Index of /php/manual/en/


../
feeds/                                             24-Apr-2024 08:00                   -
images/                                            24-Apr-2024 08:00                   -
styles/                                            24-Apr-2024 08:00                   -
toc/                                               24-Apr-2024 08:00                   -
about.formats.php                                  24-Apr-2024 08:00                4167
about.generate.php                                 24-Apr-2024 08:00                2717
about.howtohelp.php                                24-Apr-2024 08:00                3429
about.more.php                                     24-Apr-2024 08:00                1854
about.notes.php                                    24-Apr-2024 08:00                2434
about.php                                          24-Apr-2024 08:00                1890
about.phpversions.php                              24-Apr-2024 08:00                3331
about.prototypes.php                               24-Apr-2024 08:00                7480
about.translations.php                             24-Apr-2024 08:00                3173
aliases.php                                        24-Apr-2024 08:00               29111
allowdynamicproperties.construct.php               24-Apr-2024 08:00                2258
apache.configuration.php                           24-Apr-2024 08:00                5171
apache.constants.php                               24-Apr-2024 08:00                1190
apache.installation.php                            24-Apr-2024 08:00                1276
apache.requirements.php                            24-Apr-2024 08:00                1220
apache.resources.php                               24-Apr-2024 08:00                1218
apache.setup.php                                   24-Apr-2024 08:00                1627
apcu.configuration.php                             24-Apr-2024 08:00               15894
apcu.constants.php                                 24-Apr-2024 08:00                7420
apcu.installation.php                              24-Apr-2024 08:00                3233
apcu.requirements.php                              24-Apr-2024 08:00                1206
apcu.resources.php                                 24-Apr-2024 08:00                1204
apcu.setup.php                                     24-Apr-2024 08:00                1585
apcuiterator.construct.php                         24-Apr-2024 08:00                7129
apcuiterator.current.php                           24-Apr-2024 08:00                2998
apcuiterator.gettotalcount.php                     24-Apr-2024 08:00                3172
apcuiterator.gettotalhits.php                      24-Apr-2024 08:00                3308
apcuiterator.gettotalsize.php                      24-Apr-2024 08:00                3049
apcuiterator.key.php                               24-Apr-2024 08:00                2797
apcuiterator.next.php                              24-Apr-2024 08:00                3047
apcuiterator.rewind.php                            24-Apr-2024 08:00                2712
apcuiterator.valid.php                             24-Apr-2024 08:00                2935
appendices.php                                     24-Apr-2024 08:00               12128
appenditerator.append.php                          24-Apr-2024 08:00                5436
appenditerator.construct.php                       24-Apr-2024 08:00               10106
appenditerator.current.php                         24-Apr-2024 08:00                3459
appenditerator.getarrayiterator.php                24-Apr-2024 08:00                3085
appenditerator.getiteratorindex.php                24-Apr-2024 08:00                6611
appenditerator.key.php                             24-Apr-2024 08:00                7865
appenditerator.next.php                            24-Apr-2024 08:00                3351
appenditerator.rewind.php                          24-Apr-2024 08:00                3347
appenditerator.valid.php                           24-Apr-2024 08:00                3346
array.configuration.php                            24-Apr-2024 08:00                1266
array.constants.php                                24-Apr-2024 08:00               11565
array.installation.php                             24-Apr-2024 08:00                1249
array.requirements.php                             24-Apr-2024 08:00                1213
array.resources.php                                24-Apr-2024 08:00                1211
array.setup.php                                    24-Apr-2024 08:00                1594
array.sorting.php                                  24-Apr-2024 08:00                6787
arrayaccess.offsetexists.php                       24-Apr-2024 08:00                9074
arrayaccess.offsetget.php                          24-Apr-2024 08:00                4863
arrayaccess.offsetset.php                          24-Apr-2024 08:00                5133
arrayaccess.offsetunset.php                        24-Apr-2024 08:00                2817
arrayiterator.append.php                           24-Apr-2024 08:00                3519
arrayiterator.asort.php                            24-Apr-2024 08:00                7099
arrayiterator.construct.php                        24-Apr-2024 08:00                3783
arrayiterator.count.php                            24-Apr-2024 08:00                3237
arrayiterator.current.php                          24-Apr-2024 08:00                5195
arrayiterator.getarraycopy.php                     24-Apr-2024 08:00                3084
arrayiterator.getflags.php                         24-Apr-2024 08:00                3081
arrayiterator.key.php                              24-Apr-2024 08:00                4010
arrayiterator.ksort.php                            24-Apr-2024 08:00                7069
arrayiterator.natcasesort.php                      24-Apr-2024 08:00                4680
arrayiterator.natsort.php                          24-Apr-2024 08:00                4604
arrayiterator.next.php                             24-Apr-2024 08:00                4625
arrayiterator.offsetexists.php                     24-Apr-2024 08:00                3330
arrayiterator.offsetget.php                        24-Apr-2024 08:00                3358
arrayiterator.offsetset.php                        24-Apr-2024 08:00                3621
arrayiterator.offsetunset.php                      24-Apr-2024 08:00                3765
arrayiterator.rewind.php                           24-Apr-2024 08:00                4618
arrayiterator.seek.php                             24-Apr-2024 08:00                2618
arrayiterator.serialize.php                        24-Apr-2024 08:00                2879
arrayiterator.setflags.php                         24-Apr-2024 08:00                4130
arrayiterator.uasort.php                           24-Apr-2024 08:00                6340
arrayiterator.uksort.php                           24-Apr-2024 08:00                6243
arrayiterator.unserialize.php                      24-Apr-2024 08:00                3124
arrayiterator.valid.php                            24-Apr-2024 08:00                4690
arrayobject.append.php                             24-Apr-2024 08:00                5472
arrayobject.asort.php                              24-Apr-2024 08:00                9984
arrayobject.construct.php                          24-Apr-2024 08:00                6262
arrayobject.count.php                              24-Apr-2024 08:00                5391
arrayobject.exchangearray.php                      24-Apr-2024 08:00                6497
arrayobject.getarraycopy.php                       24-Apr-2024 08:00                5285
arrayobject.getflags.php                           24-Apr-2024 08:00                6108
arrayobject.getiterator.php                        24-Apr-2024 08:00                5279
arrayobject.getiteratorclass.php                   24-Apr-2024 08:00                6569
arrayobject.ksort.php                              24-Apr-2024 08:00                9660
arrayobject.natcasesort.php                        24-Apr-2024 08:00                8156
arrayobject.natsort.php                            24-Apr-2024 08:00                7883
arrayobject.offsetexists.php                       24-Apr-2024 08:00                4963
arrayobject.offsetget.php                          24-Apr-2024 08:00                5166
arrayobject.offsetset.php                          24-Apr-2024 08:00                6762
arrayobject.offsetunset.php                        24-Apr-2024 08:00                4264
arrayobject.serialize.php                          24-Apr-2024 08:00                5082
arrayobject.setflags.php                           24-Apr-2024 08:00                6705
arrayobject.setiteratorclass.php                   24-Apr-2024 08:00                5850
arrayobject.uasort.php                             24-Apr-2024 08:00               10838
arrayobject.uksort.php                             24-Apr-2024 08:00               10254
arrayobject.unserialize.php                        24-Apr-2024 08:00                3539
attribute.construct.php                            24-Apr-2024 08:00                2356
backedenum.from.php                                24-Apr-2024 08:00                6133
backedenum.tryfrom.php                             24-Apr-2024 08:00                6542
bc.configuration.php                               24-Apr-2024 08:00                2496
bc.constants.php                                   24-Apr-2024 08:00                1164
bc.installation.php                                24-Apr-2024 08:00                1445
bc.requirements.php                                24-Apr-2024 08:00                1192
bc.resources.php                                   24-Apr-2024 08:00                1190
bc.setup.php                                       24-Apr-2024 08:00                1585
book.apache.php                                    24-Apr-2024 08:00                3185
book.apcu.php                                      24-Apr-2024 08:00                4376
book.array.php                                     24-Apr-2024 08:00               11678
book.bc.php                                        24-Apr-2024 08:00                2932
book.bson.php                                      24-Apr-2024 08:00               24568
book.bzip2.php                                     24-Apr-2024 08:00                2889
book.calendar.php                                  24-Apr-2024 08:00                4033
book.classobj.php                                  24-Apr-2024 08:00                4312
book.cmark.php                                     24-Apr-2024 08:00                8782
book.com.php                                       24-Apr-2024 08:00                8022
book.componere.php                                 24-Apr-2024 08:00                6174
book.ctype.php                                     24-Apr-2024 08:00                3117
book.cubrid.php                                    24-Apr-2024 08:00               13842
book.curl.php                                      24-Apr-2024 08:00                6854
book.datetime.php                                  24-Apr-2024 08:00               16852
book.dba.php                                       24-Apr-2024 08:00                3413
book.dbase.php                                     24-Apr-2024 08:00                3219
book.dio.php                                       24-Apr-2024 08:00                2942
book.dir.php                                       24-Apr-2024 08:00                3057
book.dom.php                                       24-Apr-2024 08:00               20951
book.ds.php                                        24-Apr-2024 08:00               25134
book.eio.php                                       24-Apr-2024 08:00                7931
book.enchant.php                                   24-Apr-2024 08:00                5343
book.errorfunc.php                                 24-Apr-2024 08:00                3433
book.ev.php                                        24-Apr-2024 08:00               13369
book.event.php                                     24-Apr-2024 08:00               23133
book.exec.php                                      24-Apr-2024 08:00                3195
book.exif.php                                      24-Apr-2024 08:00                2481
book.expect.php                                    24-Apr-2024 08:00                2482
book.fann.php                                      24-Apr-2024 08:00               23097
book.fdf.php                                       24-Apr-2024 08:00                5601
book.ffi.php                                       24-Apr-2024 08:00                5641
book.fileinfo.php                                  24-Apr-2024 08:00                3042
book.filesystem.php                                24-Apr-2024 08:00                9435
book.filter.php                                    24-Apr-2024 08:00                3413
book.fpm.php                                       24-Apr-2024 08:00                1973
book.ftp.php                                       24-Apr-2024 08:00                5888
book.funchand.php                                  24-Apr-2024 08:00                3632
book.gearman.php                                   24-Apr-2024 08:00               14803
book.gender.php                                    24-Apr-2024 08:00                2587
book.geoip.php                                     24-Apr-2024 08:00                4357
book.gettext.php                                   24-Apr-2024 08:00                2930
book.gmagick.php                                   24-Apr-2024 08:00               22580
book.gmp.php                                       24-Apr-2024 08:00                6548
book.gnupg.php                                     24-Apr-2024 08:00                4861
book.hash.php                                      24-Apr-2024 08:00                4170
book.hrtime.php                                    24-Apr-2024 08:00                3523
book.ibase.php                                     24-Apr-2024 08:00               12031
book.ibm-db2.php                                   24-Apr-2024 08:00                8635
book.iconv.php                                     24-Apr-2024 08:00                3239
book.igbinary.php                                  24-Apr-2024 08:00                2139
book.image.php                                     24-Apr-2024 08:00               15158
book.imagick.php                                   24-Apr-2024 08:00               63757
book.imap.php                                      24-Apr-2024 08:00               10223
book.info.php                                      24-Apr-2024 08:00                8132
book.inotify.php                                   24-Apr-2024 08:00                2547
book.intl.php                                      24-Apr-2024 08:00               45030
book.json.php                                      24-Apr-2024 08:00                2899
book.ldap.php                                      24-Apr-2024 08:00                9134
book.libxml.php                                    24-Apr-2024 08:00                3227
book.lua.php                                       24-Apr-2024 08:00                2649
book.luasandbox.php                                24-Apr-2024 08:00                5566
book.lzf.php                                       24-Apr-2024 08:00                2190
book.mail.php                                      24-Apr-2024 08:00                2077
book.mailparse.php                                 24-Apr-2024 08:00                3910
book.math.php                                      24-Apr-2024 08:00                5338
book.mbstring.php                                  24-Apr-2024 08:00                9725
book.mcrypt.php                                    24-Apr-2024 08:00                6390
book.memcache.php                                  24-Apr-2024 08:00                4219
book.memcached.php                                 24-Apr-2024 08:00                8073
book.mhash.php                                     24-Apr-2024 08:00                2472
book.misc.php                                      24-Apr-2024 08:00                5248
book.mongodb.php                                   24-Apr-2024 08:00               26860
book.mqseries.php                                  24-Apr-2024 08:00                3177
book.mysql-xdevapi.php                             24-Apr-2024 08:00               28993
book.mysql.php                                     24-Apr-2024 08:00                7597
book.mysqli.php                                    24-Apr-2024 08:00               18047
book.mysqlnd.php                                   24-Apr-2024 08:00                2471
book.network.php                                   24-Apr-2024 08:00                5770
book.oauth.php                                     24-Apr-2024 08:00                7180
book.oci8.php                                      24-Apr-2024 08:00               16776
book.opcache.php                                   24-Apr-2024 08:00                2687
book.openal.php                                    24-Apr-2024 08:00                4428
book.openssl.php                                   24-Apr-2024 08:00               10877
book.outcontrol.php                                24-Apr-2024 08:00                5166
book.parallel.php                                  24-Apr-2024 08:00                5730
book.parle.php                                     24-Apr-2024 08:00                9266
book.password.php                                  24-Apr-2024 08:00                2564
book.pcntl.php                                     24-Apr-2024 08:00                5047
book.pcre.php                                      24-Apr-2024 08:00                3743
book.pdo.php                                       24-Apr-2024 08:00                7953
book.pgsql.php                                     24-Apr-2024 08:00               12435
book.phar.php                                      24-Apr-2024 08:00               15703
book.phpdbg.php                                    24-Apr-2024 08:00                2907
book.posix.php                                     24-Apr-2024 08:00                6726
book.ps.php                                        24-Apr-2024 08:00                9175
book.pspell.php                                    24-Apr-2024 08:00                4434
book.pthreads.php                                  24-Apr-2024 08:00                5450
book.quickhash.php                                 24-Apr-2024 08:00                8902
book.radius.php                                    24-Apr-2024 08:00                5529
book.random.php                                    24-Apr-2024 08:00                9065
book.rar.php                                       24-Apr-2024 08:00                5251
book.readline.php                                  24-Apr-2024 08:00                3654
book.recode.php                                    24-Apr-2024 08:00                2280
book.reflection.php                                24-Apr-2024 08:00               37096
book.rnp.php                                       24-Apr-2024 08:00                6046
book.rpminfo.php                                   24-Apr-2024 08:00                2493
book.rrd.php                                       24-Apr-2024 08:00                5098
book.runkit7.php                                   24-Apr-2024 08:00                4219
book.scoutapm.php                                  24-Apr-2024 08:00                2192
book.seaslog.php                                   24-Apr-2024 08:00                5185
book.sem.php                                       24-Apr-2024 08:00                4146
book.session.php                                   24-Apr-2024 08:00                7775
book.shmop.php                                     24-Apr-2024 08:00                2790
book.simdjson.php                                  24-Apr-2024 08:00                2656
book.simplexml.php                                 24-Apr-2024 08:00                5450
book.snmp.php                                      24-Apr-2024 08:00                5835
book.soap.php                                      24-Apr-2024 08:00                6084
book.sockets.php                                   24-Apr-2024 08:00                7041
book.sodium.php                                    24-Apr-2024 08:00               17305
book.solr.php                                      24-Apr-2024 08:00               53119
book.spl.php                                       24-Apr-2024 08:00                9995
book.sqlite3.php                                   24-Apr-2024 08:00                7074
book.sqlsrv.php                                    24-Apr-2024 08:00                5326
book.ssdeep.php                                    24-Apr-2024 08:00                2316
book.ssh2.php                                      24-Apr-2024 08:00                5448
book.stats.php                                     24-Apr-2024 08:00               11807
book.stomp.php                                     24-Apr-2024 08:00                4136
book.stream.php                                    24-Apr-2024 08:00               11704
book.strings.php                                   24-Apr-2024 08:00               12823
book.svm.php                                       24-Apr-2024 08:00                3671
book.svn.php                                       24-Apr-2024 08:00                7593
book.swoole.php                                    24-Apr-2024 08:00               37308
book.sync.php                                      24-Apr-2024 08:00                4761
book.taint.php                                     24-Apr-2024 08:00                2515
book.tcpwrap.php                                   24-Apr-2024 08:00                2040
book.tidy.php                                      24-Apr-2024 08:00                6573
book.tokenizer.php                                 24-Apr-2024 08:00                3095
book.trader.php                                    24-Apr-2024 08:00               17505
book.ui.php                                        24-Apr-2024 08:00               27918
book.uodbc.php                                     24-Apr-2024 08:00                7005
book.uopz.php                                      24-Apr-2024 08:00                5087
book.url.php                                       24-Apr-2024 08:00                2924
book.v8js.php                                      24-Apr-2024 08:00                3088
book.var.php                                       24-Apr-2024 08:00                5677
book.var_representation.php                        24-Apr-2024 08:00                2135
book.varnish.php                                   24-Apr-2024 08:00                5358
book.wddx.php                                      24-Apr-2024 08:00                2791
book.win32service.php                              24-Apr-2024 08:00                4002
book.wincache.php                                  24-Apr-2024 08:00                5591
book.wkhtmltox.php                                 24-Apr-2024 08:00                3296
book.xattr.php                                     24-Apr-2024 08:00                2430
book.xdiff.php                                     24-Apr-2024 08:00                4081
book.xhprof.php                                    24-Apr-2024 08:00                2436
book.xlswriter.php                                 24-Apr-2024 08:00                4408
book.xml.php                                       24-Apr-2024 08:00                5328
book.xmldiff.php                                   24-Apr-2024 08:00                3120
book.xmlreader.php                                 24-Apr-2024 08:00                4811
book.xmlrpc.php                                    24-Apr-2024 08:00                3740
book.xmlwriter.php                                 24-Apr-2024 08:00                6513
book.xsl.php                                       24-Apr-2024 08:00                3742
book.yac.php                                       24-Apr-2024 08:00                2579
book.yaconf.php                                    24-Apr-2024 08:00                2130
book.yaf.php                                       24-Apr-2024 08:00               34640
book.yaml.php                                      24-Apr-2024 08:00                2755
book.yar.php                                       24-Apr-2024 08:00                3673
book.yaz.php                                       24-Apr-2024 08:00                4342
book.zip.php                                       24-Apr-2024 08:00               10109
book.zlib.php                                      24-Apr-2024 08:00                5051
book.zmq.php                                       24-Apr-2024 08:00                5496
book.zookeeper.php                                 24-Apr-2024 08:00                6642
bzip2.configuration.php                            24-Apr-2024 08:00                1266
bzip2.constants.php                                24-Apr-2024 08:00                1179
bzip2.examples.php                                 24-Apr-2024 08:00                4059
bzip2.installation.php                             24-Apr-2024 08:00                1382
bzip2.requirements.php                             24-Apr-2024 08:00                1379
bzip2.resources.php                                24-Apr-2024 08:00                1269
bzip2.setup.php                                    24-Apr-2024 08:00                1614
cachingiterator.construct.php                      24-Apr-2024 08:00                2830
cachingiterator.count.php                          24-Apr-2024 08:00                2508
cachingiterator.current.php                        24-Apr-2024 08:00                2812
cachingiterator.getcache.php                       24-Apr-2024 08:00                5868
cachingiterator.getflags.php                       24-Apr-2024 08:00                2502
cachingiterator.hasnext.php                        24-Apr-2024 08:00                2609
cachingiterator.key.php                            24-Apr-2024 08:00                2209
cachingiterator.next.php                           24-Apr-2024 08:00                2422
cachingiterator.offsetexists.php                   24-Apr-2024 08:00                2971
cachingiterator.offsetget.php                      24-Apr-2024 08:00                2719
cachingiterator.offsetset.php                      24-Apr-2024 08:00                3085
cachingiterator.offsetunset.php                    24-Apr-2024 08:00                2758
cachingiterator.rewind.php                         24-Apr-2024 08:00                2438
cachingiterator.setflags.php                       24-Apr-2024 08:00                2790
cachingiterator.tostring.php                       24-Apr-2024 08:00                2640
cachingiterator.valid.php                          24-Apr-2024 08:00                2656
calendar.configuration.php                         24-Apr-2024 08:00                1287
calendar.constants.php                             24-Apr-2024 08:00               12984
calendar.installation.php                          24-Apr-2024 08:00                1488
calendar.requirements.php                          24-Apr-2024 08:00                1234
calendar.resources.php                             24-Apr-2024 08:00                1232
calendar.setup.php                                 24-Apr-2024 08:00                1652
callbackfilteriterator.accept.php                  24-Apr-2024 08:00                3591
callbackfilteriterator.construct.php               24-Apr-2024 08:00                3953
cc.license.php                                     24-Apr-2024 08:00               20763
changelog.misc.php                                 24-Apr-2024 08:00                1318
changelog.mysql.php                                24-Apr-2024 08:00                2528
changelog.mysql_xdevapi.php                        24-Apr-2024 08:00                2340
changelog.mysqli.php                               24-Apr-2024 08:00                1360
changelog.strings.php                              24-Apr-2024 08:00                1376
class.addressinfo.php                              24-Apr-2024 08:00                1769
class.allowdynamicproperties.php                   24-Apr-2024 08:00                4989
class.apcuiterator.php                             24-Apr-2024 08:00                7354
class.appenditerator.php                           24-Apr-2024 08:00                7895
class.argumentcounterror.php                       24-Apr-2024 08:00                8626
class.arithmeticerror.php                          24-Apr-2024 08:00                8793
class.arrayaccess.php                              24-Apr-2024 08:00               11721
class.arrayiterator.php                            24-Apr-2024 08:00               16848
class.arrayobject.php                              24-Apr-2024 08:00               16691
class.assertionerror.php                           24-Apr-2024 08:00                8503
class.attribute.php                                24-Apr-2024 08:00                8578
class.backedenum.php                               24-Apr-2024 08:00                4304
class.badfunctioncallexception.php                 24-Apr-2024 08:00                8592
class.badmethodcallexception.php                   24-Apr-2024 08:00                8610
class.cachingiterator.php                          24-Apr-2024 08:00               17245
class.callbackfilteriterator.php                   24-Apr-2024 08:00               11489
class.closedgeneratorexception.php                 24-Apr-2024 08:00                8739
class.closure.php                                  24-Apr-2024 08:00                6933
class.collator.php                                 24-Apr-2024 08:00               35455
class.collectable.php                              24-Apr-2024 08:00                2568
class.com-exception.php                            24-Apr-2024 08:00                8421
class.com-safearray-proxy.php                      24-Apr-2024 08:00                1927
class.com.php                                      24-Apr-2024 08:00               12520
class.commonmark-cql.php                           24-Apr-2024 08:00                7361
class.commonmark-interfaces-ivisitable.php         24-Apr-2024 08:00                3009
class.commonmark-interfaces-ivisitor.php           24-Apr-2024 08:00                4602
class.commonmark-node-blockquote.php               24-Apr-2024 08:00                8458
class.commonmark-node-bulletlist.php               24-Apr-2024 08:00               10633
class.commonmark-node-code.php                     24-Apr-2024 08:00                9452
class.commonmark-node-codeblock.php                24-Apr-2024 08:00               10837
class.commonmark-node-customblock.php              24-Apr-2024 08:00                9206
class.commonmark-node-custominline.php             24-Apr-2024 08:00                9186
class.commonmark-node-document.php                 24-Apr-2024 08:00                8415
class.commonmark-node-heading.php                  24-Apr-2024 08:00                9814
class.commonmark-node-htmlblock.php                24-Apr-2024 08:00                9510
class.commonmark-node-htmlinline.php               24-Apr-2024 08:00                9486
class.commonmark-node-image.php                    24-Apr-2024 08:00               10722
class.commonmark-node-item.php                     24-Apr-2024 08:00                8425
class.commonmark-node-linebreak.php                24-Apr-2024 08:00                8439
class.commonmark-node-link.php                     24-Apr-2024 08:00               10715
class.commonmark-node-orderedlist.php              24-Apr-2024 08:00               11599
class.commonmark-node-paragraph.php                24-Apr-2024 08:00                8464
class.commonmark-node-softbreak.php                24-Apr-2024 08:00                8457
class.commonmark-node-text-emphasis.php            24-Apr-2024 08:00                8486
class.commonmark-node-text-strong.php              24-Apr-2024 08:00                8475
class.commonmark-node-text.php                     24-Apr-2024 08:00                9852
class.commonmark-node-thematicbreak.php            24-Apr-2024 08:00                8486
class.commonmark-node.php                          24-Apr-2024 08:00                9378
class.commonmark-parser.php                        24-Apr-2024 08:00                3861
class.compersisthelper.php                         24-Apr-2024 08:00                7493
class.compileerror.php                             24-Apr-2024 08:00                8422
class.componere-abstract-definition.php            24-Apr-2024 08:00                4761
class.componere-definition.php                     24-Apr-2024 08:00               10271
class.componere-method.php                         24-Apr-2024 08:00                4353
class.componere-patch.php                          24-Apr-2024 08:00                8366
class.componere-value.php                          24-Apr-2024 08:00                5456
class.countable.php                                24-Apr-2024 08:00                2586
class.curlfile.php                                 24-Apr-2024 08:00                8251
class.curlhandle.php                               24-Apr-2024 08:00                1780
class.curlmultihandle.php                          24-Apr-2024 08:00                1819
class.curlsharehandle.php                          24-Apr-2024 08:00                1815
class.curlstringfile.php                           24-Apr-2024 08:00                5626
class.dateerror.php                                24-Apr-2024 08:00                9044
class.dateexception.php                            24-Apr-2024 08:00                9694
class.dateinterval.php                             24-Apr-2024 08:00               13930
class.dateinvalidoperationexception.php            24-Apr-2024 08:00                9157
class.dateinvalidtimezoneexception.php             24-Apr-2024 08:00                8735
class.datemalformedintervalstringexception.php     24-Apr-2024 08:00                8834
class.datemalformedperiodstringexception.php       24-Apr-2024 08:00                8816
class.datemalformedstringexception.php             24-Apr-2024 08:00                9115
class.dateobjecterror.php                          24-Apr-2024 08:00                8870
class.dateperiod.php                               24-Apr-2024 08:00               22196
class.daterangeerror.php                           24-Apr-2024 08:00                9058
class.datetime.php                                 24-Apr-2024 08:00               23268
class.datetimeimmutable.php                        24-Apr-2024 08:00               23402
class.datetimeinterface.php                        24-Apr-2024 08:00               20080
class.datetimezone.php                             24-Apr-2024 08:00               15585
class.deflatecontext.php                           24-Apr-2024 08:00                1834
class.directory.php                                24-Apr-2024 08:00                5529
class.directoryiterator.php                        24-Apr-2024 08:00               20028
class.divisionbyzeroerror.php                      24-Apr-2024 08:00                8480
class.domainexception.php                          24-Apr-2024 08:00                8525
class.domattr.php                                  24-Apr-2024 08:00               28284
class.domcdatasection.php                          24-Apr-2024 08:00               32134
class.domcharacterdata.php                         24-Apr-2024 08:00               33391
class.domchildnode.php                             24-Apr-2024 08:00                4245
class.domcomment.php                               24-Apr-2024 08:00               30803
class.domdocument.php                              24-Apr-2024 08:00               68208
class.domdocumentfragment.php                      24-Apr-2024 08:00               29147
class.domdocumenttype.php                          24-Apr-2024 08:00               27269
class.domelement.php                               24-Apr-2024 08:00               53103
class.domentity.php                                24-Apr-2024 08:00               27909
class.domentityreference.php                       24-Apr-2024 08:00               23404
class.domexception.php                             24-Apr-2024 08:00                9342
class.domimplementation.php                        24-Apr-2024 08:00                6050
class.domnamednodemap.php                          24-Apr-2024 08:00                7390
class.domnamespacenode.php                         24-Apr-2024 08:00                9420
class.domnode.php                                  24-Apr-2024 08:00               32494
class.domnodelist.php                              24-Apr-2024 08:00                6008
class.domnotation.php                              24-Apr-2024 08:00               23674
class.domparentnode.php                            24-Apr-2024 08:00                3915
class.domprocessinginstruction.php                 24-Apr-2024 08:00               24932
class.domtext.php                                  24-Apr-2024 08:00               33733
class.domxpath.php                                 24-Apr-2024 08:00                8714
class.dotnet.php                                   24-Apr-2024 08:00                6939
class.ds-collection.php                            24-Apr-2024 08:00                6019
class.ds-deque.php                                 24-Apr-2024 08:00               22121
class.ds-hashable.php                              24-Apr-2024 08:00                4133
class.ds-map.php                                   24-Apr-2024 08:00               23061
class.ds-pair.php                                  24-Apr-2024 08:00                4605
class.ds-priorityqueue.php                         24-Apr-2024 08:00                8375
class.ds-queue.php                                 24-Apr-2024 08:00                7864
class.ds-sequence.php                              24-Apr-2024 08:00               23628
class.ds-set.php                                   24-Apr-2024 08:00               18592
class.ds-stack.php                                 24-Apr-2024 08:00                7196
class.ds-vector.php                                24-Apr-2024 08:00               21657
class.emptyiterator.php                            24-Apr-2024 08:00                4088
class.enchantbroker.php                            24-Apr-2024 08:00                1846
class.enchantdictionary.php                        24-Apr-2024 08:00                1836
class.error.php                                    24-Apr-2024 08:00               10802
class.errorexception.php                           24-Apr-2024 08:00               14502
class.ev.php                                       24-Apr-2024 08:00               42350
class.evcheck.php                                  24-Apr-2024 08:00               10856
class.evchild.php                                  24-Apr-2024 08:00               12527
class.evembed.php                                  24-Apr-2024 08:00               10025
class.event.php                                    24-Apr-2024 08:00               18443
class.eventbase.php                                24-Apr-2024 08:00               14917
class.eventbuffer.php                              24-Apr-2024 08:00               23402
class.eventbufferevent.php                         24-Apr-2024 08:00               37899
class.eventconfig.php                              24-Apr-2024 08:00                7851
class.eventdnsbase.php                             24-Apr-2024 08:00               14286
class.eventexception.php                           24-Apr-2024 08:00                8548
class.eventhttp.php                                24-Apr-2024 08:00                9719
class.eventhttpconnection.php                      24-Apr-2024 08:00               10535
class.eventhttprequest.php                         24-Apr-2024 08:00               22872
class.eventlistener.php                            24-Apr-2024 08:00               12803
class.eventsslcontext.php                          24-Apr-2024 08:00               19168
class.eventutil.php                                24-Apr-2024 08:00               25571
class.evfork.php                                   24-Apr-2024 08:00                9022
class.evidle.php                                   24-Apr-2024 08:00                9849
class.evio.php                                     24-Apr-2024 08:00               12634
class.evloop.php                                   24-Apr-2024 08:00               31539
class.evperiodic.php                               24-Apr-2024 08:00               14949
class.evprepare.php                                24-Apr-2024 08:00               10995
class.evsignal.php                                 24-Apr-2024 08:00               11938
class.evstat.php                                   24-Apr-2024 08:00               14414
class.evtimer.php                                  24-Apr-2024 08:00               14327
class.evwatcher.php                                24-Apr-2024 08:00               10000
class.exception.php                                24-Apr-2024 08:00               11014
class.fannconnection.php                           24-Apr-2024 08:00                6571
class.ffi-cdata.php                                24-Apr-2024 08:00                6171
class.ffi-ctype.php                                24-Apr-2024 08:00               31269
class.ffi-exception.php                            24-Apr-2024 08:00                8234
class.ffi-parserexception.php                      24-Apr-2024 08:00                8289
class.ffi.php                                      24-Apr-2024 08:00               18401
class.fiber.php                                    24-Apr-2024 08:00                7708
class.fibererror.php                               24-Apr-2024 08:00                8156
class.filesystemiterator.php                       24-Apr-2024 08:00               31786
class.filteriterator.php                           24-Apr-2024 08:00                7333
class.finfo.php                                    24-Apr-2024 08:00                6257
class.ftp-connection.php                           24-Apr-2024 08:00                1808
class.gdfont.php                                   24-Apr-2024 08:00                1733
class.gdimage.php                                  24-Apr-2024 08:00                1729
class.gearmanclient.php                            24-Apr-2024 08:00               37795
class.gearmanexception.php                         24-Apr-2024 08:00                7233
class.gearmanjob.php                               24-Apr-2024 08:00                9257
class.gearmantask.php                              24-Apr-2024 08:00                8900
class.gearmanworker.php                            24-Apr-2024 08:00               13471
class.gender.php                                   24-Apr-2024 08:00               42242
class.generator.php                                24-Apr-2024 08:00                6511
class.globiterator.php                             24-Apr-2024 08:00               26517
class.gmagick.php                                  24-Apr-2024 08:00               87075
class.gmagickdraw.php                              24-Apr-2024 08:00               24475
class.gmagickpixel.php                             24-Apr-2024 08:00                5952
class.gmp.php                                      24-Apr-2024 08:00                4234
class.hashcontext.php                              24-Apr-2024 08:00                3364
class.hrtime-performancecounter.php                24-Apr-2024 08:00                3855
class.hrtime-stopwatch.php                         24-Apr-2024 08:00                7070
class.hrtime-unit.php                              24-Apr-2024 08:00                4434
class.imagick.php                                  24-Apr-2024 08:00              286419
class.imagickdraw.php                              24-Apr-2024 08:00               82912
class.imagickkernel.php                            24-Apr-2024 08:00                6567
class.imagickpixel.php                             24-Apr-2024 08:00               13877
class.imagickpixeliterator.php                     24-Apr-2024 08:00                9652
class.imap-connection.php                          24-Apr-2024 08:00                1811
class.infiniteiterator.php                         24-Apr-2024 08:00                5318
class.inflatecontext.php                           24-Apr-2024 08:00                1819
class.internaliterator.php                         24-Apr-2024 08:00                4772
class.intlbreakiterator.php                        24-Apr-2024 08:00               30522
class.intlcalendar.php                             24-Apr-2024 08:00               72243
class.intlchar.php                                 24-Apr-2024 08:00              473342
class.intlcodepointbreakiterator.php               24-Apr-2024 08:00               21551
class.intldateformatter.php                        24-Apr-2024 08:00               32351
class.intldatepatterngenerator.php                 24-Apr-2024 08:00                4771
class.intlexception.php                            24-Apr-2024 08:00                8645
class.intlgregoriancalendar.php                    24-Apr-2024 08:00               53270
class.intliterator.php                             24-Apr-2024 08:00                5076
class.intlpartsiterator.php                        24-Apr-2024 08:00                7157
class.intlrulebasedbreakiterator.php               24-Apr-2024 08:00               24466
class.intltimezone.php                             24-Apr-2024 08:00               28360
class.invalidargumentexception.php                 24-Apr-2024 08:00                8548
class.iterator.php                                 24-Apr-2024 08:00               11355
class.iteratoraggregate.php                        24-Apr-2024 08:00                6260
class.iteratoriterator.php                         24-Apr-2024 08:00                6315
class.jsonexception.php                            24-Apr-2024 08:00                8925
class.jsonserializable.php                         24-Apr-2024 08:00                2806
class.ldap-connection.php                          24-Apr-2024 08:00                1831
class.ldap-result-entry.php                        24-Apr-2024 08:00                1846
class.ldap-result.php                              24-Apr-2024 08:00                1823
class.lengthexception.php                          24-Apr-2024 08:00                8474
class.libxmlerror.php                              24-Apr-2024 08:00                5731
class.limititerator.php                            24-Apr-2024 08:00               11263
class.locale.php                                   24-Apr-2024 08:00               28510
class.logicexception.php                           24-Apr-2024 08:00                8534
class.lua.php                                      24-Apr-2024 08:00                7780
class.luaclosure.php                               24-Apr-2024 08:00                2705
class.luasandbox.php                               24-Apr-2024 08:00               14178
class.luasandboxerror.php                          24-Apr-2024 08:00               10109
class.luasandboxerrorerror.php                     24-Apr-2024 08:00                7647
class.luasandboxfatalerror.php                     24-Apr-2024 08:00                7769
class.luasandboxfunction.php                       24-Apr-2024 08:00                3964
class.luasandboxmemoryerror.php                    24-Apr-2024 08:00                7956
class.luasandboxruntimeerror.php                   24-Apr-2024 08:00                7789
class.luasandboxsyntaxerror.php                    24-Apr-2024 08:00                7651
class.luasandboxtimeouterror.php                   24-Apr-2024 08:00                7940
class.memcache.php                                 24-Apr-2024 08:00               19191
class.memcached.php                                24-Apr-2024 08:00               47523
class.memcachedexception.php                       24-Apr-2024 08:00                7530
class.messageformatter.php                         24-Apr-2024 08:00               12159
class.mongodb-bson-binary.php                      24-Apr-2024 08:00               16921
class.mongodb-bson-binaryinterface.php             24-Apr-2024 08:00                4749
class.mongodb-bson-dbpointer.php                   24-Apr-2024 08:00                6070
class.mongodb-bson-decimal128.php                  24-Apr-2024 08:00                7849
class.mongodb-bson-decimal128interface.php         24-Apr-2024 08:00                3876
class.mongodb-bson-document.php                    24-Apr-2024 08:00               11345
class.mongodb-bson-int64.php                       24-Apr-2024 08:00                7540
class.mongodb-bson-iterator.php                    24-Apr-2024 08:00                5029
class.mongodb-bson-javascript.php                  24-Apr-2024 08:00                8797
class.mongodb-bson-javascriptinterface.php         24-Apr-2024 08:00                4979
class.mongodb-bson-maxkey.php                      24-Apr-2024 08:00                5896
class.mongodb-bson-maxkeyinterface.php             24-Apr-2024 08:00                2243
class.mongodb-bson-minkey.php                      24-Apr-2024 08:00                5887
class.mongodb-bson-minkeyinterface.php             24-Apr-2024 08:00                2224
class.mongodb-bson-objectid.php                    24-Apr-2024 08:00                9261
class.mongodb-bson-objectidinterface.php           24-Apr-2024 08:00                4366
class.mongodb-bson-packedarray.php                 24-Apr-2024 08:00                9131
class.mongodb-bson-persistable.php                 24-Apr-2024 08:00                6184
class.mongodb-bson-regex.php                       24-Apr-2024 08:00                8228
class.mongodb-bson-regexinterface.php              24-Apr-2024 08:00                4768
class.mongodb-bson-serializable.php                24-Apr-2024 08:00                4267
class.mongodb-bson-symbol.php                      24-Apr-2024 08:00                5958
class.mongodb-bson-timestamp.php                   24-Apr-2024 08:00                8475
class.mongodb-bson-timestampinterface.php          24-Apr-2024 08:00                4926
class.mongodb-bson-type.php                        24-Apr-2024 08:00                2073
class.mongodb-bson-undefined.php                   24-Apr-2024 08:00                6046
class.mongodb-bson-unserializable.php              24-Apr-2024 08:00                4010
class.mongodb-bson-utcdatetime.php                 24-Apr-2024 08:00                8080
class.mongodb-bson-utcdatetimeinterface.php        24-Apr-2024 08:00                4439
class.mongodb-driver-bulkwrite.php                 24-Apr-2024 08:00               24152
class.mongodb-driver-clientencryption.php          24-Apr-2024 08:00               23488
class.mongodb-driver-command.php                   24-Apr-2024 08:00               14268
class.mongodb-driver-cursor.php                    24-Apr-2024 08:00               25844
class.mongodb-driver-cursorid.php                  24-Apr-2024 08:00                5589
class.mongodb-driver-cursorinterface.php           24-Apr-2024 08:00                6227
class.mongodb-driver-exception-authenticationex..> 24-Apr-2024 08:00                9201
class.mongodb-driver-exception-bulkwriteexcepti..> 24-Apr-2024 08:00               10055
class.mongodb-driver-exception-commandexception..> 24-Apr-2024 08:00               10956
class.mongodb-driver-exception-connectionexcept..> 24-Apr-2024 08:00                9270
class.mongodb-driver-exception-connectiontimeou..> 24-Apr-2024 08:00                9658
class.mongodb-driver-exception-encryptionexcept..> 24-Apr-2024 08:00                9204
class.mongodb-driver-exception-exception.php       24-Apr-2024 08:00                2238
class.mongodb-driver-exception-executiontimeout..> 24-Apr-2024 08:00               10308
class.mongodb-driver-exception-invalidargumente..> 24-Apr-2024 08:00                8230
class.mongodb-driver-exception-logicexception.php  24-Apr-2024 08:00                8114
class.mongodb-driver-exception-runtimeexception..> 24-Apr-2024 08:00               11704
class.mongodb-driver-exception-serverexception.php 24-Apr-2024 08:00                9281
class.mongodb-driver-exception-sslconnectionexc..> 24-Apr-2024 08:00                9548
class.mongodb-driver-exception-unexpectedvaluee..> 24-Apr-2024 08:00                8247
class.mongodb-driver-exception-writeexception.php  24-Apr-2024 08:00               12222
class.mongodb-driver-manager.php                   24-Apr-2024 08:00               21856
class.mongodb-driver-monitoring-commandfailedev..> 24-Apr-2024 08:00                8102
class.mongodb-driver-monitoring-commandstartede..> 24-Apr-2024 08:00                7606
class.mongodb-driver-monitoring-commandsubscrib..> 24-Apr-2024 08:00                6316
class.mongodb-driver-monitoring-commandsucceede..> 24-Apr-2024 08:00                7684
class.mongodb-driver-monitoring-logsubscriber.php  24-Apr-2024 08:00               10165
class.mongodb-driver-monitoring-sdamsubscriber.php 24-Apr-2024 08:00               11666
class.mongodb-driver-monitoring-serverchangedev..> 24-Apr-2024 08:00                5796
class.mongodb-driver-monitoring-serverclosedeve..> 24-Apr-2024 08:00                4443
class.mongodb-driver-monitoring-serverheartbeat..> 24-Apr-2024 08:00                5794
class.mongodb-driver-monitoring-serverheartbeat..> 24-Apr-2024 08:00                4621
class.mongodb-driver-monitoring-serverheartbeat..> 24-Apr-2024 08:00                5866
class.mongodb-driver-monitoring-serveropeningev..> 24-Apr-2024 08:00                4463
class.mongodb-driver-monitoring-subscriber.php     24-Apr-2024 08:00                2688
class.mongodb-driver-monitoring-topologychanged..> 24-Apr-2024 08:00                4791
class.mongodb-driver-monitoring-topologyclosede..> 24-Apr-2024 08:00                3402
class.mongodb-driver-monitoring-topologyopening..> 24-Apr-2024 08:00                3416
class.mongodb-driver-query.php                     24-Apr-2024 08:00                3475
class.mongodb-driver-readconcern.php               24-Apr-2024 08:00               17738
class.mongodb-driver-readpreference.php            24-Apr-2024 08:00               21952
class.mongodb-driver-server.php                    24-Apr-2024 08:00               27222
class.mongodb-driver-serverapi.php                 24-Apr-2024 08:00               14126
class.mongodb-driver-serverdescription.php         24-Apr-2024 08:00               16927
class.mongodb-driver-session.php                   24-Apr-2024 08:00               15586
class.mongodb-driver-topologydescription.php       24-Apr-2024 08:00               11691
class.mongodb-driver-writeconcern.php              24-Apr-2024 08:00               10337
class.mongodb-driver-writeconcernerror.php         24-Apr-2024 08:00                4434
class.mongodb-driver-writeerror.php                24-Apr-2024 08:00                4758
class.mongodb-driver-writeresult.php               24-Apr-2024 08:00                8736
class.multipleiterator.php                         24-Apr-2024 08:00               11570
class.mysql-xdevapi-baseresult.php                 24-Apr-2024 08:00                3099
class.mysql-xdevapi-client.php                     24-Apr-2024 08:00                3181
class.mysql-xdevapi-collection.php                 24-Apr-2024 08:00               10857
class.mysql-xdevapi-collectionadd.php              24-Apr-2024 08:00                3000
class.mysql-xdevapi-collectionfind.php             24-Apr-2024 08:00                8880
class.mysql-xdevapi-collectionmodify.php           24-Apr-2024 08:00               10337
class.mysql-xdevapi-collectionremove.php           24-Apr-2024 08:00                5274
class.mysql-xdevapi-columnresult.php               24-Apr-2024 08:00                6824
class.mysql-xdevapi-crudoperationbindable.php      24-Apr-2024 08:00                3036
class.mysql-xdevapi-crudoperationlimitable.php     24-Apr-2024 08:00                3042
class.mysql-xdevapi-crudoperationskippable.php     24-Apr-2024 08:00                3053
class.mysql-xdevapi-crudoperationsortable.php      24-Apr-2024 08:00                3029
class.mysql-xdevapi-databaseobject.php             24-Apr-2024 08:00                3600
class.mysql-xdevapi-docresult.php                  24-Apr-2024 08:00                4102
class.mysql-xdevapi-exception.php                  24-Apr-2024 08:00                2254
class.mysql-xdevapi-executable.php                 24-Apr-2024 08:00                2678
class.mysql-xdevapi-executionstatus.php            24-Apr-2024 08:00                4917
class.mysql-xdevapi-expression.php                 24-Apr-2024 08:00                3310
class.mysql-xdevapi-result.php                     24-Apr-2024 08:00                4486
class.mysql-xdevapi-rowresult.php                  24-Apr-2024 08:00                5199
class.mysql-xdevapi-schema.php                     24-Apr-2024 08:00                7911
class.mysql-xdevapi-schemaobject.php               24-Apr-2024 08:00                2863
class.mysql-xdevapi-session.php                    24-Apr-2024 08:00                9763
class.mysql-xdevapi-sqlstatement.php               24-Apr-2024 08:00                6719
class.mysql-xdevapi-sqlstatementresult.php         24-Apr-2024 08:00                7381
class.mysql-xdevapi-statement.php                  24-Apr-2024 08:00                5081
class.mysql-xdevapi-table.php                      24-Apr-2024 08:00                7480
class.mysql-xdevapi-tabledelete.php                24-Apr-2024 08:00                5239
class.mysql-xdevapi-tableinsert.php                24-Apr-2024 08:00                3560
class.mysql-xdevapi-tableselect.php                24-Apr-2024 08:00                8384
class.mysql-xdevapi-tableupdate.php                24-Apr-2024 08:00                6174
class.mysql-xdevapi-warning.php                    24-Apr-2024 08:00                3807
class.mysqli-driver.php                            24-Apr-2024 08:00                8057
class.mysqli-result.php                            24-Apr-2024 08:00               16107
class.mysqli-sql-exception.php                     24-Apr-2024 08:00               10081
class.mysqli-stmt.php                              24-Apr-2024 08:00               18804
class.mysqli-warning.php                           24-Apr-2024 08:00                4438
class.mysqli.php                                   24-Apr-2024 08:00               44945
class.norewinditerator.php                         24-Apr-2024 08:00                6755
class.normalizer.php                               24-Apr-2024 08:00               13640
class.numberformatter.php                          24-Apr-2024 08:00               74173
class.oauth.php                                    24-Apr-2024 08:00               20051
class.oauthexception.php                           24-Apr-2024 08:00                8575
class.oauthprovider.php                            24-Apr-2024 08:00               12977
class.ocicollection.php                            24-Apr-2024 08:00                7155
class.ocilob.php                                   24-Apr-2024 08:00               15378
class.opensslasymmetrickey.php                     24-Apr-2024 08:00                1909
class.opensslcertificate.php                       24-Apr-2024 08:00                1913
class.opensslcertificatesigningrequest.php         24-Apr-2024 08:00                2000
class.outeriterator.php                            24-Apr-2024 08:00                4370
class.outofboundsexception.php                     24-Apr-2024 08:00                8583
class.outofrangeexception.php                      24-Apr-2024 08:00                8585
class.overflowexception.php                        24-Apr-2024 08:00                8504
class.override.php                                 24-Apr-2024 08:00                4040
class.parallel-channel.php                         24-Apr-2024 08:00                8255
class.parallel-events-event-type.php               24-Apr-2024 08:00                3414
class.parallel-events-event.php                    24-Apr-2024 08:00                3567
class.parallel-events-input.php                    24-Apr-2024 08:00                4801
class.parallel-events.php                          24-Apr-2024 08:00                7175
class.parallel-future.php                          24-Apr-2024 08:00                7842
class.parallel-runtime.php                         24-Apr-2024 08:00                6451
class.parallel-sync.php                            24-Apr-2024 08:00                5276
class.parentiterator.php                           24-Apr-2024 08:00                9643
class.parle-errorinfo.php                          24-Apr-2024 08:00                3899
class.parle-lexer.php                              24-Apr-2024 08:00               13232
class.parle-lexerexception.php                     24-Apr-2024 08:00                7783
class.parle-parser.php                             24-Apr-2024 08:00               18160
class.parle-parserexception.php                    24-Apr-2024 08:00                7765
class.parle-rlexer.php                             24-Apr-2024 08:00               15467
class.parle-rparser.php                            24-Apr-2024 08:00               18333
class.parle-stack.php                              24-Apr-2024 08:00                4867
class.parle-token.php                              24-Apr-2024 08:00                4962
class.parseerror.php                               24-Apr-2024 08:00                8938
class.pdo.php                                      24-Apr-2024 08:00               42687
class.pdoexception.php                             24-Apr-2024 08:00               10399
class.pdorow.php                                   24-Apr-2024 08:00                4087
class.pdostatement.php                             24-Apr-2024 08:00               23053
class.pgsql-connection.php                         24-Apr-2024 08:00                1854
class.pgsql-lob.php                                24-Apr-2024 08:00                1796
class.pgsql-result.php                             24-Apr-2024 08:00                1828
class.phar.php                                     24-Apr-2024 08:00               74234
class.phardata.php                                 24-Apr-2024 08:00               49639
class.pharexception.php                            24-Apr-2024 08:00                8474
class.pharfileinfo.php                             24-Apr-2024 08:00               21699
class.php-user-filter.php                          24-Apr-2024 08:00                6477
class.phptoken.php                                 24-Apr-2024 08:00                8788
class.pool.php                                     24-Apr-2024 08:00                7753
class.pspell-config.php                            24-Apr-2024 08:00                1830
class.pspell-dictionary.php                        24-Apr-2024 08:00                1867
class.quickhashinthash.php                         24-Apr-2024 08:00               15143
class.quickhashintset.php                          24-Apr-2024 08:00               12921
class.quickhashintstringhash.php                   24-Apr-2024 08:00               16039
class.quickhashstringinthash.php                   24-Apr-2024 08:00               13708
class.random-brokenrandomengineerror.php           24-Apr-2024 08:00                8572
class.random-cryptosafeengine.php                  24-Apr-2024 08:00                2514
class.random-engine-mt19937.php                    24-Apr-2024 08:00                5410
class.random-engine-pcgoneseq128xslrr64.php        24-Apr-2024 08:00                6224
class.random-engine-secure.php                     24-Apr-2024 08:00                3451
class.random-engine-xoshiro256starstar.php         24-Apr-2024 08:00                6409
class.random-engine.php                            24-Apr-2024 08:00                3808
class.random-randomerror.php                       24-Apr-2024 08:00                8496
class.random-randomexception.php                   24-Apr-2024 08:00                8610
class.random-randomizer.php                        24-Apr-2024 08:00               10612
class.rangeexception.php                           24-Apr-2024 08:00                8713
class.rararchive.php                               24-Apr-2024 08:00                7771
class.rarentry.php                                 24-Apr-2024 08:00               49830
class.rarexception.php                             24-Apr-2024 08:00                8333
class.recursivearrayiterator.php                   24-Apr-2024 08:00               15948
class.recursivecachingiterator.php                 24-Apr-2024 08:00               14156
class.recursivecallbackfilteriterator.php          24-Apr-2024 08:00               13231
class.recursivedirectoryiterator.php               24-Apr-2024 08:00               29850
class.recursivefilteriterator.php                  24-Apr-2024 08:00                8274
class.recursiveiterator.php                        24-Apr-2024 08:00                4908
class.recursiveiteratoriterator.php                24-Apr-2024 08:00               14672
class.recursiveregexiterator.php                   24-Apr-2024 08:00               14789
class.recursivetreeiterator.php                    24-Apr-2024 08:00               25684
class.reflection.php                               24-Apr-2024 08:00                3476
class.reflectionattribute.php                      24-Apr-2024 08:00                6425
class.reflectionclass.php                          24-Apr-2024 08:00               37521
class.reflectionclassconstant.php                  24-Apr-2024 08:00               16277
class.reflectionenum.php                           24-Apr-2024 08:00               31532
class.reflectionenumbackedcase.php                 24-Apr-2024 08:00               12976
class.reflectionenumunitcase.php                   24-Apr-2024 08:00               12597
class.reflectionexception.php                      24-Apr-2024 08:00                8446
class.reflectionextension.php                      24-Apr-2024 08:00               10611
class.reflectionfiber.php                          24-Apr-2024 08:00                5002
class.reflectionfunction.php                       24-Apr-2024 08:00               21264
class.reflectionfunctionabstract.php               24-Apr-2024 08:00               19892
class.reflectiongenerator.php                      24-Apr-2024 08:00                6375
class.reflectionintersectiontype.php               24-Apr-2024 08:00                3481
class.reflectionmethod.php                         24-Apr-2024 08:00               32850
class.reflectionnamedtype.php                      24-Apr-2024 08:00                3793
class.reflectionobject.php                         24-Apr-2024 08:00               29311
class.reflectionparameter.php                      24-Apr-2024 08:00               16536
class.reflectionproperty.php                       24-Apr-2024 08:00               22195
class.reflectionreference.php                      24-Apr-2024 08:00                4176
class.reflectiontype.php                           24-Apr-2024 08:00                4516
class.reflectionuniontype.php                      24-Apr-2024 08:00                3365
class.reflectionzendextension.php                  24-Apr-2024 08:00                7900
class.reflector.php                                24-Apr-2024 08:00                3925
class.regexiterator.php                            24-Apr-2024 08:00               17639
class.resourcebundle.php                           24-Apr-2024 08:00               10459
class.returntypewillchange.php                     24-Apr-2024 08:00                3175
class.rnpffi.php                                   24-Apr-2024 08:00                1687
class.rrdcreator.php                               24-Apr-2024 08:00                4532
class.rrdgraph.php                                 24-Apr-2024 08:00                3954
class.rrdupdater.php                               24-Apr-2024 08:00                3340
class.runtimeexception.php                         24-Apr-2024 08:00                8491
class.seaslog.php                                  24-Apr-2024 08:00               21990
class.seekableiterator.php                         24-Apr-2024 08:00               11363
class.sensitiveparameter.php                       24-Apr-2024 08:00                6335
class.sensitiveparametervalue.php                  24-Apr-2024 08:00                4974
class.serializable.php                             24-Apr-2024 08:00                8124
class.sessionhandler.php                           24-Apr-2024 08:00               25286
class.sessionhandlerinterface.php                  24-Apr-2024 08:00               15519
class.sessionidinterface.php                       24-Apr-2024 08:00                3201
class.sessionupdatetimestamphandlerinterface.php   24-Apr-2024 08:00                4445
class.shmop.php                                    24-Apr-2024 08:00                1728
class.simdjsonexception.php                        24-Apr-2024 08:00                5061
class.simdjsonvalueerror.php                       24-Apr-2024 08:00                8362
class.simplexmlelement.php                         24-Apr-2024 08:00               18638
class.simplexmliterator.php                        24-Apr-2024 08:00               16654
class.snmp.php                                     24-Apr-2024 08:00               28323
class.snmpexception.php                            24-Apr-2024 08:00                9077
class.soapclient.php                               24-Apr-2024 08:00               34292
class.soapfault.php                                24-Apr-2024 08:00               14344
class.soapheader.php                               24-Apr-2024 08:00                6073
class.soapparam.php                                24-Apr-2024 08:00                3751
class.soapserver.php                               24-Apr-2024 08:00                9947
class.soapvar.php                                  24-Apr-2024 08:00                7885
class.socket.php                                   24-Apr-2024 08:00                1792
class.sodiumexception.php                          24-Apr-2024 08:00                8419
class.solrclient.php                               24-Apr-2024 08:00               24753
class.solrclientexception.php                      24-Apr-2024 08:00                9729
class.solrcollapsefunction.php                     24-Apr-2024 08:00               11813
class.solrdismaxquery.php                          24-Apr-2024 08:00              111912
class.solrdocument.php                             24-Apr-2024 08:00               23468
class.solrdocumentfield.php                        24-Apr-2024 08:00                4678
class.solrexception.php                            24-Apr-2024 08:00               10115
class.solrgenericresponse.php                      24-Apr-2024 08:00               12677
class.solrillegalargumentexception.php             24-Apr-2024 08:00                9853
class.solrillegaloperationexception.php            24-Apr-2024 08:00                9891
class.solrinputdocument.php                        24-Apr-2024 08:00               19507
class.solrmissingmandatoryparameterexception.php   24-Apr-2024 08:00                9012
class.solrmodifiableparams.php                     24-Apr-2024 08:00                9000
class.solrobject.php                               24-Apr-2024 08:00                5870
class.solrparams.php                               24-Apr-2024 08:00                9155
class.solrpingresponse.php                         24-Apr-2024 08:00               11149
class.solrquery.php                                24-Apr-2024 08:00              119015
class.solrqueryresponse.php                        24-Apr-2024 08:00               12596
class.solrresponse.php                             24-Apr-2024 08:00               14345
class.solrserverexception.php                      24-Apr-2024 08:00                9735
class.solrupdateresponse.php                       24-Apr-2024 08:00               12644
class.solrutils.php                                24-Apr-2024 08:00                4970
class.spldoublylinkedlist.php                      24-Apr-2024 08:00               17476
class.splfileinfo.php                              24-Apr-2024 08:00               18048
class.splfileobject.php                            24-Apr-2024 08:00               37266
class.splfixedarray.php                            24-Apr-2024 08:00               19882
class.splheap.php                                  24-Apr-2024 08:00                7782
class.splmaxheap.php                               24-Apr-2024 08:00                7219
class.splminheap.php                               24-Apr-2024 08:00                7229
class.splobjectstorage.php                         24-Apr-2024 08:00               21105
class.splobserver.php                              24-Apr-2024 08:00                2855
class.splpriorityqueue.php                         24-Apr-2024 08:00               11814
class.splqueue.php                                 24-Apr-2024 08:00               17178
class.splstack.php                                 24-Apr-2024 08:00               14394
class.splsubject.php                               24-Apr-2024 08:00                3724
class.spltempfileobject.php                        24-Apr-2024 08:00               31830
class.spoofchecker.php                             24-Apr-2024 08:00               17613
class.sqlite3.php                                  24-Apr-2024 08:00               39702
class.sqlite3exception.php                         24-Apr-2024 08:00                8415
class.sqlite3result.php                            24-Apr-2024 08:00                5836
class.sqlite3stmt.php                              24-Apr-2024 08:00                8316
class.stdclass.php                                 24-Apr-2024 08:00                6623
class.stomp.php                                    24-Apr-2024 08:00               21696
class.stompexception.php                           24-Apr-2024 08:00                5889
class.stompframe.php                               24-Apr-2024 08:00                4377
class.streamwrapper.php                            24-Apr-2024 08:00               20257
class.stringable.php                               24-Apr-2024 08:00                8185
class.svm.php                                      24-Apr-2024 08:00               18482
class.svmmodel.php                                 24-Apr-2024 08:00                6952
class.swoole-async.php                             24-Apr-2024 08:00                8044
class.swoole-atomic.php                            24-Apr-2024 08:00                5073
class.swoole-buffer.php                            24-Apr-2024 08:00                7528
class.swoole-channel.php                           24-Apr-2024 08:00                3971
class.swoole-client.php                            24-Apr-2024 08:00               16535
class.swoole-connection-iterator.php               24-Apr-2024 08:00                7524
class.swoole-coroutine.php                         24-Apr-2024 08:00               18660
class.swoole-event.php                             24-Apr-2024 08:00                7467
class.swoole-exception.php                         24-Apr-2024 08:00                4576
class.swoole-http-client.php                       24-Apr-2024 08:00               14786
class.swoole-http-request.php                      24-Apr-2024 08:00                3036
class.swoole-http-response.php                     24-Apr-2024 08:00               10912
class.swoole-http-server.php                       24-Apr-2024 08:00               26439
class.swoole-lock.php                              24-Apr-2024 08:00                4681
class.swoole-mmap.php                              24-Apr-2024 08:00                3082
class.swoole-mysql-exception.php                   24-Apr-2024 08:00                4617
class.swoole-mysql.php                             24-Apr-2024 08:00                5420
class.swoole-process.php                           24-Apr-2024 08:00               13669
class.swoole-redis-server.php                      24-Apr-2024 08:00               32071
class.swoole-serialize.php                         24-Apr-2024 08:00                3614
class.swoole-server.php                            24-Apr-2024 08:00               29579
class.swoole-table.php                             24-Apr-2024 08:00               12719
class.swoole-timer.php                             24-Apr-2024 08:00                5002
class.swoole-websocket-frame.php                   24-Apr-2024 08:00                1951
class.swoole-websocket-server.php                  24-Apr-2024 08:00                7832
class.syncevent.php                                24-Apr-2024 08:00                4900
class.syncmutex.php                                24-Apr-2024 08:00                4221
class.syncreaderwriter.php                         24-Apr-2024 08:00                5209
class.syncsemaphore.php                            24-Apr-2024 08:00                4657
class.syncsharedmemory.php                         24-Apr-2024 08:00                5507
class.sysvmessagequeue.php                         24-Apr-2024 08:00                1838
class.sysvsemaphore.php                            24-Apr-2024 08:00                1823
class.sysvsharedmemory.php                         24-Apr-2024 08:00                1826
class.thread.php                                   24-Apr-2024 08:00               11424
class.threaded.php                                 24-Apr-2024 08:00                8843
class.throwable.php                                24-Apr-2024 08:00                7170
class.tidy.php                                     24-Apr-2024 08:00               18873
class.tidynode.php                                 24-Apr-2024 08:00               11599
class.transliterator.php                           24-Apr-2024 08:00               10176
class.traversable.php                              24-Apr-2024 08:00                4312
class.typeerror.php                                24-Apr-2024 08:00                9438
class.uconverter.php                               24-Apr-2024 08:00               41028
class.ui-area.php                                  24-Apr-2024 08:00               12252
class.ui-control.php                               24-Apr-2024 08:00                5479
class.ui-controls-box.php                          24-Apr-2024 08:00               10117
class.ui-controls-button.php                       24-Apr-2024 08:00                6680
class.ui-controls-check.php                        24-Apr-2024 08:00                7524
class.ui-controls-colorbutton.php                  24-Apr-2024 08:00                6559
class.ui-controls-combo.php                        24-Apr-2024 08:00                6648
class.ui-controls-editablecombo.php                24-Apr-2024 08:00                6760
class.ui-controls-entry.php                        24-Apr-2024 08:00                9642
class.ui-controls-form.php                         24-Apr-2024 08:00                8046
class.ui-controls-grid.php                         24-Apr-2024 08:00               13148
class.ui-controls-group.php                        24-Apr-2024 08:00                8354
class.ui-controls-label.php                        24-Apr-2024 08:00                6431
class.ui-controls-multilineentry.php               24-Apr-2024 08:00                9885
class.ui-controls-picker.php                       24-Apr-2024 08:00                7573
class.ui-controls-progress.php                     24-Apr-2024 08:00                5932
class.ui-controls-radio.php                        24-Apr-2024 08:00                6627
class.ui-controls-separator.php                    24-Apr-2024 08:00                7077
class.ui-controls-slider.php                       24-Apr-2024 08:00                7015
class.ui-controls-spin.php                         24-Apr-2024 08:00                6885
class.ui-controls-tab.php                          24-Apr-2024 08:00                9152
class.ui-draw-brush-gradient.php                   24-Apr-2024 08:00                7340
class.ui-draw-brush-lineargradient.php             24-Apr-2024 08:00                6593
class.ui-draw-brush-radialgradient.php             24-Apr-2024 08:00                6779
class.ui-draw-brush.php                            24-Apr-2024 08:00                4439
class.ui-draw-color.php                            24-Apr-2024 08:00                8585
class.ui-draw-line-cap.php                         24-Apr-2024 08:00                3742
class.ui-draw-line-join.php                        24-Apr-2024 08:00                3726
class.ui-draw-matrix.php                           24-Apr-2024 08:00                5629
class.ui-draw-path.php                             24-Apr-2024 08:00               10765
class.ui-draw-pen.php                              24-Apr-2024 08:00                8136
class.ui-draw-stroke.php                           24-Apr-2024 08:00                6887
class.ui-draw-text-font-descriptor.php             24-Apr-2024 08:00                6049
class.ui-draw-text-font-italic.php                 24-Apr-2024 08:00                4101
class.ui-draw-text-font-stretch.php                24-Apr-2024 08:00                8297
class.ui-draw-text-font-weight.php                 24-Apr-2024 08:00                8899
class.ui-draw-text-font.php                        24-Apr-2024 08:00                4878
class.ui-draw-text-layout.php                      24-Apr-2024 08:00                5288
class.ui-exception-invalidargumentexception.php    24-Apr-2024 08:00                7800
class.ui-exception-runtimeexception.php            24-Apr-2024 08:00                7723
class.ui-executor.php                              24-Apr-2024 08:00                5439
class.ui-key.php                                   24-Apr-2024 08:00               21341
class.ui-menu.php                                  24-Apr-2024 08:00                6297
class.ui-menuitem.php                              24-Apr-2024 08:00                3767
class.ui-point.php                                 24-Apr-2024 08:00                6310
class.ui-size.php                                  24-Apr-2024 08:00                6406
class.ui-window.php                                24-Apr-2024 08:00               13096
class.underflowexception.php                       24-Apr-2024 08:00                8575
class.unexpectedvalueexception.php                 24-Apr-2024 08:00                8735
class.unhandledmatcherror.php                      24-Apr-2024 08:00                8598
class.unitenum.php                                 24-Apr-2024 08:00                2789
class.v8js.php                                     24-Apr-2024 08:00                9055
class.v8jsexception.php                            24-Apr-2024 08:00               11357
class.valueerror.php                               24-Apr-2024 08:00                8535
class.variant.php                                  24-Apr-2024 08:00                5661
class.varnishadmin.php                             24-Apr-2024 08:00               11539
class.varnishlog.php                               24-Apr-2024 08:00               34799
class.varnishstat.php                              24-Apr-2024 08:00                3016
class.volatile.php                                 24-Apr-2024 08:00               11740
class.vtiful-kernel-excel.php                      24-Apr-2024 08:00               12044
class.vtiful-kernel-format.php                     24-Apr-2024 08:00               16082
class.weakmap.php                                  24-Apr-2024 08:00                9347
class.weakreference.php                            24-Apr-2024 08:00                5621
class.win32serviceexception.php                    24-Apr-2024 08:00                7829
class.wkhtmltox-image-converter.php                24-Apr-2024 08:00                4166
class.wkhtmltox-pdf-converter.php                  24-Apr-2024 08:00                4490
class.wkhtmltox-pdf-object.php                     24-Apr-2024 08:00                3005
class.worker.php                                   24-Apr-2024 08:00                8554
class.xmldiff-base.php                             24-Apr-2024 08:00                4128
class.xmldiff-dom.php                              24-Apr-2024 08:00                5083
class.xmldiff-file.php                             24-Apr-2024 08:00                5059
class.xmldiff-memory.php                           24-Apr-2024 08:00                5091
class.xmlparser.php                                24-Apr-2024 08:00                1809
class.xmlreader.php                                24-Apr-2024 08:00               38995
class.xmlwriter.php                                24-Apr-2024 08:00               32384
class.xsltprocessor.php                            24-Apr-2024 08:00               11536
class.yac.php                                      24-Apr-2024 08:00                9562
class.yaconf.php                                   24-Apr-2024 08:00                3493
class.yaf-action-abstract.php                      24-Apr-2024 08:00               12738
class.yaf-application.php                          24-Apr-2024 08:00               12672
class.yaf-bootstrap-abstract.php                   24-Apr-2024 08:00                5560
class.yaf-config-abstract.php                      24-Apr-2024 08:00                5231
class.yaf-config-ini.php                           24-Apr-2024 08:00               17808
class.yaf-config-simple.php                        24-Apr-2024 08:00               13240
class.yaf-controller-abstract.php                  24-Apr-2024 08:00               19208
class.yaf-dispatcher.php                           24-Apr-2024 08:00               20267
class.yaf-exception-dispatchfailed.php             24-Apr-2024 08:00                2660
class.yaf-exception-loadfailed-action.php          24-Apr-2024 08:00                2731
class.yaf-exception-loadfailed-controller.php      24-Apr-2024 08:00                2756
class.yaf-exception-loadfailed-module.php          24-Apr-2024 08:00                2720
class.yaf-exception-loadfailed-view.php            24-Apr-2024 08:00                2660
class.yaf-exception-loadfailed.php                 24-Apr-2024 08:00                2634
class.yaf-exception-routerfailed.php               24-Apr-2024 08:00                2645
class.yaf-exception-startuperror.php               24-Apr-2024 08:00                2643
class.yaf-exception-typeerror.php                  24-Apr-2024 08:00                2614
class.yaf-exception.php                            24-Apr-2024 08:00                8502
class.yaf-loader.php                               24-Apr-2024 08:00               18766
class.yaf-plugin-abstract.php                      24-Apr-2024 08:00               16059
class.yaf-registry.php                             24-Apr-2024 08:00                6043
class.yaf-request-abstract.php                     24-Apr-2024 08:00               23755
class.yaf-request-http.php                         24-Apr-2024 08:00               23225
class.yaf-request-simple.php                       24-Apr-2024 08:00               22706
class.yaf-response-abstract.php                    24-Apr-2024 08:00               11826
class.yaf-route-interface.php                      24-Apr-2024 08:00                3750
class.yaf-route-map.php                            24-Apr-2024 08:00                6519
class.yaf-route-regex.php                          24-Apr-2024 08:00                8412
class.yaf-route-rewrite.php                        24-Apr-2024 08:00                7516
class.yaf-route-simple.php                         24-Apr-2024 08:00                6592
class.yaf-route-static.php                         24-Apr-2024 08:00                5070
class.yaf-route-supervar.php                       24-Apr-2024 08:00                4757
class.yaf-router.php                               24-Apr-2024 08:00               12002
class.yaf-session.php                              24-Apr-2024 08:00               12658
class.yaf-view-interface.php                       24-Apr-2024 08:00                6079
class.yaf-view-simple.php                          24-Apr-2024 08:00               11293
class.yar-client-exception.php                     24-Apr-2024 08:00                6642
class.yar-client.php                               24-Apr-2024 08:00                5846
class.yar-concurrent-client.php                    24-Apr-2024 08:00                6646
class.yar-server-exception.php                     24-Apr-2024 08:00                7099
class.yar-server.php                               24-Apr-2024 08:00                3496
class.ziparchive.php                               24-Apr-2024 08:00               89710
class.zmq.php                                      24-Apr-2024 08:00               41110
class.zmqcontext.php                               24-Apr-2024 08:00                5626
class.zmqdevice.php                                24-Apr-2024 08:00                7075
class.zmqpoll.php                                  24-Apr-2024 08:00                5211
class.zmqsocket.php                                24-Apr-2024 08:00               11488
class.zookeeper.php                                24-Apr-2024 08:00               56120
class.zookeeperauthenticationexception.php         24-Apr-2024 08:00                7730
class.zookeeperconfig.php                          24-Apr-2024 08:00                6459
class.zookeeperconnectionexception.php             24-Apr-2024 08:00                7725
class.zookeeperexception.php                       24-Apr-2024 08:00                7591
class.zookeepermarshallingexception.php            24-Apr-2024 08:00                7746
class.zookeepernonodeexception.php                 24-Apr-2024 08:00                7713
class.zookeeperoperationtimeoutexception.php       24-Apr-2024 08:00                7756
class.zookeepersessionexception.php                24-Apr-2024 08:00                7673
classobj.configuration.php                         24-Apr-2024 08:00                1287
classobj.constants.php                             24-Apr-2024 08:00                1210
classobj.examples.php                              24-Apr-2024 08:00               13368
classobj.installation.php                          24-Apr-2024 08:00                1270
classobj.requirements.php                          24-Apr-2024 08:00                1234
classobj.resources.php                             24-Apr-2024 08:00                1232
classobj.setup.php                                 24-Apr-2024 08:00                1639
closure.bind.php                                   24-Apr-2024 08:00                7936
closure.bindto.php                                 24-Apr-2024 08:00                9401
closure.call.php                                   24-Apr-2024 08:00                6346
closure.construct.php                              24-Apr-2024 08:00                2456
closure.fromcallable.php                           24-Apr-2024 08:00                3791
cmark.constants.php                                24-Apr-2024 08:00                4266
cmark.installation.php                             24-Apr-2024 08:00                1976
cmark.requirements.php                             24-Apr-2024 08:00                1323
cmark.setup.php                                    24-Apr-2024 08:00                1467
collator.asort.php                                 24-Apr-2024 08:00                9495
collator.compare.php                               24-Apr-2024 08:00               10539
collator.construct.php                             24-Apr-2024 08:00                5656
collator.create.php                                24-Apr-2024 08:00                5583
collator.getattribute.php                          24-Apr-2024 08:00                6071
collator.geterrorcode.php                          24-Apr-2024 08:00                5265
collator.geterrormessage.php                       24-Apr-2024 08:00                5336
collator.getlocale.php                             24-Apr-2024 08:00                6857
collator.getsortkey.php                            24-Apr-2024 08:00                6937
collator.getstrength.php                           24-Apr-2024 08:00                4877
collator.setattribute.php                          24-Apr-2024 08:00                6670
collator.setstrength.php                           24-Apr-2024 08:00               13240
collator.sort.php                                  24-Apr-2024 08:00                8305
collator.sortwithsortkeys.php                      24-Apr-2024 08:00                6520
collectable.isgarbage.php                          24-Apr-2024 08:00                3434
com.configuration.php                              24-Apr-2024 08:00                7928
com.constants.php                                  24-Apr-2024 08:00               26275
com.construct.php                                  24-Apr-2024 08:00                9510
com.error-handling.php                             24-Apr-2024 08:00                1626
com.examples.arrays.php                            24-Apr-2024 08:00                2113
com.examples.foreach.php                           24-Apr-2024 08:00                2896
com.examples.php                                   24-Apr-2024 08:00                1474
com.installation.php                               24-Apr-2024 08:00                1529
com.requirements.php                               24-Apr-2024 08:00                1283
com.resources.php                                  24-Apr-2024 08:00                1197
com.setup.php                                      24-Apr-2024 08:00                1589
commonmark-cql.construct.php                       24-Apr-2024 08:00                2236
commonmark-cql.invoke.php                          24-Apr-2024 08:00                3915
commonmark-interfaces-ivisitable.accept.php        24-Apr-2024 08:00                3150
commonmark-interfaces-ivisitor.enter.php           24-Apr-2024 08:00                4179
commonmark-interfaces-ivisitor.leave.php           24-Apr-2024 08:00                4181
commonmark-node-bulletlist.construct.php           24-Apr-2024 08:00                3205
commonmark-node-codeblock.construct.php            24-Apr-2024 08:00                2860
commonmark-node-heading.construct.php              24-Apr-2024 08:00                2646
commonmark-node-image.construct.php                24-Apr-2024 08:00                3303
commonmark-node-link.construct.php                 24-Apr-2024 08:00                3300
commonmark-node-orderedlist.construct.php          24-Apr-2024 08:00                4188
commonmark-node-text.construct.php                 24-Apr-2024 08:00                2688
commonmark-node.accept.php                         24-Apr-2024 08:00                2890
commonmark-node.appendchild.php                    24-Apr-2024 08:00                2728
commonmark-node.insertafter.php                    24-Apr-2024 08:00                2753
commonmark-node.insertbefore.php                   24-Apr-2024 08:00                2751
commonmark-node.prependchild.php                   24-Apr-2024 08:00                2755
commonmark-node.replace.php                        24-Apr-2024 08:00                2699
commonmark-node.unlink.php                         24-Apr-2024 08:00                2396
commonmark-parser.construct.php                    24-Apr-2024 08:00                3833
commonmark-parser.finish.php                       24-Apr-2024 08:00                2426
commonmark-parser.parse.php                        24-Apr-2024 08:00                2658
compersisthelper.construct.php                     24-Apr-2024 08:00                3643
compersisthelper.getcurfilename.php                24-Apr-2024 08:00                3157
compersisthelper.getmaxstreamsize.php              24-Apr-2024 08:00                3163
compersisthelper.initnew.php                       24-Apr-2024 08:00                3099
compersisthelper.loadfromfile.php                  24-Apr-2024 08:00                4316
compersisthelper.loadfromstream.php                24-Apr-2024 08:00                3533
compersisthelper.savetofile.php                    24-Apr-2024 08:00                6318
compersisthelper.savetostream.php                  24-Apr-2024 08:00                3560
componere-abstract-definition.addinterface.php     24-Apr-2024 08:00                3285
componere-abstract-definition.addmethod.php        24-Apr-2024 08:00                4012
componere-abstract-definition.addtrait.php         24-Apr-2024 08:00                3237
componere-abstract-definition.getreflector.php     24-Apr-2024 08:00                2418
componere-definition.addconstant.php               24-Apr-2024 08:00                4337
componere-definition.addproperty.php               24-Apr-2024 08:00                3744
componere-definition.construct.php                 24-Apr-2024 08:00                5980
componere-definition.getclosure.php                24-Apr-2024 08:00                3450
componere-definition.getclosures.php               24-Apr-2024 08:00                2701
componere-definition.isregistered.php              24-Apr-2024 08:00                2300
componere-definition.register.php                  24-Apr-2024 08:00                2450
componere-method.construct.php                     24-Apr-2024 08:00                2232
componere-method.getreflector.php                  24-Apr-2024 08:00                2221
componere-method.setprivate.php                    24-Apr-2024 08:00                2450
componere-method.setprotected.php                  24-Apr-2024 08:00                2465
componere-method.setstatic.php                     24-Apr-2024 08:00                2046
componere-patch.apply.php                          24-Apr-2024 08:00                1907
componere-patch.construct.php                      24-Apr-2024 08:00                3646
componere-patch.derive.php                         24-Apr-2024 08:00                3142
componere-patch.getclosure.php                     24-Apr-2024 08:00                3079
componere-patch.getclosures.php                    24-Apr-2024 08:00                2221
componere-patch.isapplied.php                      24-Apr-2024 08:00                1861
componere-patch.revert.php                         24-Apr-2024 08:00                1904
componere-value.construct.php                      24-Apr-2024 08:00                2666
componere-value.hasdefault.php                     24-Apr-2024 08:00                1908
componere-value.isprivate.php                      24-Apr-2024 08:00                1926
componere-value.isprotected.php                    24-Apr-2024 08:00                1936
componere-value.isstatic.php                       24-Apr-2024 08:00                1920
componere-value.setprivate.php                     24-Apr-2024 08:00                2473
componere-value.setprotected.php                   24-Apr-2024 08:00                2487
componere-value.setstatic.php                      24-Apr-2024 08:00                2063
componere.cast.php                                 24-Apr-2024 08:00                4911
componere.cast_by_ref.php                          24-Apr-2024 08:00                5083
componere.installation.php                         24-Apr-2024 08:00                1368
componere.requirements.php                         24-Apr-2024 08:00                1213
componere.setup.php                                24-Apr-2024 08:00                1506
configuration.changes.modes.php                    24-Apr-2024 08:00                4039
configuration.changes.php                          24-Apr-2024 08:00                8468
configuration.file.per-user.php                    24-Apr-2024 08:00                2986
configuration.file.php                             24-Apr-2024 08:00                9772
configuration.php                                  24-Apr-2024 08:00                1702
configure.about.php                                24-Apr-2024 08:00               12152
configure.php                                      24-Apr-2024 08:00                1439
context.ftp.php                                    24-Apr-2024 08:00                4187
context.http.php                                   24-Apr-2024 08:00               15661
context.params.php                                 24-Apr-2024 08:00                2480
context.phar.php                                   24-Apr-2024 08:00                2763
context.php                                        24-Apr-2024 08:00                2834
context.socket.php                                 24-Apr-2024 08:00                9358
context.ssl.php                                    24-Apr-2024 08:00               12369
context.zip.php                                    24-Apr-2024 08:00                4185
context.zlib.php                                   24-Apr-2024 08:00                2449
control-structures.alternative-syntax.php          24-Apr-2024 08:00                6792
control-structures.break.php                       24-Apr-2024 08:00                4647
control-structures.continue.php                    24-Apr-2024 08:00                8011
control-structures.declare.php                     24-Apr-2024 08:00                9998
control-structures.do.while.php                    24-Apr-2024 08:00                5036
control-structures.else.php                        24-Apr-2024 08:00                4790
control-structures.elseif.php                      24-Apr-2024 08:00                7600
control-structures.for.php                         24-Apr-2024 08:00               11611
control-structures.foreach.php                     24-Apr-2024 08:00               20646
control-structures.goto.php                        24-Apr-2024 08:00                6972
control-structures.if.php                          24-Apr-2024 08:00                4819
control-structures.intro.php                       24-Apr-2024 08:00                2492
control-structures.match.php                       24-Apr-2024 08:00               17536
control-structures.switch.php                      24-Apr-2024 08:00               18484
control-structures.while.php                       24-Apr-2024 08:00                4574
copyright.php                                      24-Apr-2024 08:00                2041
countable.count.php                                24-Apr-2024 08:00                5407
ctype.configuration.php                            24-Apr-2024 08:00                1266
ctype.constants.php                                24-Apr-2024 08:00                1181
ctype.installation.php                             24-Apr-2024 08:00                1508
ctype.requirements.php                             24-Apr-2024 08:00                1244
ctype.resources.php                                24-Apr-2024 08:00                1211
ctype.setup.php                                    24-Apr-2024 08:00                1598
cubrid.configuration.php                           24-Apr-2024 08:00                1225
cubrid.constants.php                               24-Apr-2024 08:00               13819
cubrid.examples.php                                24-Apr-2024 08:00               13857
cubrid.installation.php                            24-Apr-2024 08:00                2075
cubrid.requirements.php                            24-Apr-2024 08:00                1289
cubrid.resources.php                               24-Apr-2024 08:00                3112
cubrid.setup.php                                   24-Apr-2024 08:00                1612
cubridmysql.cubrid.php                             24-Apr-2024 08:00                4966
curl.configuration.php                             24-Apr-2024 08:00                2538
curl.constants.php                                 24-Apr-2024 08:00              183683
curl.examples-basic.php                            24-Apr-2024 08:00                4591
curl.examples.php                                  24-Apr-2024 08:00                1402
curl.installation.php                              24-Apr-2024 08:00                2486
curl.requirements.php                              24-Apr-2024 08:00                1471
curl.resources.php                                 24-Apr-2024 08:00                1381
curl.setup.php                                     24-Apr-2024 08:00                1606
curlfile.construct.php                             24-Apr-2024 08:00               21155
curlfile.getfilename.php                           24-Apr-2024 08:00                2157
curlfile.getmimetype.php                           24-Apr-2024 08:00                2163
curlfile.getpostfilename.php                       24-Apr-2024 08:00                2213
curlfile.setmimetype.php                           24-Apr-2024 08:00                2449
curlfile.setpostfilename.php                       24-Apr-2024 08:00                2490
curlstringfile.construct.php                       24-Apr-2024 08:00                6974
dateinterval.construct.php                         24-Apr-2024 08:00               13415
dateinterval.createfromdatestring.php              24-Apr-2024 08:00               15509
dateinterval.format.php                            24-Apr-2024 08:00               14553
dateperiod.construct.php                           24-Apr-2024 08:00               19741
dateperiod.createfromiso8601string.php             24-Apr-2024 08:00                7872
dateperiod.getdateinterval.php                     24-Apr-2024 08:00                4763
dateperiod.getenddate.php                          24-Apr-2024 08:00                7703
dateperiod.getrecurrences.php                      24-Apr-2024 08:00                8860
dateperiod.getstartdate.php                        24-Apr-2024 08:00                5231
datetime.add.php                                   24-Apr-2024 08:00                4858
datetime.configuration.php                         24-Apr-2024 08:00                6156
datetime.constants.php                             24-Apr-2024 08:00                2920
datetime.construct.php                             24-Apr-2024 08:00                6192
datetime.createfromformat.php                      24-Apr-2024 08:00                7301
datetime.createfromimmutable.php                   24-Apr-2024 08:00                4857
datetime.createfrominterface.php                   24-Apr-2024 08:00                4847
datetime.diff.php                                  24-Apr-2024 08:00               17145
datetime.error.tree.php                            24-Apr-2024 08:00                3325
datetime.examples-arithmetic.php                   24-Apr-2024 08:00               15117
datetime.examples.php                              24-Apr-2024 08:00                1458
datetime.format.php                                24-Apr-2024 08:00               26710
datetime.formats.php                               24-Apr-2024 08:00               55181
datetime.getlasterrors.php                         24-Apr-2024 08:00                1887
datetime.getoffset.php                             24-Apr-2024 08:00                7856
datetime.gettimestamp.php                          24-Apr-2024 08:00               10190
datetime.gettimezone.php                           24-Apr-2024 08:00                7756
datetime.installation.php                          24-Apr-2024 08:00                1627
datetime.modify.php                                24-Apr-2024 08:00               14148
datetime.requirements.php                          24-Apr-2024 08:00                1234
datetime.resources.php                             24-Apr-2024 08:00                1232
datetime.set-state.php                             24-Apr-2024 08:00                2871
datetime.setdate.php                               24-Apr-2024 08:00                5516
datetime.setisodate.php                            24-Apr-2024 08:00                5685
datetime.settime.php                               24-Apr-2024 08:00                7010
datetime.settimestamp.php                          24-Apr-2024 08:00                4980
datetime.settimezone.php                           24-Apr-2024 08:00                9272
datetime.setup.php                                 24-Apr-2024 08:00                1661
datetime.sub.php                                   24-Apr-2024 08:00                6211
datetime.wakeup.php                                24-Apr-2024 08:00                3041
datetimeimmutable.add.php                          24-Apr-2024 08:00               10487
datetimeimmutable.construct.php                    24-Apr-2024 08:00               18378
datetimeimmutable.createfromformat.php             24-Apr-2024 08:00               46930
datetimeimmutable.createfrominterface.php          24-Apr-2024 08:00                5111
datetimeimmutable.createfrommutable.php            24-Apr-2024 08:00                5014
datetimeimmutable.getlasterrors.php                24-Apr-2024 08:00                5601
datetimeimmutable.modify.php                       24-Apr-2024 08:00                9241
datetimeimmutable.set-state.php                    24-Apr-2024 08:00                2786
datetimeimmutable.setdate.php                      24-Apr-2024 08:00                9111
datetimeimmutable.setisodate.php                   24-Apr-2024 08:00               12710
datetimeimmutable.settime.php                      24-Apr-2024 08:00               11932
datetimeimmutable.settimestamp.php                 24-Apr-2024 08:00                5770
datetimeimmutable.settimezone.php                  24-Apr-2024 08:00                5952
datetimeimmutable.sub.php                          24-Apr-2024 08:00               11922
datetimezone.construct.php                         24-Apr-2024 08:00               10576
datetimezone.getlocation.php                       24-Apr-2024 08:00                5886
datetimezone.getname.php                           24-Apr-2024 08:00                3624
datetimezone.getoffset.php                         24-Apr-2024 08:00                7003
datetimezone.gettransitions.php                    24-Apr-2024 08:00               12104
datetimezone.listabbreviations.php                 24-Apr-2024 08:00                6025
datetimezone.listidentifiers.php                   24-Apr-2024 08:00               14555
dba.configuration.php                              24-Apr-2024 08:00                2295
dba.constants.php                                  24-Apr-2024 08:00                2173
dba.example.php                                    24-Apr-2024 08:00                6227
dba.examples.php                                   24-Apr-2024 08:00                1363
dba.installation.php                               24-Apr-2024 08:00                9430
dba.requirements.php                               24-Apr-2024 08:00                7289
dba.resources.php                                  24-Apr-2024 08:00                1476
dba.setup.php                                      24-Apr-2024 08:00                1593
dbase.configuration.php                            24-Apr-2024 08:00                1266
dbase.constants.php                                24-Apr-2024 08:00                3664
dbase.installation.php                             24-Apr-2024 08:00                1593
dbase.requirements.php                             24-Apr-2024 08:00                1213
dbase.resources.php                                24-Apr-2024 08:00                1488
dbase.setup.php                                    24-Apr-2024 08:00                1614
debugger-about.php                                 24-Apr-2024 08:00                1543
debugger.php                                       24-Apr-2024 08:00                1418
dio.configuration.php                              24-Apr-2024 08:00                1252
dio.constants.php                                  24-Apr-2024 08:00               11025
dio.installation.php                               24-Apr-2024 08:00                1997
dio.requirements.php                               24-Apr-2024 08:00                1199
dio.resources.php                                  24-Apr-2024 08:00                1334
dio.setup.php                                      24-Apr-2024 08:00                1594
dir.configuration.php                              24-Apr-2024 08:00                1252
dir.constants.php                                  24-Apr-2024 08:00                2799
dir.installation.php                               24-Apr-2024 08:00                1235
dir.requirements.php                               24-Apr-2024 08:00                1199
dir.resources.php                                  24-Apr-2024 08:00                1197
dir.setup.php                                      24-Apr-2024 08:00                1589
directory.close.php                                24-Apr-2024 08:00                2202
directory.read.php                                 24-Apr-2024 08:00                2336
directory.rewind.php                               24-Apr-2024 08:00                2214
directoryiterator.construct.php                    24-Apr-2024 08:00                5796
directoryiterator.current.php                      24-Apr-2024 08:00                6080
directoryiterator.getbasename.php                  24-Apr-2024 08:00                6364
directoryiterator.getextension.php                 24-Apr-2024 08:00                6112
directoryiterator.getfilename.php                  24-Apr-2024 08:00                5103
directoryiterator.isdot.php                        24-Apr-2024 08:00                5306
directoryiterator.key.php                          24-Apr-2024 08:00                6529
directoryiterator.next.php                         24-Apr-2024 08:00                5424
directoryiterator.rewind.php                       24-Apr-2024 08:00                5345
directoryiterator.seek.php                         24-Apr-2024 08:00                5295
directoryiterator.tostring.php                     24-Apr-2024 08:00                4625
directoryiterator.valid.php                        24-Apr-2024 08:00                5749
doc.changelog.php                                  24-Apr-2024 08:00                1312
dom.configuration.php                              24-Apr-2024 08:00                1252
dom.constants.php                                  24-Apr-2024 08:00               19582
dom.examples.php                                   24-Apr-2024 08:00                2979
dom.installation.php                               24-Apr-2024 08:00                1319
dom.requirements.php                               24-Apr-2024 08:00                1503
dom.resources.php                                  24-Apr-2024 08:00                1197
dom.setup.php                                      24-Apr-2024 08:00                1583
domattr.construct.php                              24-Apr-2024 08:00                5576
domattr.isid.php                                   24-Apr-2024 08:00                5009
domcdatasection.construct.php                      24-Apr-2024 08:00                5155
domcharacterdata.after.php                         24-Apr-2024 08:00                7724
domcharacterdata.appenddata.php                    24-Apr-2024 08:00                4382
domcharacterdata.before.php                        24-Apr-2024 08:00                7352
domcharacterdata.deletedata.php                    24-Apr-2024 08:00                5057
domcharacterdata.insertdata.php                    24-Apr-2024 08:00                4781
domcharacterdata.remove.php                        24-Apr-2024 08:00                5380
domcharacterdata.replacedata.php                   24-Apr-2024 08:00                5449
domcharacterdata.replacewith.php                   24-Apr-2024 08:00                7808
domcharacterdata.substringdata.php                 24-Apr-2024 08:00                4917
domchildnode.after.php                             24-Apr-2024 08:00                5652
domchildnode.before.php                            24-Apr-2024 08:00                5078
domchildnode.remove.php                            24-Apr-2024 08:00                3097
domchildnode.replacewith.php                       24-Apr-2024 08:00                5270
domcomment.construct.php                           24-Apr-2024 08:00                4992
domdocument.adoptnode.php                          24-Apr-2024 08:00                6696
domdocument.append.php                             24-Apr-2024 08:00                6775
domdocument.construct.php                          24-Apr-2024 08:00                4380
domdocument.createattribute.php                    24-Apr-2024 08:00                5858
domdocument.createattributens.php                  24-Apr-2024 08:00                8168
domdocument.createcdatasection.php                 24-Apr-2024 08:00                5469
domdocument.createcomment.php                      24-Apr-2024 08:00                5843
domdocument.createdocumentfragment.php             24-Apr-2024 08:00                5671
domdocument.createelement.php                      24-Apr-2024 08:00               11285
domdocument.createelementns.php                    24-Apr-2024 08:00               14004
domdocument.createentityreference.php              24-Apr-2024 08:00                6175
domdocument.createprocessinginstruction.php        24-Apr-2024 08:00                6495
domdocument.createtextnode.php                     24-Apr-2024 08:00                5831
domdocument.getelementbyid.php                     24-Apr-2024 08:00                7663
domdocument.getelementsbytagname.php               24-Apr-2024 08:00                6029
domdocument.getelementsbytagnamens.php             24-Apr-2024 08:00                7663
domdocument.importnode.php                         24-Apr-2024 08:00                8924
domdocument.load.php                               24-Apr-2024 08:00                6580
domdocument.loadhtml.php                           24-Apr-2024 08:00                7733
domdocument.loadhtmlfile.php                       24-Apr-2024 08:00                7852
domdocument.loadxml.php                            24-Apr-2024 08:00                6294
domdocument.normalizedocument.php                  24-Apr-2024 08:00                2958
domdocument.prepend.php                            24-Apr-2024 08:00                6867
domdocument.registernodeclass.php                  24-Apr-2024 08:00               20729
domdocument.relaxngvalidate.php                    24-Apr-2024 08:00                4014
domdocument.relaxngvalidatesource.php              24-Apr-2024 08:00                4069
domdocument.replacechildren.php                    24-Apr-2024 08:00                7164
domdocument.save.php                               24-Apr-2024 08:00                7592
domdocument.savehtml.php                           24-Apr-2024 08:00                7527
domdocument.savehtmlfile.php                       24-Apr-2024 08:00                7968
domdocument.savexml.php                            24-Apr-2024 08:00                9704
domdocument.schemavalidate.php                     24-Apr-2024 08:00                4400
domdocument.schemavalidatesource.php               24-Apr-2024 08:00                4462
domdocument.validate.php                           24-Apr-2024 08:00                6033
domdocument.xinclude.php                           24-Apr-2024 08:00                7157
domdocumentfragment.append.php                     24-Apr-2024 08:00                7465
domdocumentfragment.appendxml.php                  24-Apr-2024 08:00                5543
domdocumentfragment.construct.php                  24-Apr-2024 08:00                2147
domdocumentfragment.prepend.php                    24-Apr-2024 08:00                7523
domdocumentfragment.replacechildren.php            24-Apr-2024 08:00                7908
domelement.after.php                               24-Apr-2024 08:00                7402
domelement.append.php                              24-Apr-2024 08:00                7087
domelement.before.php                              24-Apr-2024 08:00                6987
domelement.construct.php                           24-Apr-2024 08:00                6668
domelement.getattribute.php                        24-Apr-2024 08:00                3541
domelement.getattributenames.php                   24-Apr-2024 08:00                3960
domelement.getattributenode.php                    24-Apr-2024 08:00                4090
domelement.getattributenodens.php                  24-Apr-2024 08:00                4580
domelement.getattributens.php                      24-Apr-2024 08:00                4083
domelement.getelementsbytagname.php                24-Apr-2024 08:00                3648
domelement.getelementsbytagnamens.php              24-Apr-2024 08:00                4730
domelement.hasattribute.php                        24-Apr-2024 08:00                3818
domelement.hasattributens.php                      24-Apr-2024 08:00                4290
domelement.insertadjacentelement.php               24-Apr-2024 08:00                6639
domelement.insertadjacenttext.php                  24-Apr-2024 08:00                6449
domelement.prepend.php                             24-Apr-2024 08:00                7137
domelement.remove.php                              24-Apr-2024 08:00                5023
domelement.removeattribute.php                     24-Apr-2024 08:00                4034
domelement.removeattributenode.php                 24-Apr-2024 08:00                4388
domelement.removeattributens.php                   24-Apr-2024 08:00                4327
domelement.replacechildren.php                     24-Apr-2024 08:00                7728
domelement.replacewith.php                         24-Apr-2024 08:00                7792
domelement.setattribute.php                        24-Apr-2024 08:00                6201
domelement.setattributenode.php                    24-Apr-2024 08:00                4754
domelement.setattributenodens.php                  24-Apr-2024 08:00                4821
domelement.setattributens.php                      24-Apr-2024 08:00                5256
domelement.setidattribute.php                      24-Apr-2024 08:00                4782
domelement.setidattributenode.php                  24-Apr-2024 08:00                4776
domelement.setidattributens.php                    24-Apr-2024 08:00                5234
domelement.toggleattribute.php                     24-Apr-2024 08:00                6421
domentityreference.construct.php                   24-Apr-2024 08:00                4834
domimplementation.construct.php                    24-Apr-2024 08:00                2157
domimplementation.createdocument.php               24-Apr-2024 08:00                7353
domimplementation.createdocumenttype.php           24-Apr-2024 08:00                9859
domimplementation.hasfeature.php                   24-Apr-2024 08:00                9254
domnamednodemap.count.php                          24-Apr-2024 08:00                2431
domnamednodemap.getiterator.php                    24-Apr-2024 08:00                3192
domnamednodemap.getnameditem.php                   24-Apr-2024 08:00                3469
domnamednodemap.getnameditemns.php                 24-Apr-2024 08:00                3921
domnamednodemap.item.php                           24-Apr-2024 08:00                3074
domnode.appendchild.php                            24-Apr-2024 08:00                8707
domnode.c14n.php                                   24-Apr-2024 08:00                4909
domnode.c14nfile.php                               24-Apr-2024 08:00                5243
domnode.clonenode.php                              24-Apr-2024 08:00                2847
domnode.contains.php                               24-Apr-2024 08:00                5356
domnode.getlineno.php                              24-Apr-2024 08:00                4866
domnode.getnodepath.php                            24-Apr-2024 08:00                5215
domnode.getrootnode.php                            24-Apr-2024 08:00                4399
domnode.hasattributes.php                          24-Apr-2024 08:00                2947
domnode.haschildnodes.php                          24-Apr-2024 08:00                2811
domnode.insertbefore.php                           24-Apr-2024 08:00                5411
domnode.isdefaultnamespace.php                     24-Apr-2024 08:00                2935
domnode.isequalnode.php                            24-Apr-2024 08:00                4695
domnode.issamenode.php                             24-Apr-2024 08:00                2779
domnode.issupported.php                            24-Apr-2024 08:00                3802
domnode.lookupnamespaceuri.php                     24-Apr-2024 08:00                3586
domnode.lookupprefix.php                           24-Apr-2024 08:00                3224
domnode.normalize.php                              24-Apr-2024 08:00                2804
domnode.removechild.php                            24-Apr-2024 08:00                6965
domnode.replacechild.php                           24-Apr-2024 08:00                5659
domnodelist.count.php                              24-Apr-2024 08:00                2360
domnodelist.getiterator.php                        24-Apr-2024 08:00                3095
domnodelist.item.php                               24-Apr-2024 08:00                6970
domparentnode.append.php                           24-Apr-2024 08:00                4754
domparentnode.prepend.php                          24-Apr-2024 08:00                4794
domparentnode.replacechildren.php                  24-Apr-2024 08:00                6600
domprocessinginstruction.construct.php             24-Apr-2024 08:00                6679
domtext.construct.php                              24-Apr-2024 08:00                4790
domtext.iselementcontentwhitespace.php             24-Apr-2024 08:00                2630
domtext.iswhitespaceinelementcontent.php           24-Apr-2024 08:00                2846
domtext.splittext.php                              24-Apr-2024 08:00                3243
domxpath.construct.php                             24-Apr-2024 08:00                3506
domxpath.evaluate.php                              24-Apr-2024 08:00                7894
domxpath.query.php                                 24-Apr-2024 08:00               12359
domxpath.registernamespace.php                     24-Apr-2024 08:00                3297
domxpath.registerphpfunctions.php                  24-Apr-2024 08:00               13762
dotnet.construct.php                               24-Apr-2024 08:00                3127
ds-collection.clear.php                            24-Apr-2024 08:00                3911
ds-collection.copy.php                             24-Apr-2024 08:00                4321
ds-collection.isempty.php                          24-Apr-2024 08:00                4249
ds-collection.toarray.php                          24-Apr-2024 08:00                4238
ds-deque.allocate.php                              24-Apr-2024 08:00                4666
ds-deque.apply.php                                 24-Apr-2024 08:00                4966
ds-deque.capacity.php                              24-Apr-2024 08:00                3948
ds-deque.clear.php                                 24-Apr-2024 08:00                3828
ds-deque.construct.php                             24-Apr-2024 08:00                4322
ds-deque.contains.php                              24-Apr-2024 08:00                7089
ds-deque.copy.php                                  24-Apr-2024 08:00                4187
ds-deque.count.php                                 24-Apr-2024 08:00                1625
ds-deque.filter.php                                24-Apr-2024 08:00                7615
ds-deque.find.php                                  24-Apr-2024 08:00                5426
ds-deque.first.php                                 24-Apr-2024 08:00                3757
ds-deque.get.php                                   24-Apr-2024 08:00                6590
ds-deque.insert.php                                24-Apr-2024 08:00                6663
ds-deque.isempty.php                               24-Apr-2024 08:00                4135
ds-deque.join.php                                  24-Apr-2024 08:00                5740
ds-deque.jsonserialize.php                         24-Apr-2024 08:00                1879
ds-deque.last.php                                  24-Apr-2024 08:00                3745
ds-deque.map.php                                   24-Apr-2024 08:00                5322
ds-deque.merge.php                                 24-Apr-2024 08:00                4872
ds-deque.pop.php                                   24-Apr-2024 08:00                4242
ds-deque.push.php                                  24-Apr-2024 08:00                4670
ds-deque.reduce.php                                24-Apr-2024 08:00                7986
ds-deque.remove.php                                24-Apr-2024 08:00                4870
ds-deque.reverse.php                               24-Apr-2024 08:00                3664
ds-deque.reversed.php                              24-Apr-2024 08:00                4012
ds-deque.rotate.php                                24-Apr-2024 08:00                5056
ds-deque.set.php                                   24-Apr-2024 08:00                6060
ds-deque.shift.php                                 24-Apr-2024 08:00                4343
ds-deque.slice.php                                 24-Apr-2024 08:00                7150
ds-deque.sort.php                                  24-Apr-2024 08:00                7401
ds-deque.sorted.php                                24-Apr-2024 08:00                7425
ds-deque.sum.php                                   24-Apr-2024 08:00                5258
ds-deque.toarray.php                               24-Apr-2024 08:00                4124
ds-deque.unshift.php                               24-Apr-2024 08:00                4749
ds-hashable.equals.php                             24-Apr-2024 08:00                3701
ds-hashable.hash.php                               24-Apr-2024 08:00                7463
ds-map.allocate.php                                24-Apr-2024 08:00                4532
ds-map.apply.php                                   24-Apr-2024 08:00                5662
ds-map.capacity.php                                24-Apr-2024 08:00                3238
ds-map.clear.php                                   24-Apr-2024 08:00                4304
ds-map.construct.php                               24-Apr-2024 08:00                4824
ds-map.copy.php                                    24-Apr-2024 08:00                4047
ds-map.count.php                                   24-Apr-2024 08:00                1586
ds-map.diff.php                                    24-Apr-2024 08:00                5448
ds-map.filter.php                                  24-Apr-2024 08:00                8399
ds-map.first.php                                   24-Apr-2024 08:00                4056
ds-map.get.php                                     24-Apr-2024 08:00                8411
ds-map.haskey.php                                  24-Apr-2024 08:00                4685
ds-map.hasvalue.php                                24-Apr-2024 08:00                4729
ds-map.intersect.php                               24-Apr-2024 08:00                5969
ds-map.isempty.php                                 24-Apr-2024 08:00                4357
ds-map.jsonserialize.php                           24-Apr-2024 08:00                1857
ds-map.keys.php                                    24-Apr-2024 08:00                3948
ds-map.ksort.php                                   24-Apr-2024 08:00                8088
ds-map.ksorted.php                                 24-Apr-2024 08:00                8174
ds-map.last.php                                    24-Apr-2024 08:00                4041
ds-map.map.php                                     24-Apr-2024 08:00                6303
ds-map.merge.php                                   24-Apr-2024 08:00                5852
ds-map.pairs.php                                   24-Apr-2024 08:00                4363
ds-map.put.php                                     24-Apr-2024 08:00               13934
ds-map.putall.php                                  24-Apr-2024 08:00                5535
ds-map.reduce.php                                  24-Apr-2024 08:00                8921
ds-map.remove.php                                  24-Apr-2024 08:00                6966
ds-map.reverse.php                                 24-Apr-2024 08:00                4116
ds-map.reversed.php                                24-Apr-2024 08:00                4222
ds-map.skip.php                                    24-Apr-2024 08:00                4620
ds-map.slice.php                                   24-Apr-2024 08:00                8002
ds-map.sort.php                                    24-Apr-2024 08:00                8011
ds-map.sorted.php                                  24-Apr-2024 08:00                8153
ds-map.sum.php                                     24-Apr-2024 08:00                5725
ds-map.toarray.php                                 24-Apr-2024 08:00                5121
ds-map.union.php                                   24-Apr-2024 08:00                5953
ds-map.values.php                                  24-Apr-2024 08:00                3947
ds-map.xor.php                                     24-Apr-2024 08:00                5514
ds-pair.clear.php                                  24-Apr-2024 08:00                3733
ds-pair.construct.php                              24-Apr-2024 08:00                2603
ds-pair.copy.php                                   24-Apr-2024 08:00                4101
ds-pair.isempty.php                                24-Apr-2024 08:00                4085
ds-pair.jsonserialize.php                          24-Apr-2024 08:00                1877
ds-pair.toarray.php                                24-Apr-2024 08:00                4058
ds-priorityqueue.allocate.php                      24-Apr-2024 08:00                4832
ds-priorityqueue.capacity.php                      24-Apr-2024 08:00                3447
ds-priorityqueue.clear.php                         24-Apr-2024 08:00                4485
ds-priorityqueue.construct.php                     24-Apr-2024 08:00                2930
ds-priorityqueue.copy.php                          24-Apr-2024 08:00                4490
ds-priorityqueue.count.php                         24-Apr-2024 08:00                1734
ds-priorityqueue.isempty.php                       24-Apr-2024 08:00                5045
ds-priorityqueue.jsonserialize.php                 24-Apr-2024 08:00                1997
ds-priorityqueue.peek.php                          24-Apr-2024 08:00                4735
ds-priorityqueue.pop.php                           24-Apr-2024 08:00                5505
ds-priorityqueue.push.php                          24-Apr-2024 08:00                5596
ds-priorityqueue.toarray.php                       24-Apr-2024 08:00                5223
ds-queue.allocate.php                              24-Apr-2024 08:00                4859
ds-queue.capacity.php                              24-Apr-2024 08:00                3954
ds-queue.clear.php                                 24-Apr-2024 08:00                3813
ds-queue.construct.php                             24-Apr-2024 08:00                4320
ds-queue.copy.php                                  24-Apr-2024 08:00                4289
ds-queue.count.php                                 24-Apr-2024 08:00                1622
ds-queue.isempty.php                               24-Apr-2024 08:00                4151
ds-queue.jsonserialize.php                         24-Apr-2024 08:00                1885
ds-queue.peek.php                                  24-Apr-2024 08:00                4339
ds-queue.pop.php                                   24-Apr-2024 08:00                4873
ds-queue.push.php                                  24-Apr-2024 08:00                4705
ds-queue.toarray.php                               24-Apr-2024 08:00                4288
ds-sequence.allocate.php                           24-Apr-2024 08:00                4570
ds-sequence.apply.php                              24-Apr-2024 08:00                5081
ds-sequence.capacity.php                           24-Apr-2024 08:00                4503
ds-sequence.contains.php                           24-Apr-2024 08:00                7216
ds-sequence.filter.php                             24-Apr-2024 08:00                7754
ds-sequence.find.php                               24-Apr-2024 08:00                5538
ds-sequence.first.php                              24-Apr-2024 08:00                3872
ds-sequence.get.php                                24-Apr-2024 08:00                6718
ds-sequence.insert.php                             24-Apr-2024 08:00                6782
ds-sequence.join.php                               24-Apr-2024 08:00                5836
ds-sequence.last.php                               24-Apr-2024 08:00                3839
ds-sequence.map.php                                24-Apr-2024 08:00                5451
ds-sequence.merge.php                              24-Apr-2024 08:00                4998
ds-sequence.pop.php                                24-Apr-2024 08:00                4354
ds-sequence.push.php                               24-Apr-2024 08:00                4792
ds-sequence.reduce.php                             24-Apr-2024 08:00                8105
ds-sequence.remove.php                             24-Apr-2024 08:00                4982
ds-sequence.reverse.php                            24-Apr-2024 08:00                3777
ds-sequence.reversed.php                           24-Apr-2024 08:00                4135
ds-sequence.rotate.php                             24-Apr-2024 08:00                5193
ds-sequence.set.php                                24-Apr-2024 08:00                6184
ds-sequence.shift.php                              24-Apr-2024 08:00                4455
ds-sequence.slice.php                              24-Apr-2024 08:00                7315
ds-sequence.sort.php                               24-Apr-2024 08:00                7528
ds-sequence.sorted.php                             24-Apr-2024 08:00                7552
ds-sequence.sum.php                                24-Apr-2024 08:00                5383
ds-sequence.unshift.php                            24-Apr-2024 08:00                4860
ds-set.add.php                                     24-Apr-2024 08:00               12167
ds-set.allocate.php                                24-Apr-2024 08:00                4541
ds-set.capacity.php                                24-Apr-2024 08:00                3906
ds-set.clear.php                                   24-Apr-2024 08:00                3759
ds-set.construct.php                               24-Apr-2024 08:00                4274
ds-set.contains.php                                24-Apr-2024 08:00                7282
ds-set.copy.php                                    24-Apr-2024 08:00                4228
ds-set.count.php                                   24-Apr-2024 08:00                1586
ds-set.diff.php                                    24-Apr-2024 08:00                4738
ds-set.filter.php                                  24-Apr-2024 08:00                7563
ds-set.first.php                                   24-Apr-2024 08:00                3710
ds-set.get.php                                     24-Apr-2024 08:00                6534
ds-set.intersect.php                               24-Apr-2024 08:00                4969
ds-set.isempty.php                                 24-Apr-2024 08:00                4093
ds-set.join.php                                    24-Apr-2024 08:00                5686
ds-set.jsonserialize.php                           24-Apr-2024 08:00                1851
ds-set.last.php                                    24-Apr-2024 08:00                3711
ds-set.merge.php                                   24-Apr-2024 08:00                4798
ds-set.reduce.php                                  24-Apr-2024 08:00                7932
ds-set.remove.php                                  24-Apr-2024 08:00                4976
ds-set.reverse.php                                 24-Apr-2024 08:00                3612
ds-set.reversed.php                                24-Apr-2024 08:00                3950
ds-set.slice.php                                   24-Apr-2024 08:00                7064
ds-set.sort.php                                    24-Apr-2024 08:00                7337
ds-set.sorted.php                                  24-Apr-2024 08:00                7361
ds-set.sum.php                                     24-Apr-2024 08:00                5198
ds-set.toarray.php                                 24-Apr-2024 08:00                4070
ds-set.union.php                                   24-Apr-2024 08:00                4932
ds-set.xor.php                                     24-Apr-2024 08:00                4908
ds-stack.allocate.php                              24-Apr-2024 08:00                2854
ds-stack.capacity.php                              24-Apr-2024 08:00                2189
ds-stack.clear.php                                 24-Apr-2024 08:00                3809
ds-stack.construct.php                             24-Apr-2024 08:00                4286
ds-stack.copy.php                                  24-Apr-2024 08:00                4289
ds-stack.count.php                                 24-Apr-2024 08:00                1622
ds-stack.isempty.php                               24-Apr-2024 08:00                4151
ds-stack.jsonserialize.php                         24-Apr-2024 08:00                1885
ds-stack.peek.php                                  24-Apr-2024 08:00                4333
ds-stack.pop.php                                   24-Apr-2024 08:00                4867
ds-stack.push.php                                  24-Apr-2024 08:00                4705
ds-stack.toarray.php                               24-Apr-2024 08:00                4115
ds-vector.allocate.php                             24-Apr-2024 08:00                4487
ds-vector.apply.php                                24-Apr-2024 08:00                4992
ds-vector.capacity.php                             24-Apr-2024 08:00                4408
ds-vector.clear.php                                24-Apr-2024 08:00                3840
ds-vector.construct.php                            24-Apr-2024 08:00                4354
ds-vector.contains.php                             24-Apr-2024 08:00                7119
ds-vector.copy.php                                 24-Apr-2024 08:00                4313
ds-vector.count.php                                24-Apr-2024 08:00                1639
ds-vector.filter.php                               24-Apr-2024 08:00                7649
ds-vector.find.php                                 24-Apr-2024 08:00                5451
ds-vector.first.php                                24-Apr-2024 08:00                3783
ds-vector.get.php                                  24-Apr-2024 08:00                6621
ds-vector.insert.php                               24-Apr-2024 08:00                6693
ds-vector.isempty.php                              24-Apr-2024 08:00                4159
ds-vector.join.php                                 24-Apr-2024 08:00                5767
ds-vector.jsonserialize.php                        24-Apr-2024 08:00                1893
ds-vector.last.php                                 24-Apr-2024 08:00                3770
ds-vector.map.php                                  24-Apr-2024 08:00                5354
ds-vector.merge.php                                24-Apr-2024 08:00                4903
ds-vector.pop.php                                  24-Apr-2024 08:00                4267
ds-vector.push.php                                 24-Apr-2024 08:00                4699
ds-vector.reduce.php                               24-Apr-2024 08:00                8014
ds-vector.remove.php                               24-Apr-2024 08:00                4895
ds-vector.reverse.php                              24-Apr-2024 08:00                3690
ds-vector.reversed.php                             24-Apr-2024 08:00                4042
ds-vector.rotate.php                               24-Apr-2024 08:00                5090
ds-vector.set.php                                  24-Apr-2024 08:00                6091
ds-vector.shift.php                                24-Apr-2024 08:00                4368
ds-vector.slice.php                                24-Apr-2024 08:00                7196
ds-vector.sort.php                                 24-Apr-2024 08:00                7433
ds-vector.sorted.php                               24-Apr-2024 08:00                7457
ds-vector.sum.php                                  24-Apr-2024 08:00                5288
ds-vector.toarray.php                              24-Apr-2024 08:00                4149
ds-vector.unshift.php                              24-Apr-2024 08:00                4779
ds.constants.php                                   24-Apr-2024 08:00                1169
ds.examples.php                                    24-Apr-2024 08:00                4726
ds.installation.php                                24-Apr-2024 08:00                2521
ds.requirements.php                                24-Apr-2024 08:00                1214
ds.setup.php                                       24-Apr-2024 08:00                1443
eio.configuration.php                              24-Apr-2024 08:00                1250
eio.constants.php                                  24-Apr-2024 08:00               21837
eio.examples.php                                   24-Apr-2024 08:00               27068
eio.installation.php                               24-Apr-2024 08:00                1727
eio.requirements.php                               24-Apr-2024 08:00                1334
eio.resources.php                                  24-Apr-2024 08:00                1242
eio.setup.php                                      24-Apr-2024 08:00                1595
emptyiterator.current.php                          24-Apr-2024 08:00                2732
emptyiterator.key.php                              24-Apr-2024 08:00                2696
emptyiterator.next.php                             24-Apr-2024 08:00                2394
emptyiterator.rewind.php                           24-Apr-2024 08:00                2416
emptyiterator.valid.php                            24-Apr-2024 08:00                2742
enchant.configuration.php                          24-Apr-2024 08:00                1280
enchant.constants.php                              24-Apr-2024 08:00                2948
enchant.examples.php                               24-Apr-2024 08:00                5438
enchant.installation.php                           24-Apr-2024 08:00                3198
enchant.requirements.php                           24-Apr-2024 08:00                1817
enchant.resources.php                              24-Apr-2024 08:00                1349
enchant.setup.php                                  24-Apr-2024 08:00                1640
error.clone.php                                    24-Apr-2024 08:00                2805
error.construct.php                                24-Apr-2024 08:00                3436
error.getcode.php                                  24-Apr-2024 08:00                4035
error.getfile.php                                  24-Apr-2024 08:00                3768
error.getline.php                                  24-Apr-2024 08:00                3979
error.getmessage.php                               24-Apr-2024 08:00                3843
error.getprevious.php                              24-Apr-2024 08:00                6605
error.gettrace.php                                 24-Apr-2024 08:00                4313
error.gettraceasstring.php                         24-Apr-2024 08:00                4096
error.tostring.php                                 24-Apr-2024 08:00                4007
errorexception.construct.php                       24-Apr-2024 08:00                6190
errorexception.getseverity.php                     24-Apr-2024 08:00                4376
errorfunc.configuration.php                        24-Apr-2024 08:00               25023
errorfunc.constants.php                            24-Apr-2024 08:00               11439
errorfunc.examples.php                             24-Apr-2024 08:00               19085
errorfunc.installation.php                         24-Apr-2024 08:00                1277
errorfunc.requirements.php                         24-Apr-2024 08:00                1241
errorfunc.resources.php                            24-Apr-2024 08:00                1239
errorfunc.setup.php                                24-Apr-2024 08:00                1655
ev.backend.php                                     24-Apr-2024 08:00                3394
ev.configuration.php                               24-Apr-2024 08:00                1245
ev.depth.php                                       24-Apr-2024 08:00                3264
ev.embeddablebackends.php                          24-Apr-2024 08:00                6463
ev.examples.php                                    24-Apr-2024 08:00               41811
ev.feedsignal.php                                  24-Apr-2024 08:00                3387
ev.feedsignalevent.php                             24-Apr-2024 08:00                3174
ev.global.constants.php                            24-Apr-2024 08:00                1323
ev.installation.php                                24-Apr-2024 08:00                1717
ev.iteration.php                                   24-Apr-2024 08:00                2640
ev.now.php                                         24-Apr-2024 08:00                3111
ev.nowupdate.php                                   24-Apr-2024 08:00                3188
ev.periodic-modes.php                              24-Apr-2024 08:00                7686
ev.recommendedbackends.php                         24-Apr-2024 08:00                7155
ev.requirements.php                                24-Apr-2024 08:00                1269
ev.resources.php                                   24-Apr-2024 08:00                1197
ev.resume.php                                      24-Apr-2024 08:00                3710
ev.run.php                                         24-Apr-2024 08:00                5085
ev.setup.php                                       24-Apr-2024 08:00                1550
ev.sleep.php                                       24-Apr-2024 08:00                2450
ev.stop.php                                        24-Apr-2024 08:00                2886
ev.supportedbackends.php                           24-Apr-2024 08:00                6445
ev.suspend.php                                     24-Apr-2024 08:00                3477
ev.time.php                                        24-Apr-2024 08:00                2685
ev.verify.php                                      24-Apr-2024 08:00                2272
ev.watcher-callbacks.php                           24-Apr-2024 08:00                4559
ev.watchers.php                                    24-Apr-2024 08:00                3479
evcheck.construct.php                              24-Apr-2024 08:00                3668
evcheck.createstopped.php                          24-Apr-2024 08:00                3774
evchild.construct.php                              24-Apr-2024 08:00                6745
evchild.createstopped.php                          24-Apr-2024 08:00                5145
evchild.set.php                                    24-Apr-2024 08:00                3223
evembed.construct.php                              24-Apr-2024 08:00                7961
evembed.createstopped.php                          24-Apr-2024 08:00                4787
evembed.set.php                                    24-Apr-2024 08:00                2574
evembed.sweep.php                                  24-Apr-2024 08:00                3073
event.add.php                                      24-Apr-2024 08:00               10289
event.addsignal.php                                24-Apr-2024 08:00                1690
event.addtimer.php                                 24-Apr-2024 08:00                1699
event.callbacks.php                                24-Apr-2024 08:00                5714
event.configuration.php                            24-Apr-2024 08:00                1266
event.construct.php                                24-Apr-2024 08:00                4596
event.constructing.signal.events.php               24-Apr-2024 08:00                6075
event.del.php                                      24-Apr-2024 08:00                2632
event.delsignal.php                                24-Apr-2024 08:00                1690
event.deltimer.php                                 24-Apr-2024 08:00                1687
event.examples.php                                 24-Apr-2024 08:00              165066
event.flags.php                                    24-Apr-2024 08:00                2640
event.free.php                                     24-Apr-2024 08:00                3032
event.getsupportedmethods.php                      24-Apr-2024 08:00                2682
event.installation.php                             24-Apr-2024 08:00                1744
event.pending.php                                  24-Apr-2024 08:00                3140
event.persistence.php                              24-Apr-2024 08:00                2968
event.requirements.php                             24-Apr-2024 08:00                1487
event.resources.php                                24-Apr-2024 08:00                1198
event.set.php                                      24-Apr-2024 08:00                4703
event.setpriority.php                              24-Apr-2024 08:00                2619
event.settimer.php                                 24-Apr-2024 08:00                4128
event.setup.php                                    24-Apr-2024 08:00                1589
event.signal.php                                   24-Apr-2024 08:00                4327
event.timer.php                                    24-Apr-2024 08:00                3621
eventbase.construct.php                            24-Apr-2024 08:00                3070
eventbase.dispatch.php                             24-Apr-2024 08:00                3326
eventbase.exit.php                                 24-Apr-2024 08:00                3114
eventbase.free.php                                 24-Apr-2024 08:00                3387
eventbase.getfeatures.php                          24-Apr-2024 08:00                5785
eventbase.getmethod.php                            24-Apr-2024 08:00                4572
eventbase.gettimeofdaycached.php                   24-Apr-2024 08:00                2757
eventbase.gotexit.php                              24-Apr-2024 08:00                3373
eventbase.gotstop.php                              24-Apr-2024 08:00                3345
eventbase.loop.php                                 24-Apr-2024 08:00                3657
eventbase.priorityinit.php                         24-Apr-2024 08:00                3091
eventbase.reinit.php                               24-Apr-2024 08:00                2420
eventbase.stop.php                                 24-Apr-2024 08:00                2885
eventbuffer.add.php                                24-Apr-2024 08:00                3092
eventbuffer.addbuffer.php                          24-Apr-2024 08:00                3444
eventbuffer.appendfrom.php                         24-Apr-2024 08:00                4950
eventbuffer.construct.php                          24-Apr-2024 08:00                1996
eventbuffer.copyout.php                            24-Apr-2024 08:00                4001
eventbuffer.drain.php                              24-Apr-2024 08:00                3567
eventbuffer.enablelocking.php                      24-Apr-2024 08:00                2914
eventbuffer.expand.php                             24-Apr-2024 08:00                2892
eventbuffer.freeze.php                             24-Apr-2024 08:00                3140
eventbuffer.lock.php                               24-Apr-2024 08:00                3039
eventbuffer.prepend.php                            24-Apr-2024 08:00                3567
eventbuffer.prependbuffer.php                      24-Apr-2024 08:00                3729
eventbuffer.pullup.php                             24-Apr-2024 08:00                4709
eventbuffer.read.php                               24-Apr-2024 08:00                4975
eventbuffer.readfrom.php                           24-Apr-2024 08:00                4414
eventbuffer.readline.php                           24-Apr-2024 08:00                4335
eventbuffer.search.php                             24-Apr-2024 08:00                8398
eventbuffer.searcheol.php                          24-Apr-2024 08:00                4940
eventbuffer.substr.php                             24-Apr-2024 08:00                3621
eventbuffer.unfreeze.php                           24-Apr-2024 08:00                3154
eventbuffer.unlock.php                             24-Apr-2024 08:00                2860
eventbuffer.write.php                              24-Apr-2024 08:00                3527
eventbufferevent.about.callbacks.php               24-Apr-2024 08:00                6179
eventbufferevent.close.php                         24-Apr-2024 08:00                2607
eventbufferevent.connect.php                       24-Apr-2024 08:00               23937
eventbufferevent.connecthost.php                   24-Apr-2024 08:00               17829
eventbufferevent.construct.php                     24-Apr-2024 08:00                6918
eventbufferevent.createpair.php                    24-Apr-2024 08:00                4370
eventbufferevent.disable.php                       24-Apr-2024 08:00                3595
eventbufferevent.enable.php                        24-Apr-2024 08:00                4065
eventbufferevent.free.php                          24-Apr-2024 08:00                2828
eventbufferevent.getdnserrorstring.php             24-Apr-2024 08:00                3152
eventbufferevent.getenabled.php                    24-Apr-2024 08:00                3101
eventbufferevent.getinput.php                      24-Apr-2024 08:00                5043
eventbufferevent.getoutput.php                     24-Apr-2024 08:00                7924
eventbufferevent.read.php                          24-Apr-2024 08:00                3123
eventbufferevent.readbuffer.php                    24-Apr-2024 08:00                3281
eventbufferevent.setcallbacks.php                  24-Apr-2024 08:00                4610
eventbufferevent.setpriority.php                   24-Apr-2024 08:00                3002
eventbufferevent.settimeouts.php                   24-Apr-2024 08:00                3226
eventbufferevent.setwatermark.php                  24-Apr-2024 08:00                4146
eventbufferevent.sslerror.php                      24-Apr-2024 08:00                5925
eventbufferevent.sslfilter.php                     24-Apr-2024 08:00               34541
eventbufferevent.sslgetcipherinfo.php              24-Apr-2024 08:00                2967
eventbufferevent.sslgetciphername.php              24-Apr-2024 08:00                2870
eventbufferevent.sslgetcipherversion.php           24-Apr-2024 08:00                2899
eventbufferevent.sslgetprotocol.php                24-Apr-2024 08:00                2776
eventbufferevent.sslrenegotiate.php                24-Apr-2024 08:00                2864
eventbufferevent.sslsocket.php                     24-Apr-2024 08:00                5946
eventbufferevent.write.php                         24-Apr-2024 08:00                3277
eventbufferevent.writebuffer.php                   24-Apr-2024 08:00                3399
eventconfig.avoidmethod.php                        24-Apr-2024 08:00                4439
eventconfig.construct.php                          24-Apr-2024 08:00                4086
eventconfig.requirefeatures.php                    24-Apr-2024 08:00                6037
eventconfig.setflags.php                           24-Apr-2024 08:00                3394
eventconfig.setmaxdispatchinterval.php             24-Apr-2024 08:00                4594
eventdnsbase.addnameserverip.php                   24-Apr-2024 08:00                3028
eventdnsbase.addsearch.php                         24-Apr-2024 08:00                2604
eventdnsbase.clearsearch.php                       24-Apr-2024 08:00                2845
eventdnsbase.construct.php                         24-Apr-2024 08:00                7568
eventdnsbase.countnameservers.php                  24-Apr-2024 08:00                2583
eventdnsbase.loadhosts.php                         24-Apr-2024 08:00                2901
eventdnsbase.parseresolvconf.php                   24-Apr-2024 08:00                4277
eventdnsbase.setoption.php                         24-Apr-2024 08:00                3475
eventdnsbase.setsearchndots.php                    24-Apr-2024 08:00                2964
eventhttp.accept.php                               24-Apr-2024 08:00               12437
eventhttp.addserveralias.php                       24-Apr-2024 08:00                6481
eventhttp.bind.php                                 24-Apr-2024 08:00                7900
eventhttp.construct.php                            24-Apr-2024 08:00               17435
eventhttp.removeserveralias.php                    24-Apr-2024 08:00                3287
eventhttp.setallowedmethods.php                    24-Apr-2024 08:00                3443
eventhttp.setcallback.php                          24-Apr-2024 08:00               18099
eventhttp.setdefaultcallback.php                   24-Apr-2024 08:00                7899
eventhttp.setmaxbodysize.php                       24-Apr-2024 08:00                2954
eventhttp.setmaxheaderssize.php                    24-Apr-2024 08:00                2866
eventhttp.settimeout.php                           24-Apr-2024 08:00                2557
eventhttpconnection.construct.php                  24-Apr-2024 08:00                5158
eventhttpconnection.getbase.php                    24-Apr-2024 08:00                2658
eventhttpconnection.getpeer.php                    24-Apr-2024 08:00                3073
eventhttpconnection.makerequest.php                24-Apr-2024 08:00               11707
eventhttpconnection.setclosecallback.php           24-Apr-2024 08:00                9478
eventhttpconnection.setlocaladdress.php            24-Apr-2024 08:00                3253
eventhttpconnection.setlocalport.php               24-Apr-2024 08:00                3144
eventhttpconnection.setmaxbodysize.php             24-Apr-2024 08:00                3178
eventhttpconnection.setmaxheaderssize.php          24-Apr-2024 08:00                3199
eventhttpconnection.setretries.php                 24-Apr-2024 08:00                2787
eventhttpconnection.settimeout.php                 24-Apr-2024 08:00                2684
eventhttprequest.addheader.php                     24-Apr-2024 08:00                4009
eventhttprequest.cancel.php                        24-Apr-2024 08:00                2882
eventhttprequest.clearheaders.php                  24-Apr-2024 08:00                2830
eventhttprequest.closeconnection.php               24-Apr-2024 08:00                2437
eventhttprequest.construct.php                     24-Apr-2024 08:00               11452
eventhttprequest.findheader.php                    24-Apr-2024 08:00                3586
eventhttprequest.free.php                          24-Apr-2024 08:00                2345
eventhttprequest.getbufferevent.php                24-Apr-2024 08:00                3714
eventhttprequest.getcommand.php                    24-Apr-2024 08:00                2722
eventhttprequest.getconnection.php                 24-Apr-2024 08:00                4468
eventhttprequest.gethost.php                       24-Apr-2024 08:00                2895
eventhttprequest.getinputbuffer.php                24-Apr-2024 08:00                2797
eventhttprequest.getinputheaders.php               24-Apr-2024 08:00                2888
eventhttprequest.getoutputbuffer.php               24-Apr-2024 08:00                2856
eventhttprequest.getoutputheaders.php              24-Apr-2024 08:00                2839
eventhttprequest.getresponsecode.php               24-Apr-2024 08:00                3175
eventhttprequest.geturi.php                        24-Apr-2024 08:00                3088
eventhttprequest.removeheader.php                  24-Apr-2024 08:00                3546
eventhttprequest.senderror.php                     24-Apr-2024 08:00                5881
eventhttprequest.sendreply.php                     24-Apr-2024 08:00                4089
eventhttprequest.sendreplychunk.php                24-Apr-2024 08:00                3461
eventhttprequest.sendreplyend.php                  24-Apr-2024 08:00                3063
eventhttprequest.sendreplystart.php                24-Apr-2024 08:00                4348
eventlistener.construct.php                        24-Apr-2024 08:00               22450
eventlistener.disable.php                          24-Apr-2024 08:00                2836
eventlistener.enable.php                           24-Apr-2024 08:00                2822
eventlistener.getbase.php                          24-Apr-2024 08:00                2361
eventlistener.getsocketname.php                    24-Apr-2024 08:00                3396
eventlistener.setcallback.php                      24-Apr-2024 08:00                6065
eventlistener.seterrorcallback.php                 24-Apr-2024 08:00                4435
eventsslcontext.construct.php                      24-Apr-2024 08:00                5333
eventutil.construct.php                            24-Apr-2024 08:00                2190
eventutil.getlastsocketerrno.php                   24-Apr-2024 08:00                3335
eventutil.getlastsocketerror.php                   24-Apr-2024 08:00                3151
eventutil.getsocketfd.php                          24-Apr-2024 08:00                3257
eventutil.getsocketname.php                        24-Apr-2024 08:00                3799
eventutil.setsocketoption.php                      24-Apr-2024 08:00                5725
eventutil.sslrandpoll.php                          24-Apr-2024 08:00                2410
evfork.construct.php                               24-Apr-2024 08:00                3694
evfork.createstopped.php                           24-Apr-2024 08:00                3976
evidle.construct.php                               24-Apr-2024 08:00                3698
evidle.createstopped.php                           24-Apr-2024 08:00                4174
evio.construct.php                                 24-Apr-2024 08:00                4846
evio.createstopped.php                             24-Apr-2024 08:00                5180
evio.set.php                                       24-Apr-2024 08:00                2869
evloop.backend.php                                 24-Apr-2024 08:00                2741
evloop.check.php                                   24-Apr-2024 08:00                3331
evloop.child.php                                   24-Apr-2024 08:00                3813
evloop.construct.php                               24-Apr-2024 08:00                4065
evloop.defaultloop.php                             24-Apr-2024 08:00                4660
evloop.embed.php                                   24-Apr-2024 08:00                3856
evloop.fork.php                                    24-Apr-2024 08:00                3413
evloop.idle.php                                    24-Apr-2024 08:00                3433
evloop.invokepending.php                           24-Apr-2024 08:00                2252
evloop.io.php                                      24-Apr-2024 08:00                3869
evloop.loopfork.php                                24-Apr-2024 08:00                2590
evloop.now.php                                     24-Apr-2024 08:00                2855
evloop.nowupdate.php                               24-Apr-2024 08:00                3167
evloop.periodic.php                                24-Apr-2024 08:00                4007
evloop.prepare.php                                 24-Apr-2024 08:00                3431
evloop.resume.php                                  24-Apr-2024 08:00                2827
evloop.run.php                                     24-Apr-2024 08:00                5068
evloop.signal.php                                  24-Apr-2024 08:00                3736
evloop.stat.php                                    24-Apr-2024 08:00                3917
evloop.stop.php                                    24-Apr-2024 08:00                2998
evloop.suspend.php                                 24-Apr-2024 08:00                2819
evloop.timer.php                                   24-Apr-2024 08:00                3934
evloop.verify.php                                  24-Apr-2024 08:00                2592
evperiodic.again.php                               24-Apr-2024 08:00                2582
evperiodic.at.php                                  24-Apr-2024 08:00                2662
evperiodic.construct.php                           24-Apr-2024 08:00               10051
evperiodic.createstopped.php                       24-Apr-2024 08:00                5882
evperiodic.set.php                                 24-Apr-2024 08:00                3226
evprepare.construct.php                            24-Apr-2024 08:00                3601
evprepare.createstopped.php                        24-Apr-2024 08:00                4337
evsignal.construct.php                             24-Apr-2024 08:00                5523
evsignal.createstopped.php                         24-Apr-2024 08:00                4862
evsignal.set.php                                   24-Apr-2024 08:00                2526
evstat.attr.php                                    24-Apr-2024 08:00                8241
evstat.construct.php                               24-Apr-2024 08:00                7246
evstat.createstopped.php                           24-Apr-2024 08:00                5238
evstat.prev.php                                    24-Apr-2024 08:00                2953
evstat.set.php                                     24-Apr-2024 08:00                2885
evstat.stat.php                                    24-Apr-2024 08:00                3010
evtimer.again.php                                  24-Apr-2024 08:00                3077
evtimer.construct.php                              24-Apr-2024 08:00               12686
evtimer.createstopped.php                          24-Apr-2024 08:00                8378
evtimer.set.php                                    24-Apr-2024 08:00                3042
evwatcher.clear.php                                24-Apr-2024 08:00                2849
evwatcher.construct.php                            24-Apr-2024 08:00                2131
evwatcher.feed.php                                 24-Apr-2024 08:00                2639
evwatcher.getloop.php                              24-Apr-2024 08:00                2335
evwatcher.invoke.php                               24-Apr-2024 08:00                2646
evwatcher.keepalive.php                            24-Apr-2024 08:00                5363
evwatcher.setcallback.php                          24-Apr-2024 08:00                2601
evwatcher.start.php                                24-Apr-2024 08:00                2524
evwatcher.stop.php                                 24-Apr-2024 08:00                2493
example.xml-external-entity.php                    24-Apr-2024 08:00               21393
example.xml-map-tags.php                           24-Apr-2024 08:00                8166
example.xml-structure.php                          24-Apr-2024 08:00                6254
example.xmlwriter-namespace.php                    24-Apr-2024 08:00                5398
example.xmlwriter-oop.php                          24-Apr-2024 08:00                3406
example.xmlwriter-simple.php                       24-Apr-2024 08:00                8653
exception.clone.php                                24-Apr-2024 08:00                3059
exception.construct.php                            24-Apr-2024 08:00                3806
exception.getcode.php                              24-Apr-2024 08:00                4603
exception.getfile.php                              24-Apr-2024 08:00                3893
exception.getline.php                              24-Apr-2024 08:00                4103
exception.getmessage.php                           24-Apr-2024 08:00                3950
exception.getprevious.php                          24-Apr-2024 08:00                6859
exception.gettrace.php                             24-Apr-2024 08:00                4428
exception.gettraceasstring.php                     24-Apr-2024 08:00                4211
exception.tostring.php                             24-Apr-2024 08:00                4164
exec.configuration.php                             24-Apr-2024 08:00                1259
exec.constants.php                                 24-Apr-2024 08:00                1198
exec.installation.php                              24-Apr-2024 08:00                1242
exec.requirements.php                              24-Apr-2024 08:00                1206
exec.resources.php                                 24-Apr-2024 08:00                1349
exec.setup.php                                     24-Apr-2024 08:00                1609
exif.configuration.php                             24-Apr-2024 08:00                7266
exif.constants.php                                 24-Apr-2024 08:00                2057
exif.installation.php                              24-Apr-2024 08:00                1671
exif.requirements.php                              24-Apr-2024 08:00                1788
exif.resources.php                                 24-Apr-2024 08:00                1204
exif.setup.php                                     24-Apr-2024 08:00                1607
expect.configuration.php                           24-Apr-2024 08:00                5411
expect.constants.php                               24-Apr-2024 08:00                3895
expect.examples-usage.php                          24-Apr-2024 08:00               12217
expect.examples.php                                24-Apr-2024 08:00                1427
expect.installation.php                            24-Apr-2024 08:00                2349
expect.requirements.php                            24-Apr-2024 08:00                1340
expect.resources.php                               24-Apr-2024 08:00                1426
expect.setup.php                                   24-Apr-2024 08:00                1633
extensions.alphabetical.php                        24-Apr-2024 08:00               20825
extensions.membership.php                          24-Apr-2024 08:00               20504
extensions.php                                     24-Apr-2024 08:00                1686
extensions.state.php                               24-Apr-2024 08:00                2719
fann.configuration.php                             24-Apr-2024 08:00                1259
fann.constants.php                                 24-Apr-2024 08:00               23619
fann.examples-1.php                                24-Apr-2024 08:00                8527
fann.examples.php                                  24-Apr-2024 08:00                1381
fann.installation.php                              24-Apr-2024 08:00                4916
fann.requirements.php                              24-Apr-2024 08:00                1195
fann.resources.php                                 24-Apr-2024 08:00                1163
fann.setup.php                                     24-Apr-2024 08:00                1580
fannconnection.construct.php                       24-Apr-2024 08:00                3031
fannconnection.getfromneuron.php                   24-Apr-2024 08:00                2388
fannconnection.gettoneuron.php                     24-Apr-2024 08:00                2376
fannconnection.getweight.php                       24-Apr-2024 08:00                2311
fannconnection.setweight.php                       24-Apr-2024 08:00                2958
faq.build.php                                      24-Apr-2024 08:00               22920
faq.com.php                                        24-Apr-2024 08:00               11556
faq.databases.php                                  24-Apr-2024 08:00                7277
faq.general.php                                    24-Apr-2024 08:00                4743
faq.html.php                                       24-Apr-2024 08:00               19593
faq.installation.php                               24-Apr-2024 08:00               24313
faq.mailinglist.php                                24-Apr-2024 08:00               10400
faq.misc.php                                       24-Apr-2024 08:00                4376
faq.obtaining.php                                  24-Apr-2024 08:00               10452
faq.passwords.php                                  24-Apr-2024 08:00                9570
faq.php                                            24-Apr-2024 08:00                2011
faq.using.php                                      24-Apr-2024 08:00               21825
fdf.configuration.php                              24-Apr-2024 08:00                1252
fdf.constants.php                                  24-Apr-2024 08:00                9232
fdf.examples.php                                   24-Apr-2024 08:00                6030
fdf.installation.php                               24-Apr-2024 08:00                3417
fdf.requirements.php                               24-Apr-2024 08:00                1532
fdf.resources.php                                  24-Apr-2024 08:00                1723
fdf.setup.php                                      24-Apr-2024 08:00                1588
features.commandline.differences.php               24-Apr-2024 08:00               12181
features.commandline.ini.php                       24-Apr-2024 08:00                2318
features.commandline.interactive.php               24-Apr-2024 08:00                8797
features.commandline.io-streams.php                24-Apr-2024 08:00                5940
features.commandline.options.php                   24-Apr-2024 08:00               25594
features.commandline.php                           24-Apr-2024 08:00                7347
features.commandline.usage.php                     24-Apr-2024 08:00               13785
features.commandline.webserver.php                 24-Apr-2024 08:00               12932
features.connection-handling.php                   24-Apr-2024 08:00                5470
features.cookies.php                               24-Apr-2024 08:00                2940
features.dtrace.dtrace.php                         24-Apr-2024 08:00               13965
features.dtrace.introduction.php                   24-Apr-2024 08:00                3140
features.dtrace.php                                24-Apr-2024 08:00                1676
features.dtrace.systemtap.php                      24-Apr-2024 08:00                8066
features.file-upload.common-pitfalls.php           24-Apr-2024 08:00                4880
features.file-upload.errors.php                    24-Apr-2024 08:00                3711
features.file-upload.errors.seealso.php            24-Apr-2024 08:00                1344
features.file-upload.multiple.php                  24-Apr-2024 08:00                6573
features.file-upload.php                           24-Apr-2024 08:00                1889
features.file-upload.post-method.php               24-Apr-2024 08:00               15636
features.file-upload.put-method.php                24-Apr-2024 08:00                5721
features.gc.collecting-cycles.php                  24-Apr-2024 08:00                7969
features.gc.performance-considerations.php         24-Apr-2024 08:00               13849
features.gc.php                                    24-Apr-2024 08:00                1771
features.gc.refcounting-basics.php                 24-Apr-2024 08:00               21446
features.http-auth.php                             24-Apr-2024 08:00               22886
features.persistent-connections.php                24-Apr-2024 08:00                8365
features.php                                       24-Apr-2024 08:00                3922
features.remote-files.php                          24-Apr-2024 08:00                7826
features.session.security.management.php           24-Apr-2024 08:00               23643
features.sessions.php                              24-Apr-2024 08:00                1423
features.xforms.php                                24-Apr-2024 08:00                5278
ffi-ctype.getalignment.php                         24-Apr-2024 08:00                2359
ffi-ctype.getarrayelementtype.php                  24-Apr-2024 08:00                2445
ffi-ctype.getarraylength.php                       24-Apr-2024 08:00                2402
ffi-ctype.getattributes.php                        24-Apr-2024 08:00                2378
ffi-ctype.getenumkind.php                          24-Apr-2024 08:00                2354
ffi-ctype.getfuncabi.php                           24-Apr-2024 08:00                2362
ffi-ctype.getfuncparametercount.php                24-Apr-2024 08:00                2468
ffi-ctype.getfuncparametertype.php                 24-Apr-2024 08:00                2713
ffi-ctype.getfuncreturntype.php                    24-Apr-2024 08:00                2427
ffi-ctype.getkind.php                              24-Apr-2024 08:00                2316
ffi-ctype.getname.php                              24-Apr-2024 08:00                2322
ffi-ctype.getpointertype.php                       24-Apr-2024 08:00                2371
ffi-ctype.getsize.php                              24-Apr-2024 08:00                2334
ffi-ctype.getstructfieldnames.php                  24-Apr-2024 08:00                2444
ffi-ctype.getstructfieldoffset.php                 24-Apr-2024 08:00                2709
ffi-ctype.getstructfieldtype.php                   24-Apr-2024 08:00                2671
ffi.addr.php                                       24-Apr-2024 08:00                2803
ffi.alignof.php                                    24-Apr-2024 08:00                2933
ffi.arraytype.php                                  24-Apr-2024 08:00                4633
ffi.cast.php                                       24-Apr-2024 08:00                4840
ffi.cdef.php                                       24-Apr-2024 08:00                4458
ffi.configuration.php                              24-Apr-2024 08:00                4313
ffi.constants.php                                  24-Apr-2024 08:00                1163
ffi.examples-basic.php                             24-Apr-2024 08:00               15793
ffi.examples-callback.php                          24-Apr-2024 08:00                4942
ffi.examples-complete.php                          24-Apr-2024 08:00                5353
ffi.examples.php                                   24-Apr-2024 08:00                1538
ffi.free.php                                       24-Apr-2024 08:00                2440
ffi.installation.php                               24-Apr-2024 08:00                1440
ffi.isnull.php                                     24-Apr-2024 08:00                2546
ffi.load.php                                       24-Apr-2024 08:00                4312
ffi.memcmp.php                                     24-Apr-2024 08:00                4111
ffi.memcpy.php                                     24-Apr-2024 08:00                3292
ffi.memset.php                                     24-Apr-2024 08:00                3132
ffi.new.php                                        24-Apr-2024 08:00                5172
ffi.requirements.php                               24-Apr-2024 08:00                1291
ffi.resources.php                                  24-Apr-2024 08:00                1197
ffi.scope.php                                      24-Apr-2024 08:00                3151
ffi.setup.php                                      24-Apr-2024 08:00                1578
ffi.sizeof.php                                     24-Apr-2024 08:00                2774
ffi.string.php                                     24-Apr-2024 08:00                4209
ffi.type.php                                       24-Apr-2024 08:00                3586
ffi.typeof.php                                     24-Apr-2024 08:00                2867
fiber.construct.php                                24-Apr-2024 08:00                2373
fiber.getcurrent.php                               24-Apr-2024 08:00                2523
fiber.getreturn.php                                24-Apr-2024 08:00                2596
fiber.isrunning.php                                24-Apr-2024 08:00                2744
fiber.isstarted.php                                24-Apr-2024 08:00                2358
fiber.issuspended.php                              24-Apr-2024 08:00                2373
fiber.isterminated.php                             24-Apr-2024 08:00                2430
fiber.resume.php                                   24-Apr-2024 08:00                3353
fiber.start.php                                    24-Apr-2024 08:00                3030
fiber.suspend.php                                  24-Apr-2024 08:00                4069
fiber.throw.php                                    24-Apr-2024 08:00                3213
fibererror.construct.php                           24-Apr-2024 08:00                2192
fileinfo.configuration.php                         24-Apr-2024 08:00                1287
fileinfo.constants.php                             24-Apr-2024 08:00                6079
fileinfo.installation.php                          24-Apr-2024 08:00                1710
fileinfo.requirements.php                          24-Apr-2024 08:00                1234
fileinfo.resources.php                             24-Apr-2024 08:00                1410
fileinfo.setup.php                                 24-Apr-2024 08:00                1653
filesystem.configuration.php                       24-Apr-2024 08:00                7374
filesystem.constants.php                           24-Apr-2024 08:00               13341
filesystem.installation.php                        24-Apr-2024 08:00                1284
filesystem.requirements.php                        24-Apr-2024 08:00                1248
filesystem.resources.php                           24-Apr-2024 08:00                1398
filesystem.setup.php                               24-Apr-2024 08:00                1679
filesystemiterator.construct.php                   24-Apr-2024 08:00                7539
filesystemiterator.current.php                     24-Apr-2024 08:00                5387
filesystemiterator.getflags.php                    24-Apr-2024 08:00                3210
filesystemiterator.key.php                         24-Apr-2024 08:00                5105
filesystemiterator.next.php                        24-Apr-2024 08:00                4512
filesystemiterator.rewind.php                      24-Apr-2024 08:00                5141
filesystemiterator.setflags.php                    24-Apr-2024 08:00                6664
filter.configuration.php                           24-Apr-2024 08:00                5063
filter.constants.php                               24-Apr-2024 08:00               25015
filter.examples.php                                24-Apr-2024 08:00                1488
filter.examples.sanitization.php                   24-Apr-2024 08:00                5583
filter.examples.validation.php                     24-Apr-2024 08:00               10144
filter.filters.flags.php                           24-Apr-2024 08:00               16858
filter.filters.misc.php                            24-Apr-2024 08:00                1947
filter.filters.php                                 24-Apr-2024 08:00                1640
filter.filters.sanitize.php                        24-Apr-2024 08:00               13631
filter.filters.validate.php                        24-Apr-2024 08:00               13944
filter.installation.php                            24-Apr-2024 08:00                1341
filter.requirements.php                            24-Apr-2024 08:00                1220
filter.resources.php                               24-Apr-2024 08:00                1212
filter.setup.php                                   24-Apr-2024 08:00                1617
filteriterator.accept.php                          24-Apr-2024 08:00                5305
filteriterator.construct.php                       24-Apr-2024 08:00                3088
filteriterator.current.php                         24-Apr-2024 08:00                2970
filteriterator.key.php                             24-Apr-2024 08:00                2910
filteriterator.next.php                            24-Apr-2024 08:00                2923
filteriterator.rewind.php                          24-Apr-2024 08:00                3101
filteriterator.valid.php                           24-Apr-2024 08:00                2825
filters.compression.php                            24-Apr-2024 08:00               15298
filters.convert.php                                24-Apr-2024 08:00               11480
filters.encryption.php                             24-Apr-2024 08:00               40862
filters.php                                        24-Apr-2024 08:00                3288
filters.string.php                                 24-Apr-2024 08:00                9961
finfo.buffer.php                                   24-Apr-2024 08:00                2905
finfo.construct.php                                24-Apr-2024 08:00                3075
finfo.file.php                                     24-Apr-2024 08:00                2896
finfo.set-flags.php                                24-Apr-2024 08:00                2109
fpm.observability.php                              24-Apr-2024 08:00                1420
fpm.setup.php                                      24-Apr-2024 08:00                1315
fpm.status.php                                     24-Apr-2024 08:00               10117
ftp.configuration.php                              24-Apr-2024 08:00                1252
ftp.constants.php                                  24-Apr-2024 08:00                5335
ftp.examples-basic.php                             24-Apr-2024 08:00                4798
ftp.examples.php                                   24-Apr-2024 08:00                1377
ftp.installation.php                               24-Apr-2024 08:00                1479
ftp.requirements.php                               24-Apr-2024 08:00                1199
ftp.resources.php                                  24-Apr-2024 08:00                1499
ftp.setup.php                                      24-Apr-2024 08:00                1588
funchand.configuration.php                         24-Apr-2024 08:00                1287
funchand.constants.php                             24-Apr-2024 08:00                1226
funchand.installation.php                          24-Apr-2024 08:00                1270
funchand.requirements.php                          24-Apr-2024 08:00                1234
funchand.resources.php                             24-Apr-2024 08:00                1232
funchand.setup.php                                 24-Apr-2024 08:00                1641
funcref.php                                        24-Apr-2024 08:00               13954
function.abs.php                                   24-Apr-2024 08:00                5579
function.acos.php                                  24-Apr-2024 08:00                3485
function.acosh.php                                 24-Apr-2024 08:00                3259
function.addcslashes.php                           24-Apr-2024 08:00                7822
function.addslashes.php                            24-Apr-2024 08:00                6196
function.apache-child-terminate.php                24-Apr-2024 08:00                3384
function.apache-get-modules.php                    24-Apr-2024 08:00                3412
function.apache-get-version.php                    24-Apr-2024 08:00                3919
function.apache-getenv.php                         24-Apr-2024 08:00                5213
function.apache-lookup-uri.php                     24-Apr-2024 08:00                5893
function.apache-note.php                           24-Apr-2024 08:00                7234
function.apache-request-headers.php                24-Apr-2024 08:00                5711
function.apache-response-headers.php               24-Apr-2024 08:00                4349
function.apache-setenv.php                         24-Apr-2024 08:00                5722
function.apcu-add.php                              24-Apr-2024 08:00                8499
function.apcu-cache-info.php                       24-Apr-2024 08:00                6721
function.apcu-cas.php                              24-Apr-2024 08:00                8787
function.apcu-clear-cache.php                      24-Apr-2024 08:00                2618
function.apcu-dec.php                              24-Apr-2024 08:00                8258
function.apcu-delete.php                           24-Apr-2024 08:00                6102
function.apcu-enabled.php                          24-Apr-2024 08:00                2411
function.apcu-entry.php                            24-Apr-2024 08:00                8472
function.apcu-exists.php                           24-Apr-2024 08:00                6974
function.apcu-fetch.php                            24-Apr-2024 08:00                5797
function.apcu-inc.php                              24-Apr-2024 08:00                8242
function.apcu-key-info.php                         24-Apr-2024 08:00                4993
function.apcu-sma-info.php                         24-Apr-2024 08:00                4643
function.apcu-store.php                            24-Apr-2024 08:00                7359
function.array-change-key-case.php                 24-Apr-2024 08:00                5328
function.array-chunk.php                           24-Apr-2024 08:00                7734
function.array-column.php                          24-Apr-2024 08:00               16964
function.array-combine.php                         24-Apr-2024 08:00                7550
function.array-count-values.php                    24-Apr-2024 08:00                5933
function.array-diff-assoc.php                      24-Apr-2024 08:00               11162
function.array-diff-key.php                        24-Apr-2024 08:00               12776
function.array-diff-uassoc.php                     24-Apr-2024 08:00               11936
function.array-diff-ukey.php                       24-Apr-2024 08:00               12281
function.array-diff.php                            24-Apr-2024 08:00               12177
function.array-fill-keys.php                       24-Apr-2024 08:00                5335
function.array-fill.php                            24-Apr-2024 08:00                9019
function.array-filter.php                          24-Apr-2024 08:00               16669
function.array-flip.php                            24-Apr-2024 08:00                7224
function.array-intersect-assoc.php                 24-Apr-2024 08:00                8819
function.array-intersect-key.php                   24-Apr-2024 08:00               10081
function.array-intersect-uassoc.php                24-Apr-2024 08:00                9054
function.array-intersect-ukey.php                  24-Apr-2024 08:00               11964
function.array-intersect.php                       24-Apr-2024 08:00                6963
function.array-is-list.php                         24-Apr-2024 08:00                7128
function.array-key-exists.php                      24-Apr-2024 08:00                9909
function.array-key-first.php                       24-Apr-2024 08:00                7115
function.array-key-last.php                        24-Apr-2024 08:00                3381
function.array-keys.php                            24-Apr-2024 08:00                8419
function.array-map.php                             24-Apr-2024 08:00               27462
function.array-merge-recursive.php                 24-Apr-2024 08:00                6942
function.array-merge.php                           24-Apr-2024 08:00               12548
function.array-multisort.php                       24-Apr-2024 08:00               23526
function.array-pad.php                             24-Apr-2024 08:00                7470
function.array-pop.php                             24-Apr-2024 08:00                5729
function.array-product.php                         24-Apr-2024 08:00                5740
function.array-push.php                            24-Apr-2024 08:00                7065
function.array-rand.php                            24-Apr-2024 08:00                9446
function.array-reduce.php                          24-Apr-2024 08:00               10009
function.array-replace-recursive.php               24-Apr-2024 08:00               11225
function.array-replace.php                         24-Apr-2024 08:00                6884
function.array-reverse.php                         24-Apr-2024 08:00                6187
function.array-search.php                          24-Apr-2024 08:00                8417
function.array-shift.php                           24-Apr-2024 08:00                5776
function.array-slice.php                           24-Apr-2024 08:00               13935
function.array-splice.php                          24-Apr-2024 08:00               17708
function.array-sum.php                             24-Apr-2024 08:00                6392
function.array-udiff-assoc.php                     24-Apr-2024 08:00               17903
function.array-udiff-uassoc.php                    24-Apr-2024 08:00               19348
function.array-udiff.php                           24-Apr-2024 08:00               30098
function.array-uintersect-assoc.php                24-Apr-2024 08:00               11847
function.array-uintersect-uassoc.php               24-Apr-2024 08:00               12195
function.array-uintersect.php                      24-Apr-2024 08:00               11448
function.array-unique.php                          24-Apr-2024 08:00                9732
function.array-unshift.php                         24-Apr-2024 08:00               11095
function.array-values.php                          24-Apr-2024 08:00                4582
function.array-walk-recursive.php                  24-Apr-2024 08:00                7660
function.array-walk.php                            24-Apr-2024 08:00               13807
function.array.php                                 24-Apr-2024 08:00               11472
function.arsort.php                                24-Apr-2024 08:00                9298
function.asin.php                                  24-Apr-2024 08:00                3480
function.asinh.php                                 24-Apr-2024 08:00                3255
function.asort.php                                 24-Apr-2024 08:00                9283
function.assert-options.php                        24-Apr-2024 08:00               14094
function.assert.php                                24-Apr-2024 08:00               22235
function.atan.php                                  24-Apr-2024 08:00                3493
function.atan2.php                                 24-Apr-2024 08:00                3449
function.atanh.php                                 24-Apr-2024 08:00                3280
function.autoload.php                              24-Apr-2024 08:00                3158
function.base-convert.php                          24-Apr-2024 08:00                6592
function.base64-decode.php                         24-Apr-2024 08:00                5172
function.base64-encode.php                         24-Apr-2024 08:00                4657
function.basename.php                              24-Apr-2024 08:00                7512
function.bcadd.php                                 24-Apr-2024 08:00                5821
function.bccomp.php                                24-Apr-2024 08:00                5762
function.bcdiv.php                                 24-Apr-2024 08:00                5413
function.bcmod.php                                 24-Apr-2024 08:00                7460
function.bcmul.php                                 24-Apr-2024 08:00                7181
function.bcpow.php                                 24-Apr-2024 08:00                7184
function.bcpowmod.php                              24-Apr-2024 08:00                7376
function.bcscale.php                               24-Apr-2024 08:00                5533
function.bcsqrt.php                                24-Apr-2024 08:00                6248
function.bcsub.php                                 24-Apr-2024 08:00                5827
function.bin2hex.php                               24-Apr-2024 08:00                4512
function.bind-textdomain-codeset.php               24-Apr-2024 08:00                4609
function.bindec.php                                24-Apr-2024 08:00               14846
function.bindtextdomain.php                        24-Apr-2024 08:00                5540
function.boolval.php                               24-Apr-2024 08:00               10194
function.bzclose.php                               24-Apr-2024 08:00                3071
function.bzcompress.php                            24-Apr-2024 08:00                5199
function.bzdecompress.php                          24-Apr-2024 08:00                6630
function.bzerrno.php                               24-Apr-2024 08:00                3149
function.bzerror.php                               24-Apr-2024 08:00                4377
function.bzerrstr.php                              24-Apr-2024 08:00                3157
function.bzflush.php                               24-Apr-2024 08:00                3377
function.bzopen.php                                24-Apr-2024 08:00                5246
function.bzread.php                                24-Apr-2024 08:00                6487
function.bzwrite.php                               24-Apr-2024 08:00                6357
function.cal-days-in-month.php                     24-Apr-2024 08:00                4652
function.cal-from-jd.php                           24-Apr-2024 08:00                7028
function.cal-info.php                              24-Apr-2024 08:00                6070
function.cal-to-jd.php                             24-Apr-2024 08:00                6078
function.call-user-func-array.php                  24-Apr-2024 08:00               17521
function.call-user-func.php                        24-Apr-2024 08:00               14323
function.ceil.php                                  24-Apr-2024 08:00                5163
function.chdir.php                                 24-Apr-2024 08:00                5581
function.checkdate.php                             24-Apr-2024 08:00                5556
function.checkdnsrr.php                            24-Apr-2024 08:00                5091
function.chgrp.php                                 24-Apr-2024 08:00                6661
function.chmod.php                                 24-Apr-2024 08:00                8740
function.chop.php                                  24-Apr-2024 08:00                2058
function.chown.php                                 24-Apr-2024 08:00                6749
function.chr.php                                   24-Apr-2024 08:00                8818
function.chroot.php                                24-Apr-2024 08:00                4735
function.chunk-split.php                           24-Apr-2024 08:00                5203
function.class-alias.php                           24-Apr-2024 08:00                9008
function.class-exists.php                          24-Apr-2024 08:00                7055
function.class-implements.php                      24-Apr-2024 08:00                7314
function.class-parents.php                         24-Apr-2024 08:00                7022
function.class-uses.php                            24-Apr-2024 08:00                6332
function.clearstatcache.php                        24-Apr-2024 08:00               10899
function.cli-get-process-title.php                 24-Apr-2024 08:00                4506
function.cli-set-process-title.php                 24-Apr-2024 08:00                5563
function.closedir.php                              24-Apr-2024 08:00                4884
function.closelog.php                              24-Apr-2024 08:00                2882
function.com-create-guid.php                       24-Apr-2024 08:00                2873
function.com-event-sink.php                        24-Apr-2024 08:00               10417
function.com-get-active-object.php                 24-Apr-2024 08:00                5709
function.com-load-typelib.php                      24-Apr-2024 08:00                5231
function.com-message-pump.php                      24-Apr-2024 08:00                4096
function.com-print-typeinfo.php                    24-Apr-2024 08:00                5162
function.commonmark-parse.php                      24-Apr-2024 08:00                4177
function.commonmark-render-html.php                24-Apr-2024 08:00                4714
function.commonmark-render-latex.php               24-Apr-2024 08:00                5044
function.commonmark-render-man.php                 24-Apr-2024 08:00                5026
function.commonmark-render-xml.php                 24-Apr-2024 08:00                4671
function.commonmark-render.php                     24-Apr-2024 08:00                4972
function.compact.php                               24-Apr-2024 08:00                8214
function.connection-aborted.php                    24-Apr-2024 08:00                2997
function.connection-status.php                     24-Apr-2024 08:00                3185
function.constant.php                              24-Apr-2024 08:00                9177
function.convert-cyr-string.php                    24-Apr-2024 08:00                5075
function.convert-uudecode.php                      24-Apr-2024 08:00                4467
function.convert-uuencode.php                      24-Apr-2024 08:00                5371
function.copy.php                                  24-Apr-2024 08:00                6030
function.cos.php                                   24-Apr-2024 08:00                3966
function.cosh.php                                  24-Apr-2024 08:00                3200
function.count-chars.php                           24-Apr-2024 08:00                7429
function.count.php                                 24-Apr-2024 08:00               16345
function.crc32.php                                 24-Apr-2024 08:00                6968
function.create-function.php                       24-Apr-2024 08:00               30956
function.crypt.php                                 24-Apr-2024 08:00               12978
function.ctype-alnum.php                           24-Apr-2024 08:00                6846
function.ctype-alpha.php                           24-Apr-2024 08:00                7196
function.ctype-cntrl.php                           24-Apr-2024 08:00                6847
function.ctype-digit.php                           24-Apr-2024 08:00                8974
function.ctype-graph.php                           24-Apr-2024 08:00                7531
function.ctype-lower.php                           24-Apr-2024 08:00                6900
function.ctype-print.php                           24-Apr-2024 08:00                7589
function.ctype-punct.php                           24-Apr-2024 08:00                6891
function.ctype-space.php                           24-Apr-2024 08:00                7634
function.ctype-upper.php                           24-Apr-2024 08:00                6947
function.ctype-xdigit.php                          24-Apr-2024 08:00                6775
function.cubrid-affected-rows.php                  24-Apr-2024 08:00                9427
function.cubrid-bind.php                           24-Apr-2024 08:00               20705
function.cubrid-client-encoding.php                24-Apr-2024 08:00                5307
function.cubrid-close-prepare.php                  24-Apr-2024 08:00                6284
function.cubrid-close-request.php                  24-Apr-2024 08:00                6295
function.cubrid-close.php                          24-Apr-2024 08:00                6427
function.cubrid-col-get.php                        24-Apr-2024 08:00                8588
function.cubrid-col-size.php                       24-Apr-2024 08:00                8679
function.cubrid-column-names.php                   24-Apr-2024 08:00                8523
function.cubrid-column-types.php                   24-Apr-2024 08:00                8503
function.cubrid-commit.php                         24-Apr-2024 08:00               15339
function.cubrid-connect-with-url.php               24-Apr-2024 08:00               15125
function.cubrid-connect.php                        24-Apr-2024 08:00               12337
function.cubrid-current-oid.php                    24-Apr-2024 08:00                6004
function.cubrid-data-seek.php                      24-Apr-2024 08:00                7495
function.cubrid-db-name.php                        24-Apr-2024 08:00                6579
function.cubrid-disconnect.php                     24-Apr-2024 08:00                7145
function.cubrid-drop.php                           24-Apr-2024 08:00               11434
function.cubrid-errno.php                          24-Apr-2024 08:00                6836
function.cubrid-error-code-facility.php            24-Apr-2024 08:00                5842
function.cubrid-error-code.php                     24-Apr-2024 08:00                5752
function.cubrid-error-msg.php                      24-Apr-2024 08:00                5202
function.cubrid-error.php                          24-Apr-2024 08:00                6396
function.cubrid-execute.php                        24-Apr-2024 08:00               14380
function.cubrid-fetch-array.php                    24-Apr-2024 08:00                9837
function.cubrid-fetch-assoc.php                    24-Apr-2024 08:00                9071
function.cubrid-fetch-field.php                    24-Apr-2024 08:00               14107
function.cubrid-fetch-lengths.php                  24-Apr-2024 08:00                6157
function.cubrid-fetch-object.php                   24-Apr-2024 08:00               12050
function.cubrid-fetch-row.php                      24-Apr-2024 08:00                8995
function.cubrid-fetch.php                          24-Apr-2024 08:00                9969
function.cubrid-field-flags.php                    24-Apr-2024 08:00                7815
function.cubrid-field-len.php                      24-Apr-2024 08:00                8324
function.cubrid-field-name.php                     24-Apr-2024 08:00                7230
function.cubrid-field-seek.php                     24-Apr-2024 08:00               10982
function.cubrid-field-table.php                    24-Apr-2024 08:00                7447
function.cubrid-field-type.php                     24-Apr-2024 08:00                7497
function.cubrid-free-result.php                    24-Apr-2024 08:00                5951
function.cubrid-get-autocommit.php                 24-Apr-2024 08:00                3830
function.cubrid-get-charset.php                    24-Apr-2024 08:00                5041
function.cubrid-get-class-name.php                 24-Apr-2024 08:00                6346
function.cubrid-get-client-info.php                24-Apr-2024 08:00                8154
function.cubrid-get-db-parameter.php               24-Apr-2024 08:00               14286
function.cubrid-get-query-timeout.php              24-Apr-2024 08:00                6732
function.cubrid-get-server-info.php                24-Apr-2024 08:00                8445
function.cubrid-get.php                            24-Apr-2024 08:00                9879
function.cubrid-insert-id.php                      24-Apr-2024 08:00                7160
function.cubrid-is-instance.php                    24-Apr-2024 08:00                7203
function.cubrid-list-dbs.php                       24-Apr-2024 08:00                4577
function.cubrid-load-from-glo.php                  24-Apr-2024 08:00                6898
function.cubrid-lob-close.php                      24-Apr-2024 08:00                7264
function.cubrid-lob-export.php                     24-Apr-2024 08:00                7843
function.cubrid-lob-get.php                        24-Apr-2024 08:00                7648
function.cubrid-lob-send.php                       24-Apr-2024 08:00                7018
function.cubrid-lob-size.php                       24-Apr-2024 08:00                5840
function.cubrid-lob2-bind.php                      24-Apr-2024 08:00                9728
function.cubrid-lob2-close.php                     24-Apr-2024 08:00                3419
function.cubrid-lob2-export.php                    24-Apr-2024 08:00                8721
function.cubrid-lob2-import.php                    24-Apr-2024 08:00                8590
function.cubrid-lob2-new.php                       24-Apr-2024 08:00                3945
function.cubrid-lob2-read.php                      24-Apr-2024 08:00               13714
function.cubrid-lob2-seek.php                      24-Apr-2024 08:00               11252
function.cubrid-lob2-seek64.php                    24-Apr-2024 08:00               12672
function.cubrid-lob2-size.php                      24-Apr-2024 08:00                4326
function.cubrid-lob2-size64.php                    24-Apr-2024 08:00                4506
function.cubrid-lob2-tell.php                      24-Apr-2024 08:00                4345
function.cubrid-lob2-tell64.php                    24-Apr-2024 08:00                4543
function.cubrid-lob2-write.php                     24-Apr-2024 08:00               14014
function.cubrid-lock-read.php                      24-Apr-2024 08:00                9155
function.cubrid-lock-write.php                     24-Apr-2024 08:00                9543
function.cubrid-move-cursor.php                    24-Apr-2024 08:00                9527
function.cubrid-new-glo.php                        24-Apr-2024 08:00                6949
function.cubrid-next-result.php                    24-Apr-2024 08:00               16314
function.cubrid-num-cols.php                       24-Apr-2024 08:00                6000
function.cubrid-num-fields.php                     24-Apr-2024 08:00                5724
function.cubrid-num-rows.php                       24-Apr-2024 08:00                7184
function.cubrid-pconnect-with-url.php              24-Apr-2024 08:00               14452
function.cubrid-pconnect.php                       24-Apr-2024 08:00               12118
function.cubrid-ping.php                           24-Apr-2024 08:00                6113
function.cubrid-prepare.php                        24-Apr-2024 08:00               10273
function.cubrid-put.php                            24-Apr-2024 08:00               11376
function.cubrid-query.php                          24-Apr-2024 08:00               14747
function.cubrid-real-escape-string.php             24-Apr-2024 08:00                8245
function.cubrid-result.php                         24-Apr-2024 08:00                7455
function.cubrid-rollback.php                       24-Apr-2024 08:00               14634
function.cubrid-save-to-glo.php                    24-Apr-2024 08:00                6811
function.cubrid-schema.php                         24-Apr-2024 08:00               20470
function.cubrid-send-glo.php                       24-Apr-2024 08:00                6278
function.cubrid-seq-drop.php                       24-Apr-2024 08:00                9804
function.cubrid-seq-insert.php                     24-Apr-2024 08:00               10310
function.cubrid-seq-put.php                        24-Apr-2024 08:00               10237
function.cubrid-set-add.php                        24-Apr-2024 08:00                9576
function.cubrid-set-autocommit.php                 24-Apr-2024 08:00                4182
function.cubrid-set-db-parameter.php               24-Apr-2024 08:00                8191
function.cubrid-set-drop.php                       24-Apr-2024 08:00                9553
function.cubrid-set-query-timeout.php              24-Apr-2024 08:00                3570
function.cubrid-unbuffered-query.php               24-Apr-2024 08:00                7041
function.cubrid-version.php                        24-Apr-2024 08:00                8704
function.curl-close.php                            24-Apr-2024 08:00                5962
function.curl-copy-handle.php                      24-Apr-2024 08:00                6331
function.curl-errno.php                            24-Apr-2024 08:00                5978
function.curl-error.php                            24-Apr-2024 08:00                5909
function.curl-escape.php                           24-Apr-2024 08:00                7428
function.curl-exec.php                             24-Apr-2024 08:00                7295
function.curl-getinfo.php                          24-Apr-2024 08:00               40062
function.curl-init.php                             24-Apr-2024 08:00                7179
function.curl-multi-add-handle.php                 24-Apr-2024 08:00               10107
function.curl-multi-close.php                      24-Apr-2024 08:00                9488
function.curl-multi-errno.php                      24-Apr-2024 08:00                3862
function.curl-multi-exec.php                       24-Apr-2024 08:00               10182
function.curl-multi-getcontent.php                 24-Apr-2024 08:00                4374
function.curl-multi-info-read.php                  24-Apr-2024 08:00               12118
function.curl-multi-init.php                       24-Apr-2024 08:00                8635
function.curl-multi-remove-handle.php              24-Apr-2024 08:00                5367
function.curl-multi-select.php                     24-Apr-2024 08:00                4339
function.curl-multi-setopt.php                     24-Apr-2024 08:00               12891
function.curl-multi-strerror.php                   24-Apr-2024 08:00                7043
function.curl-pause.php                            24-Apr-2024 08:00                3844
function.curl-reset.php                            24-Apr-2024 08:00                6302
function.curl-setopt-array.php                     24-Apr-2024 08:00                7528
function.curl-setopt.php                           24-Apr-2024 08:00              165959
function.curl-share-close.php                      24-Apr-2024 08:00                7842
function.curl-share-errno.php                      24-Apr-2024 08:00                3862
function.curl-share-init.php                       24-Apr-2024 08:00                7433
function.curl-share-setopt.php                     24-Apr-2024 08:00               10060
function.curl-share-strerror.php                   24-Apr-2024 08:00                3419
function.curl-strerror.php                         24-Apr-2024 08:00                6195
function.curl-unescape.php                         24-Apr-2024 08:00                7852
function.curl-version.php                          24-Apr-2024 08:00                6813
function.curl_upkeep.php                           24-Apr-2024 08:00                6869
function.current.php                               24-Apr-2024 08:00               11295
function.date-add.php                              24-Apr-2024 08:00                1747
function.date-create-from-format.php               24-Apr-2024 08:00                1922
function.date-create-immutable-from-format.php     24-Apr-2024 08:00                2034
function.date-create-immutable.php                 24-Apr-2024 08:00                4263
function.date-create.php                           24-Apr-2024 08:00                4417
function.date-date-set.php                         24-Apr-2024 08:00                1806
function.date-default-timezone-get.php             24-Apr-2024 08:00                6932
function.date-default-timezone-set.php             24-Apr-2024 08:00                5616
function.date-diff.php                             24-Apr-2024 08:00                1766
function.date-format.php                           24-Apr-2024 08:00                1774
function.date-get-last-errors.php                  24-Apr-2024 08:00                1939
function.date-interval-create-from-date-string.php 24-Apr-2024 08:00                2050
function.date-interval-format.php                  24-Apr-2024 08:00                1901
function.date-isodate-set.php                      24-Apr-2024 08:00                1829
function.date-modify.php                           24-Apr-2024 08:00                1778
function.date-offset-get.php                       24-Apr-2024 08:00                1822
function.date-parse-from-format.php                24-Apr-2024 08:00               13775
function.date-parse.php                            24-Apr-2024 08:00               19396
function.date-sub.php                              24-Apr-2024 08:00                2349
function.date-sun-info.php                         24-Apr-2024 08:00               15744
function.date-sunrise.php                          24-Apr-2024 08:00               14159
function.date-sunset.php                           24-Apr-2024 08:00               14139
function.date-time-set.php                         24-Apr-2024 08:00                1792
function.date-timestamp-get.php                    24-Apr-2024 08:00                1851
function.date-timestamp-set.php                    24-Apr-2024 08:00                1859
function.date-timezone-get.php                     24-Apr-2024 08:00                1848
function.date-timezone-set.php                     24-Apr-2024 08:00                1820
function.date.php                                  24-Apr-2024 08:00               21413
function.db2-autocommit.php                        24-Apr-2024 08:00               11073
function.db2-bind-param.php                        24-Apr-2024 08:00               22844
function.db2-client-info.php                       24-Apr-2024 08:00               11642
function.db2-close.php                             24-Apr-2024 08:00                5654
function.db2-column-privileges.php                 24-Apr-2024 08:00                9166
function.db2-columns.php                           24-Apr-2024 08:00               11215
function.db2-commit.php                            24-Apr-2024 08:00                3726
function.db2-conn-error.php                        24-Apr-2024 08:00                6982
function.db2-conn-errormsg.php                     24-Apr-2024 08:00                6741
function.db2-connect.php                           24-Apr-2024 08:00               39215
function.db2-cursor-type.php                       24-Apr-2024 08:00                3336
function.db2-escape-string.php                     24-Apr-2024 08:00                7605
function.db2-exec.php                              24-Apr-2024 08:00               26284
function.db2-execute.php                           24-Apr-2024 08:00               25638
function.db2-fetch-array.php                       24-Apr-2024 08:00               11295
function.db2-fetch-assoc.php                       24-Apr-2024 08:00               11311
function.db2-fetch-both.php                        24-Apr-2024 08:00               11844
function.db2-fetch-object.php                      24-Apr-2024 08:00                9024
function.db2-fetch-row.php                         24-Apr-2024 08:00               16308
function.db2-field-display-size.php                24-Apr-2024 08:00                5130
function.db2-field-name.php                        24-Apr-2024 08:00                5018
function.db2-field-num.php                         24-Apr-2024 08:00                5026
function.db2-field-precision.php                   24-Apr-2024 08:00                5058
function.db2-field-scale.php                       24-Apr-2024 08:00                5020
function.db2-field-type.php                        24-Apr-2024 08:00                5023
function.db2-field-width.php                       24-Apr-2024 08:00                5228
function.db2-foreign-keys.php                      24-Apr-2024 08:00                9071
function.db2-free-result.php                       24-Apr-2024 08:00                3384
function.db2-free-stmt.php                         24-Apr-2024 08:00                3372
function.db2-get-option.php                        24-Apr-2024 08:00               24085
function.db2-last-insert-id.php                    24-Apr-2024 08:00                8165
function.db2-lob-read.php                          24-Apr-2024 08:00               16393
function.db2-next-result.php                       24-Apr-2024 08:00                8839
function.db2-num-fields.php                        24-Apr-2024 08:00                7180
function.db2-num-rows.php                          24-Apr-2024 08:00                4745
function.db2-pclose.php                            24-Apr-2024 08:00                5847
function.db2-pconnect.php                          24-Apr-2024 08:00               32255
function.db2-prepare.php                           24-Apr-2024 08:00               10586
function.db2-primary-keys.php                      24-Apr-2024 08:00                7705
function.db2-procedure-columns.php                 24-Apr-2024 08:00               12173
function.db2-procedures.php                        24-Apr-2024 08:00                8034
function.db2-result.php                            24-Apr-2024 08:00                7983
function.db2-rollback.php                          24-Apr-2024 08:00                9306
function.db2-server-info.php                       24-Apr-2024 08:00               22488
function.db2-set-option.php                        24-Apr-2024 08:00               67333
function.db2-special-columns.php                   24-Apr-2024 08:00               10286
function.db2-statistics.php                        24-Apr-2024 08:00               12557
function.db2-stmt-error.php                        24-Apr-2024 08:00                4635
function.db2-stmt-errormsg.php                     24-Apr-2024 08:00                4266
function.db2-table-privileges.php                  24-Apr-2024 08:00                8595
function.db2-tables.php                            24-Apr-2024 08:00                8925
function.dba-close.php                             24-Apr-2024 08:00                3197
function.dba-delete.php                            24-Apr-2024 08:00                4130
function.dba-exists.php                            24-Apr-2024 08:00                4175
function.dba-fetch.php                             24-Apr-2024 08:00                7116
function.dba-firstkey.php                          24-Apr-2024 08:00                3654
function.dba-handlers.php                          24-Apr-2024 08:00                5541
function.dba-insert.php                            24-Apr-2024 08:00                4768
function.dba-key-split.php                         24-Apr-2024 08:00                3964
function.dba-list.php                              24-Apr-2024 08:00                2245
function.dba-nextkey.php                           24-Apr-2024 08:00                3576
function.dba-open.php                              24-Apr-2024 08:00               13825
function.dba-optimize.php                          24-Apr-2024 08:00                3214
function.dba-popen.php                             24-Apr-2024 08:00                9155
function.dba-replace.php                           24-Apr-2024 08:00                4596
function.dba-sync.php                              24-Apr-2024 08:00                3234
function.dbase-add-record.php                      24-Apr-2024 08:00                6912
function.dbase-close.php                           24-Apr-2024 08:00                5251
function.dbase-create.php                          24-Apr-2024 08:00                8243
function.dbase-delete-record.php                   24-Apr-2024 08:00                4990
function.dbase-get-header-info.php                 24-Apr-2024 08:00                7015
function.dbase-get-record-with-names.php           24-Apr-2024 08:00                8810
function.dbase-get-record.php                      24-Apr-2024 08:00                5759
function.dbase-numfields.php                       24-Apr-2024 08:00                5978
function.dbase-numrecords.php                      24-Apr-2024 08:00                6924
function.dbase-open.php                            24-Apr-2024 08:00                6572
function.dbase-pack.php                            24-Apr-2024 08:00                6343
function.dbase-replace-record.php                  24-Apr-2024 08:00                9470
function.dcgettext.php                             24-Apr-2024 08:00                3533
function.dcngettext.php                            24-Apr-2024 08:00                4185
function.debug-backtrace.php                       24-Apr-2024 08:00               11847
function.debug-print-backtrace.php                 24-Apr-2024 08:00                6466
function.debug-zval-dump.php                       24-Apr-2024 08:00                9524
function.decbin.php                                24-Apr-2024 08:00                8728
function.dechex.php                                24-Apr-2024 08:00                7157
function.decoct.php                                24-Apr-2024 08:00                4801
function.define.php                                24-Apr-2024 08:00               11913
function.defined.php                               24-Apr-2024 08:00                7814
function.deflate-add.php                           24-Apr-2024 08:00                5959
function.deflate-init.php                          24-Apr-2024 08:00                7902
function.deg2rad.php                               24-Apr-2024 08:00                4017
function.delete.php                                24-Apr-2024 08:00                2409
function.dgettext.php                              24-Apr-2024 08:00                3285
function.die.php                                   24-Apr-2024 08:00                1590
function.dio-close.php                             24-Apr-2024 08:00                3989
function.dio-fcntl.php                             24-Apr-2024 08:00                9649
function.dio-open.php                              24-Apr-2024 08:00                8500
function.dio-read.php                              24-Apr-2024 08:00                3528
function.dio-seek.php                              24-Apr-2024 08:00                7429
function.dio-stat.php                              24-Apr-2024 08:00                4300
function.dio-tcsetattr.php                         24-Apr-2024 08:00                6890
function.dio-truncate.php                          24-Apr-2024 08:00                3747
function.dio-write.php                             24-Apr-2024 08:00                3852
function.dir.php                                   24-Apr-2024 08:00                7237
function.dirname.php                               24-Apr-2024 08:00                9429
function.disk-free-space.php                       24-Apr-2024 08:00                5468
function.disk-total-space.php                      24-Apr-2024 08:00                5183
function.diskfreespace.php                         24-Apr-2024 08:00                1791
function.dl.php                                    24-Apr-2024 08:00                9824
function.dngettext.php                             24-Apr-2024 08:00                3949
function.dns-check-record.php                      24-Apr-2024 08:00                1763
function.dns-get-mx.php                            24-Apr-2024 08:00                1733
function.dns-get-record.php                        24-Apr-2024 08:00               23446
function.dom-import-simplexml.php                  24-Apr-2024 08:00                7024
function.doubleval.php                             24-Apr-2024 08:00                1716
function.each.php                                  24-Apr-2024 08:00               11392
function.easter-date.php                           24-Apr-2024 08:00               14002
function.easter-days.php                           24-Apr-2024 08:00                7165
function.echo.php                                  24-Apr-2024 08:00               17141
function.eio-busy.php                              24-Apr-2024 08:00                4920
function.eio-cancel.php                            24-Apr-2024 08:00                7482
function.eio-chmod.php                             24-Apr-2024 08:00                6146
function.eio-chown.php                             24-Apr-2024 08:00                6348
function.eio-close.php                             24-Apr-2024 08:00                5578
function.eio-custom.php                            24-Apr-2024 08:00               10237
function.eio-dup2.php                              24-Apr-2024 08:00                5632
function.eio-event-loop.php                        24-Apr-2024 08:00                5769
function.eio-fallocate.php                         24-Apr-2024 08:00                7487
function.eio-fchmod.php                            24-Apr-2024 08:00                6105
function.eio-fchown.php                            24-Apr-2024 08:00                6407
function.eio-fdatasync.php                         24-Apr-2024 08:00                5496
function.eio-fstat.php                             24-Apr-2024 08:00               11474
function.eio-fstatvfs.php                          24-Apr-2024 08:00                5620
function.eio-fsync.php                             24-Apr-2024 08:00                5594
function.eio-ftruncate.php                         24-Apr-2024 08:00                6123
function.eio-futime.php                            24-Apr-2024 08:00                6429
function.eio-get-event-stream.php                  24-Apr-2024 08:00                8056
function.eio-get-last-error.php                    24-Apr-2024 08:00                3136
function.eio-grp-add.php                           24-Apr-2024 08:00               11445
function.eio-grp-cancel.php                        24-Apr-2024 08:00                3134
function.eio-grp-limit.php                         24-Apr-2024 08:00                3048
function.eio-grp.php                               24-Apr-2024 08:00               11670
function.eio-init.php                              24-Apr-2024 08:00                2594
function.eio-link.php                              24-Apr-2024 08:00               12494
function.eio-lstat.php                             24-Apr-2024 08:00                9867
function.eio-mkdir.php                             24-Apr-2024 08:00                9160
function.eio-mknod.php                             24-Apr-2024 08:00               11445
function.eio-nop.php                               24-Apr-2024 08:00                5251
function.eio-npending.php                          24-Apr-2024 08:00                3009
function.eio-nready.php                            24-Apr-2024 08:00                2757
function.eio-nreqs.php                             24-Apr-2024 08:00                5539
function.eio-nthreads.php                          24-Apr-2024 08:00                3431
function.eio-open.php                              24-Apr-2024 08:00               11450
function.eio-poll.php                              24-Apr-2024 08:00                5667
function.eio-read.php                              24-Apr-2024 08:00               12464
function.eio-readahead.php                         24-Apr-2024 08:00                6165
function.eio-readdir.php                           24-Apr-2024 08:00               18188
function.eio-readlink.php                          24-Apr-2024 08:00               12171
function.eio-realpath.php                          24-Apr-2024 08:00                5352
function.eio-rename.php                            24-Apr-2024 08:00                9249
function.eio-rmdir.php                             24-Apr-2024 08:00                8191
function.eio-seek.php                              24-Apr-2024 08:00                6975
function.eio-sendfile.php                          24-Apr-2024 08:00                6490
function.eio-set-max-idle.php                      24-Apr-2024 08:00                3137
function.eio-set-max-parallel.php                  24-Apr-2024 08:00                3186
function.eio-set-max-poll-reqs.php                 24-Apr-2024 08:00                2508
function.eio-set-max-poll-time.php                 24-Apr-2024 08:00                2578
function.eio-set-min-parallel.php                  24-Apr-2024 08:00                3177
function.eio-stat.php                              24-Apr-2024 08:00                9844
function.eio-statvfs.php                           24-Apr-2024 08:00                8323
function.eio-symlink.php                           24-Apr-2024 08:00               10805
function.eio-sync-file-range.php                   24-Apr-2024 08:00                7270
function.eio-sync.php                              24-Apr-2024 08:00                2891
function.eio-syncfs.php                            24-Apr-2024 08:00                5179
function.eio-truncate.php                          24-Apr-2024 08:00                6100
function.eio-unlink.php                            24-Apr-2024 08:00                5285
function.eio-utime.php                             24-Apr-2024 08:00                6138
function.eio-write.php                             24-Apr-2024 08:00                6856
function.empty.php                                 24-Apr-2024 08:00                9289
function.enchant-broker-describe.php               24-Apr-2024 08:00                6073
function.enchant-broker-dict-exists.php            24-Apr-2024 08:00                5747
function.enchant-broker-free-dict.php              24-Apr-2024 08:00                4801
function.enchant-broker-free.php                   24-Apr-2024 08:00                4353
function.enchant-broker-get-dict-path.php          24-Apr-2024 08:00                5318
function.enchant-broker-get-error.php              24-Apr-2024 08:00                3701
function.enchant-broker-init.php                   24-Apr-2024 08:00                3510
function.enchant-broker-list-dicts.php             24-Apr-2024 08:00                6947
function.enchant-broker-request-dict.php           24-Apr-2024 08:00                7058
function.enchant-broker-request-pwl-dict.php       24-Apr-2024 08:00                5381
function.enchant-broker-set-dict-path.php          24-Apr-2024 08:00                5599
function.enchant-broker-set-ordering.php           24-Apr-2024 08:00                4818
function.enchant-dict-add-to-personal.php          24-Apr-2024 08:00                2201
function.enchant-dict-add-to-session.php           24-Apr-2024 08:00                4457
function.enchant-dict-add.php                      24-Apr-2024 08:00                6389
function.enchant-dict-check.php                    24-Apr-2024 08:00                4282
function.enchant-dict-describe.php                 24-Apr-2024 08:00                6546
function.enchant-dict-get-error.php                24-Apr-2024 08:00                3904
function.enchant-dict-is-added.php                 24-Apr-2024 08:00                4509
function.enchant-dict-is-in-session.php            24-Apr-2024 08:00                2187
function.enchant-dict-quick-check.php              24-Apr-2024 08:00                8319
function.enchant-dict-store-replacement.php        24-Apr-2024 08:00                4729
function.enchant-dict-suggest.php                  24-Apr-2024 08:00                7469
function.end.php                                   24-Apr-2024 08:00                6665
function.enum-exists.php                           24-Apr-2024 08:00                5360
function.error-clear-last.php                      24-Apr-2024 08:00                4628
function.error-get-last.php                        24-Apr-2024 08:00                4864
function.error-log.php                             24-Apr-2024 08:00               10714
function.error-reporting.php                       24-Apr-2024 08:00                9097
function.escapeshellarg.php                        24-Apr-2024 08:00                5289
function.escapeshellcmd.php                        24-Apr-2024 08:00                7532
function.eval.php                                  24-Apr-2024 08:00                9061
function.exec.php                                  24-Apr-2024 08:00               10666
function.exif-imagetype.php                        24-Apr-2024 08:00                9977
function.exif-read-data.php                        24-Apr-2024 08:00               22197
function.exif-tagname.php                          24-Apr-2024 08:00                4747
function.exif-thumbnail.php                        24-Apr-2024 08:00                8915
function.exit.php                                  24-Apr-2024 08:00                9172
function.exp.php                                   24-Apr-2024 08:00                4318
function.expect-expectl.php                        24-Apr-2024 08:00               11087
function.expect-popen.php                          24-Apr-2024 08:00                4632
function.explode.php                               24-Apr-2024 08:00               15414
function.expm1.php                                 24-Apr-2024 08:00                3485
function.extension-loaded.php                      24-Apr-2024 08:00                5577
function.extract.php                               24-Apr-2024 08:00               14132
function.ezmlm-hash.php                            24-Apr-2024 08:00                4510
function.fann-cascadetrain-on-data.php             24-Apr-2024 08:00                6797
function.fann-cascadetrain-on-file.php             24-Apr-2024 08:00                5678
function.fann-clear-scaling-params.php             24-Apr-2024 08:00                2813
function.fann-copy.php                             24-Apr-2024 08:00                3331
function.fann-create-from-file.php                 24-Apr-2024 08:00                3346
function.fann-create-shortcut-array.php            24-Apr-2024 08:00                4173
function.fann-create-shortcut.php                  24-Apr-2024 08:00                5193
function.fann-create-sparse-array.php              24-Apr-2024 08:00                4812
function.fann-create-sparse.php                    24-Apr-2024 08:00                5570
function.fann-create-standard-array.php            24-Apr-2024 08:00                4486
function.fann-create-standard.php                  24-Apr-2024 08:00                5261
function.fann-create-train-from-callback.php       24-Apr-2024 08:00                9125
function.fann-create-train.php                     24-Apr-2024 08:00                4652
function.fann-descale-input.php                    24-Apr-2024 08:00                3869
function.fann-descale-output.php                   24-Apr-2024 08:00                3885
function.fann-descale-train.php                    24-Apr-2024 08:00                3898
function.fann-destroy-train.php                    24-Apr-2024 08:00                2766
function.fann-destroy.php                          24-Apr-2024 08:00                2800
function.fann-duplicate-train-data.php             24-Apr-2024 08:00                3009
function.fann-get-activation-function.php          24-Apr-2024 08:00                5339
function.fann-get-activation-steepness.php         24-Apr-2024 08:00                5752
function.fann-get-bias-array.php                   24-Apr-2024 08:00                2683
function.fann-get-bit-fail-limit.php               24-Apr-2024 08:00                3899
function.fann-get-bit-fail.php                     24-Apr-2024 08:00                4987
function.fann-get-cascade-activation-functions-..> 24-Apr-2024 08:00                3936
function.fann-get-cascade-activation-functions.php 24-Apr-2024 08:00                4752
function.fann-get-cascade-activation-steepnesse..> 24-Apr-2024 08:00                3992
function.fann-get-cascade-activation-steepnesse..> 24-Apr-2024 08:00                4143
function.fann-get-cascade-candidate-change-frac..> 24-Apr-2024 08:00                5249
function.fann-get-cascade-candidate-limit.php      24-Apr-2024 08:00                3639
function.fann-get-cascade-candidate-stagnation-..> 24-Apr-2024 08:00                4375
function.fann-get-cascade-max-cand-epochs.php      24-Apr-2024 08:00                3521
function.fann-get-cascade-max-out-epochs.php       24-Apr-2024 08:00                3442
function.fann-get-cascade-min-cand-epochs.php      24-Apr-2024 08:00                3826
function.fann-get-cascade-min-out-epochs.php       24-Apr-2024 08:00                3783
function.fann-get-cascade-num-candidate-groups.php 24-Apr-2024 08:00                3919
function.fann-get-cascade-num-candidates.php       24-Apr-2024 08:00                6053
function.fann-get-cascade-output-change-fractio..> 24-Apr-2024 08:00                5177
function.fann-get-cascade-output-stagnation-epo..> 24-Apr-2024 08:00                4318
function.fann-get-cascade-weight-multiplier.php    24-Apr-2024 08:00                3597
function.fann-get-connection-array.php             24-Apr-2024 08:00                2710
function.fann-get-connection-rate.php              24-Apr-2024 08:00                2833
function.fann-get-errno.php                        24-Apr-2024 08:00                3307
function.fann-get-errstr.php                       24-Apr-2024 08:00                3312
function.fann-get-layer-array.php                  24-Apr-2024 08:00                2784
function.fann-get-learning-momentum.php            24-Apr-2024 08:00                3982
function.fann-get-learning-rate.php                24-Apr-2024 08:00                3916
function.fann-get-mse.php                          24-Apr-2024 08:00                3302
function.fann-get-network-type.php                 24-Apr-2024 08:00                2803
function.fann-get-num-input.php                    24-Apr-2024 08:00                2690
function.fann-get-num-layers.php                   24-Apr-2024 08:00                2745
function.fann-get-num-output.php                   24-Apr-2024 08:00                2709
function.fann-get-quickprop-decay.php              24-Apr-2024 08:00                3454
function.fann-get-quickprop-mu.php                 24-Apr-2024 08:00                3347
function.fann-get-rprop-decrease-factor.php        24-Apr-2024 08:00                3408
function.fann-get-rprop-delta-max.php              24-Apr-2024 08:00                3470
function.fann-get-rprop-delta-min.php              24-Apr-2024 08:00                3281
function.fann-get-rprop-delta-zero.php             24-Apr-2024 08:00                3654
function.fann-get-rprop-increase-factor.php        24-Apr-2024 08:00                3433
function.fann-get-sarprop-step-error-shift.php     24-Apr-2024 08:00                3743
function.fann-get-sarprop-step-error-threshold-..> 24-Apr-2024 08:00                3895
function.fann-get-sarprop-temperature.php          24-Apr-2024 08:00                3657
function.fann-get-sarprop-weight-decay-shift.php   24-Apr-2024 08:00                3724
function.fann-get-total-connections.php            24-Apr-2024 08:00                2882
function.fann-get-total-neurons.php                24-Apr-2024 08:00                2929
function.fann-get-train-error-function.php         24-Apr-2024 08:00                3686
function.fann-get-train-stop-function.php          24-Apr-2024 08:00                3672
function.fann-get-training-algorithm.php           24-Apr-2024 08:00                3906
function.fann-init-weights.php                     24-Apr-2024 08:00                4549
function.fann-length-train-data.php                24-Apr-2024 08:00                3005
function.fann-merge-train-data.php                 24-Apr-2024 08:00                3378
function.fann-num-input-train-data.php             24-Apr-2024 08:00                3638
function.fann-num-output-train-data.php            24-Apr-2024 08:00                3636
function.fann-print-error.php                      24-Apr-2024 08:00                3058
function.fann-randomize-weights.php                24-Apr-2024 08:00                4059
function.fann-read-train-from-file.php             24-Apr-2024 08:00                5057
function.fann-reset-errno.php                      24-Apr-2024 08:00                3234
function.fann-reset-errstr.php                     24-Apr-2024 08:00                3215
function.fann-reset-mse.php                        24-Apr-2024 08:00                3546
function.fann-run.php                              24-Apr-2024 08:00                2999
function.fann-save-train.php                       24-Apr-2024 08:00                3609
function.fann-save.php                             24-Apr-2024 08:00                4422
function.fann-scale-input-train-data.php           24-Apr-2024 08:00                4236
function.fann-scale-input.php                      24-Apr-2024 08:00                3883
function.fann-scale-output-train-data.php          24-Apr-2024 08:00                4264
function.fann-scale-output.php                     24-Apr-2024 08:00                3887
function.fann-scale-train-data.php                 24-Apr-2024 08:00                4234
function.fann-scale-train.php                      24-Apr-2024 08:00                3916
function.fann-set-activation-function-hidden.php   24-Apr-2024 08:00                4578
function.fann-set-activation-function-layer.php    24-Apr-2024 08:00                5092
function.fann-set-activation-function-output.php   24-Apr-2024 08:00                4594
function.fann-set-activation-function.php          24-Apr-2024 08:00                6569
function.fann-set-activation-steepness-hidden.php  24-Apr-2024 08:00                4864
function.fann-set-activation-steepness-layer.php   24-Apr-2024 08:00                5329
function.fann-set-activation-steepness-output.php  24-Apr-2024 08:00                4845
function.fann-set-activation-steepness.php         24-Apr-2024 08:00                6225
function.fann-set-bit-fail-limit.php               24-Apr-2024 08:00                3567
function.fann-set-callback.php                     24-Apr-2024 08:00                5740
function.fann-set-cascade-activation-functions.php 24-Apr-2024 08:00                4223
function.fann-set-cascade-activation-steepnesse..> 24-Apr-2024 08:00                4436
function.fann-set-cascade-candidate-change-frac..> 24-Apr-2024 08:00                3918
function.fann-set-cascade-candidate-limit.php      24-Apr-2024 08:00                3725
function.fann-set-cascade-candidate-stagnation-..> 24-Apr-2024 08:00                3980
function.fann-set-cascade-max-cand-epochs.php      24-Apr-2024 08:00                3726
function.fann-set-cascade-max-out-epochs.php       24-Apr-2024 08:00                3677
function.fann-set-cascade-min-cand-epochs.php      24-Apr-2024 08:00                4036
function.fann-set-cascade-min-out-epochs.php       24-Apr-2024 08:00                4018
function.fann-set-cascade-num-candidate-groups.php 24-Apr-2024 08:00                3811
function.fann-set-cascade-output-change-fractio..> 24-Apr-2024 08:00                3875
function.fann-set-cascade-output-stagnation-epo..> 24-Apr-2024 08:00                3941
function.fann-set-cascade-weight-multiplier.php    24-Apr-2024 08:00                3710
function.fann-set-error-log.php                    24-Apr-2024 08:00                3083
function.fann-set-input-scaling-params.php         24-Apr-2024 08:00                4676
function.fann-set-learning-momentum.php            24-Apr-2024 08:00                3951
function.fann-set-learning-rate.php                24-Apr-2024 08:00                3877
function.fann-set-output-scaling-params.php        24-Apr-2024 08:00                4696
function.fann-set-quickprop-decay.php              24-Apr-2024 08:00                3638
function.fann-set-quickprop-mu.php                 24-Apr-2024 08:00                3493
function.fann-set-rprop-decrease-factor.php        24-Apr-2024 08:00                3695
function.fann-set-rprop-delta-max.php              24-Apr-2024 08:00                3807
function.fann-set-rprop-delta-min.php              24-Apr-2024 08:00                3613
function.fann-set-rprop-delta-zero.php             24-Apr-2024 08:00                3995
function.fann-set-rprop-increase-factor.php        24-Apr-2024 08:00                3721
function.fann-set-sarprop-step-error-shift.php     24-Apr-2024 08:00                4086
function.fann-set-sarprop-step-error-threshold-..> 24-Apr-2024 08:00                4280
function.fann-set-sarprop-temperature.php          24-Apr-2024 08:00                3997
function.fann-set-sarprop-weight-decay-shift.php   24-Apr-2024 08:00                4080
function.fann-set-scaling-params.php               24-Apr-2024 08:00                5713
function.fann-set-train-error-function.php         24-Apr-2024 08:00                3907
function.fann-set-train-stop-function.php          24-Apr-2024 08:00                3895
function.fann-set-training-algorithm.php           24-Apr-2024 08:00                3843
function.fann-set-weight-array.php                 24-Apr-2024 08:00                3355
function.fann-set-weight.php                       24-Apr-2024 08:00                3803
function.fann-shuffle-train-data.php               24-Apr-2024 08:00                2966
function.fann-subset-train-data.php                24-Apr-2024 08:00                4372
function.fann-test-data.php                        24-Apr-2024 08:00                4307
function.fann-test.php                             24-Apr-2024 08:00                4600
function.fann-train-epoch.php                      24-Apr-2024 08:00                4681
function.fann-train-on-data.php                    24-Apr-2024 08:00                6623
function.fann-train-on-file.php                    24-Apr-2024 08:00                6551
function.fann-train.php                            24-Apr-2024 08:00                4678
function.fastcgi-finish-request.php                24-Apr-2024 08:00                2601
function.fbird-add-user.php                        24-Apr-2024 08:00                2338
function.fbird-affected-rows.php                   24-Apr-2024 08:00                2353
function.fbird-backup.php                          24-Apr-2024 08:00                1784
function.fbird-blob-add.php                        24-Apr-2024 08:00                2666
function.fbird-blob-cancel.php                     24-Apr-2024 08:00                3693
function.fbird-blob-close.php                      24-Apr-2024 08:00                2697
function.fbird-blob-create.php                     24-Apr-2024 08:00                2697
function.fbird-blob-echo.php                       24-Apr-2024 08:00                2500
function.fbird-blob-get.php                        24-Apr-2024 08:00                2493
function.fbird-blob-import.php                     24-Apr-2024 08:00                2693
function.fbird-blob-info.php                       24-Apr-2024 08:00                1816
function.fbird-blob-open.php                       24-Apr-2024 08:00                2490
function.fbird-close.php                           24-Apr-2024 08:00                2276
function.fbird-commit-ret.php                      24-Apr-2024 08:00                1809
function.fbird-commit.php                          24-Apr-2024 08:00                1777
function.fbird-connect.php                         24-Apr-2024 08:00                2282
function.fbird-db-info.php                         24-Apr-2024 08:00                1790
function.fbird-delete-user.php                     24-Apr-2024 08:00                2350
function.fbird-drop-db.php                         24-Apr-2024 08:00                2298
function.fbird-errcode.php                         24-Apr-2024 08:00                2121
function.fbird-errmsg.php                          24-Apr-2024 08:00                2114
function.fbird-execute.php                         24-Apr-2024 08:00                2126
function.fbird-fetch-assoc.php                     24-Apr-2024 08:00                2366
function.fbird-fetch-object.php                    24-Apr-2024 08:00                2377
function.fbird-fetch-row.php                       24-Apr-2024 08:00                2354
function.fbird-field-info.php                      24-Apr-2024 08:00                2196
function.fbird-free-event-handler.php              24-Apr-2024 08:00                2300
function.fbird-free-query.php                      24-Apr-2024 08:00                1845
function.fbird-free-result.php                     24-Apr-2024 08:00                1830
function.fbird-gen-id.php                          24-Apr-2024 08:00                1787
function.fbird-maintain-db.php                     24-Apr-2024 08:00                1832
function.fbird-modify-user.php                     24-Apr-2024 08:00                2366
function.fbird-name-result.php                     24-Apr-2024 08:00                2349
function.fbird-num-fields.php                      24-Apr-2024 08:00                2185
function.fbird-num-params.php                      24-Apr-2024 08:00                2344
function.fbird-param-info.php                      24-Apr-2024 08:00                2349
function.fbird-pconnect.php                        24-Apr-2024 08:00                2299
function.fbird-prepare.php                         24-Apr-2024 08:00                1780
function.fbird-query.php                           24-Apr-2024 08:00                2615
function.fbird-restore.php                         24-Apr-2024 08:00                1787
function.fbird-rollback-ret.php                    24-Apr-2024 08:00                1839
function.fbird-rollback.php                        24-Apr-2024 08:00                1811
function.fbird-server-info.php                     24-Apr-2024 08:00                1842
function.fbird-service-attach.php                  24-Apr-2024 08:00                1881
function.fbird-service-detach.php                  24-Apr-2024 08:00                1893
function.fbird-set-event-handler.php               24-Apr-2024 08:00                2459
function.fbird-trans.php                           24-Apr-2024 08:00                1786
function.fbird-wait-event.php                      24-Apr-2024 08:00                2384
function.fclose.php                                24-Apr-2024 08:00                4380
function.fdatasync.php                             24-Apr-2024 08:00                5966
function.fdf-add-doc-javascript.php                24-Apr-2024 08:00                5534
function.fdf-add-template.php                      24-Apr-2024 08:00                2923
function.fdf-close.php                             24-Apr-2024 08:00                3089
function.fdf-create.php                            24-Apr-2024 08:00                5591
function.fdf-enum-values.php                       24-Apr-2024 08:00                2496
function.fdf-errno.php                             24-Apr-2024 08:00                2769
function.fdf-error.php                             24-Apr-2024 08:00                3215
function.fdf-get-ap.php                            24-Apr-2024 08:00                4423
function.fdf-get-attachment.php                    24-Apr-2024 08:00                6097
function.fdf-get-encoding.php                      24-Apr-2024 08:00                3397
function.fdf-get-file.php                          24-Apr-2024 08:00                3217
function.fdf-get-flags.php                         24-Apr-2024 08:00                2416
function.fdf-get-opt.php                           24-Apr-2024 08:00                2455
function.fdf-get-status.php                        24-Apr-2024 08:00                3236
function.fdf-get-value.php                         24-Apr-2024 08:00                4533
function.fdf-get-version.php                       24-Apr-2024 08:00                3596
function.fdf-header.php                            24-Apr-2024 08:00                2339
function.fdf-next-field-name.php                   24-Apr-2024 08:00                5390
function.fdf-open-string.php                       24-Apr-2024 08:00                4846
function.fdf-open.php                              24-Apr-2024 08:00                5857
function.fdf-remove-item.php                       24-Apr-2024 08:00                2429
function.fdf-save-string.php                       24-Apr-2024 08:00                5618
function.fdf-save.php                              24-Apr-2024 08:00                4091
function.fdf-set-ap.php                            24-Apr-2024 08:00                4650
function.fdf-set-encoding.php                      24-Apr-2024 08:00                3778
function.fdf-set-file.php                          24-Apr-2024 08:00                6710
function.fdf-set-flags.php                         24-Apr-2024 08:00                4397
function.fdf-set-javascript-action.php             24-Apr-2024 08:00                4594
function.fdf-set-on-import-javascript.php          24-Apr-2024 08:00                3202
function.fdf-set-opt.php                           24-Apr-2024 08:00                4680
function.fdf-set-status.php                        24-Apr-2024 08:00                3810
function.fdf-set-submit-form-action.php            24-Apr-2024 08:00                4893
function.fdf-set-target-frame.php                  24-Apr-2024 08:00                3810
function.fdf-set-value.php                         24-Apr-2024 08:00                5247
function.fdf-set-version.php                       24-Apr-2024 08:00                4034
function.fdiv.php                                  24-Apr-2024 08:00                6371
function.feof.php                                  24-Apr-2024 08:00                7599
function.fflush.php                                24-Apr-2024 08:00                5572
function.fgetc.php                                 24-Apr-2024 08:00                6384
function.fgetcsv.php                               24-Apr-2024 08:00               12660
function.fgets.php                                 24-Apr-2024 08:00                8273
function.fgetss.php                                24-Apr-2024 08:00                9258
function.file-exists.php                           24-Apr-2024 08:00                6992
function.file-get-contents.php                     24-Apr-2024 08:00               18246
function.file-put-contents.php                     24-Apr-2024 08:00               13085
function.file.php                                  24-Apr-2024 08:00               11878
function.fileatime.php                             24-Apr-2024 08:00                6692
function.filectime.php                             24-Apr-2024 08:00                6773
function.filegroup.php                             24-Apr-2024 08:00                5660
function.fileinode.php                             24-Apr-2024 08:00                5227
function.filemtime.php                             24-Apr-2024 08:00                6532
function.fileowner.php                             24-Apr-2024 08:00                5498
function.fileperms.php                             24-Apr-2024 08:00               16152
function.filesize.php                              24-Apr-2024 08:00                5704
function.filetype.php                              24-Apr-2024 08:00                6614
function.filter-has-var.php                        24-Apr-2024 08:00                3415
function.filter-id.php                             24-Apr-2024 08:00                2988
function.filter-input-array.php                    24-Apr-2024 08:00               13216
function.filter-input.php                          24-Apr-2024 08:00                8531
function.filter-list.php                           24-Apr-2024 08:00                3682
function.filter-var-array.php                      24-Apr-2024 08:00               12101
function.filter-var.php                            24-Apr-2024 08:00               14270
function.finfo-buffer.php                          24-Apr-2024 08:00                8479
function.finfo-close.php                           24-Apr-2024 08:00                3556
function.finfo-file.php                            24-Apr-2024 08:00                9063
function.finfo-open.php                            24-Apr-2024 08:00               10072
function.finfo-set-flags.php                       24-Apr-2024 08:00                4747
function.floatval.php                              24-Apr-2024 08:00                6668
function.flock.php                                 24-Apr-2024 08:00               12816
function.floor.php                                 24-Apr-2024 08:00                4950
function.flush.php                                 24-Apr-2024 08:00                4570
function.fmod.php                                  24-Apr-2024 08:00                5021
function.fnmatch.php                               24-Apr-2024 08:00               11017
function.fopen.php                                 24-Apr-2024 08:00               22750
function.forward-static-call-array.php             24-Apr-2024 08:00                9532
function.forward-static-call.php                   24-Apr-2024 08:00                8797
function.fpassthru.php                             24-Apr-2024 08:00                7155
function.fpm-get-status.php                        24-Apr-2024 08:00                2791
function.fprintf.php                               24-Apr-2024 08:00               22697
function.fputcsv.php                               24-Apr-2024 08:00               10321
function.fputs.php                                 24-Apr-2024 08:00                1679
function.fread.php                                 24-Apr-2024 08:00               14462
function.frenchtojd.php                            24-Apr-2024 08:00                4073
function.fscanf.php                                24-Apr-2024 08:00                9292
function.fseek.php                                 24-Apr-2024 08:00                7851
function.fsockopen.php                             24-Apr-2024 08:00               16820
function.fstat.php                                 24-Apr-2024 08:00                6063
function.fsync.php                                 24-Apr-2024 08:00                5728
function.ftell.php                                 24-Apr-2024 08:00                6053
function.ftok.php                                  24-Apr-2024 08:00                3661
function.ftp-alloc.php                             24-Apr-2024 08:00                8428
function.ftp-append.php                            24-Apr-2024 08:00                4585
function.ftp-cdup.php                              24-Apr-2024 08:00                6598
function.ftp-chdir.php                             24-Apr-2024 08:00                7456
function.ftp-chmod.php                             24-Apr-2024 08:00                7067
function.ftp-close.php                             24-Apr-2024 08:00                6040
function.ftp-connect.php                           24-Apr-2024 08:00                6565
function.ftp-delete.php                            24-Apr-2024 08:00                6249
function.ftp-exec.php                              24-Apr-2024 08:00                6755
function.ftp-fget.php                              24-Apr-2024 08:00               10021
function.ftp-fput.php                              24-Apr-2024 08:00                9433
function.ftp-get-option.php                        24-Apr-2024 08:00                6181
function.ftp-get.php                               24-Apr-2024 08:00                9325
function.ftp-login.php                             24-Apr-2024 08:00                6752
function.ftp-mdtm.php                              24-Apr-2024 08:00                7028
function.ftp-mkdir.php                             24-Apr-2024 08:00                6954
function.ftp-mlsd.php                              24-Apr-2024 08:00                9149
function.ftp-nb-continue.php                       24-Apr-2024 08:00                5539
function.ftp-nb-fget.php                           24-Apr-2024 08:00               10525
function.ftp-nb-fput.php                           24-Apr-2024 08:00               10311
function.ftp-nb-get.php                            24-Apr-2024 08:00               14221
function.ftp-nb-put.php                            24-Apr-2024 08:00               11617
function.ftp-nlist.php                             24-Apr-2024 08:00                6851
function.ftp-pasv.php                              24-Apr-2024 08:00                7263
function.ftp-put.php                               24-Apr-2024 08:00                9041
function.ftp-pwd.php                               24-Apr-2024 08:00                6031
function.ftp-quit.php                              24-Apr-2024 08:00                1687
function.ftp-raw.php                               24-Apr-2024 08:00                5624
function.ftp-rawlist.php                           24-Apr-2024 08:00                8199
function.ftp-rename.php                            24-Apr-2024 08:00                7204
function.ftp-rmdir.php                             24-Apr-2024 08:00                6542
function.ftp-set-option.php                        24-Apr-2024 08:00                7366
function.ftp-site.php                              24-Apr-2024 08:00                6696
function.ftp-size.php                              24-Apr-2024 08:00                6765
function.ftp-ssl-connect.php                       24-Apr-2024 08:00                8890
function.ftp-systype.php                           24-Apr-2024 08:00                5574
function.ftruncate.php                             24-Apr-2024 08:00                6473
function.func-get-arg.php                          24-Apr-2024 08:00               11125
function.func-get-args.php                         24-Apr-2024 08:00               11763
function.func-num-args.php                         24-Apr-2024 08:00                5913
function.function-exists.php                       24-Apr-2024 08:00                6018
function.fwrite.php                                24-Apr-2024 08:00               14481
function.gc-collect-cycles.php                     24-Apr-2024 08:00                2548
function.gc-disable.php                            24-Apr-2024 08:00                2578
function.gc-enable.php                             24-Apr-2024 08:00                2551
function.gc-enabled.php                            24-Apr-2024 08:00                3406
function.gc-mem-caches.php                         24-Apr-2024 08:00                2488
function.gc-status.php                             24-Apr-2024 08:00                8723
function.gd-info.php                               24-Apr-2024 08:00                9040
function.geoip-asnum-by-name.php                   24-Apr-2024 08:00                4246
function.geoip-continent-code-by-name.php          24-Apr-2024 08:00                5752
function.geoip-country-code-by-name.php            24-Apr-2024 08:00                5473
function.geoip-country-code3-by-name.php           24-Apr-2024 08:00                5038
function.geoip-country-name-by-name.php            24-Apr-2024 08:00                5002
function.geoip-database-info.php                   24-Apr-2024 08:00                4329
function.geoip-db-avail.php                        24-Apr-2024 08:00                4545
function.geoip-db-filename.php                     24-Apr-2024 08:00                4205
function.geoip-db-get-all-info.php                 24-Apr-2024 08:00                6772
function.geoip-domain-by-name.php                  24-Apr-2024 08:00                4480
function.geoip-id-by-name.php                      24-Apr-2024 08:00                5552
function.geoip-isp-by-name.php                     24-Apr-2024 08:00                4484
function.geoip-netspeedcell-by-name.php            24-Apr-2024 08:00                5222
function.geoip-org-by-name.php                     24-Apr-2024 08:00                4503
function.geoip-record-by-name.php                  24-Apr-2024 08:00                7822
function.geoip-region-by-name.php                  24-Apr-2024 08:00                5164
function.geoip-region-name-by-code.php             24-Apr-2024 08:00                7210
function.geoip-setup-custom-directory.php          24-Apr-2024 08:00                4243
function.geoip-time-zone-by-country-and-region.php 24-Apr-2024 08:00                7420
function.get-browser.php                           24-Apr-2024 08:00                8667
function.get-called-class.php                      24-Apr-2024 08:00                6147
function.get-cfg-var.php                           24-Apr-2024 08:00                3887
function.get-class-methods.php                     24-Apr-2024 08:00                6846
function.get-class-vars.php                        24-Apr-2024 08:00                9683
function.get-class.php                             24-Apr-2024 08:00               12650
function.get-current-user.php                      24-Apr-2024 08:00                4278
function.get-debug-type.php                        24-Apr-2024 08:00                9536
function.get-declared-classes.php                  24-Apr-2024 08:00                5273
function.get-declared-interfaces.php               24-Apr-2024 08:00                4290
function.get-declared-traits.php                   24-Apr-2024 08:00                2840
function.get-defined-constants.php                 24-Apr-2024 08:00                7530
function.get-defined-functions.php                 24-Apr-2024 08:00                7096
function.get-defined-vars.php                      24-Apr-2024 08:00                6166
function.get-extension-funcs.php                   24-Apr-2024 08:00                5604
function.get-headers.php                           24-Apr-2024 08:00                9248
function.get-html-translation-table.php            24-Apr-2024 08:00               13846
function.get-include-path.php                      24-Apr-2024 08:00                4415
function.get-included-files.php                    24-Apr-2024 08:00                5955
function.get-loaded-extensions.php                 24-Apr-2024 08:00                5573
function.get-magic-quotes-gpc.php                  24-Apr-2024 08:00                4162
function.get-magic-quotes-runtime.php              24-Apr-2024 08:00                3695
function.get-mangled-object-vars.php               24-Apr-2024 08:00                8207
function.get-meta-tags.php                         24-Apr-2024 08:00                7860
function.get-object-vars.php                       24-Apr-2024 08:00                6104
function.get-parent-class.php                      24-Apr-2024 08:00                7680
function.get-required-files.php                    24-Apr-2024 08:00                1853
function.get-resource-id.php                       24-Apr-2024 08:00                4870
function.get-resource-type.php                     24-Apr-2024 08:00                5362
function.get-resources.php                         24-Apr-2024 08:00                7932
function.getallheaders.php                         24-Apr-2024 08:00                4679
function.getcwd.php                                24-Apr-2024 08:00                5358
function.getdate.php                               24-Apr-2024 08:00                9617
function.getenv.php                                24-Apr-2024 08:00                8749
function.gethostbyaddr.php                         24-Apr-2024 08:00                4404
function.gethostbyname.php                         24-Apr-2024 08:00                4537
function.gethostbynamel.php                        24-Apr-2024 08:00                5112
function.gethostname.php                           24-Apr-2024 08:00                3986
function.getimagesize.php                          24-Apr-2024 08:00               16883
function.getimagesizefromstring.php                24-Apr-2024 08:00                5644
function.getlastmod.php                            24-Apr-2024 08:00                5141
function.getmxrr.php                               24-Apr-2024 08:00                6010
function.getmygid.php                              24-Apr-2024 08:00                3389
function.getmyinode.php                            24-Apr-2024 08:00                3400
function.getmypid.php                              24-Apr-2024 08:00                3723
function.getmyuid.php                              24-Apr-2024 08:00                3363
function.getopt.php                                24-Apr-2024 08:00               15204
function.getprotobyname.php                        24-Apr-2024 08:00                4691
function.getprotobynumber.php                      24-Apr-2024 08:00                3329
function.getrandmax.php                            24-Apr-2024 08:00                3005
function.getrusage.php                             24-Apr-2024 08:00               11185
function.getservbyname.php                         24-Apr-2024 08:00                6477
function.getservbyport.php                         24-Apr-2024 08:00                3839
function.gettext.php                               24-Apr-2024 08:00                5840
function.gettimeofday.php                          24-Apr-2024 08:00                4912
function.gettype.php                               24-Apr-2024 08:00                8914
function.glob.php                                  24-Apr-2024 08:00               10608
function.gmdate.php                                24-Apr-2024 08:00                7672
function.gmmktime.php                              24-Apr-2024 08:00               11340
function.gmp-abs.php                               24-Apr-2024 08:00                4568
function.gmp-add.php                               24-Apr-2024 08:00                4982
function.gmp-and.php                               24-Apr-2024 08:00                5433
function.gmp-binomial.php                          24-Apr-2024 08:00                4134
function.gmp-clrbit.php                            24-Apr-2024 08:00                5490
function.gmp-cmp.php                               24-Apr-2024 08:00                5845
function.gmp-com.php                               24-Apr-2024 08:00                4061
function.gmp-div-q.php                             24-Apr-2024 08:00               10412
function.gmp-div-qr.php                            24-Apr-2024 08:00                6977
function.gmp-div-r.php                             24-Apr-2024 08:00                6363
function.gmp-div.php                               24-Apr-2024 08:00                1706
function.gmp-divexact.php                          24-Apr-2024 08:00                6072
function.gmp-export.php                            24-Apr-2024 08:00                5704
function.gmp-fact.php                              24-Apr-2024 08:00                4930
function.gmp-gcd.php                               24-Apr-2024 08:00                5361
function.gmp-gcdext.php                            24-Apr-2024 08:00                9539
function.gmp-hamdist.php                           24-Apr-2024 08:00                6712
function.gmp-import.php                            24-Apr-2024 08:00                6023
function.gmp-init.php                              24-Apr-2024 08:00                5648
function.gmp-intval.php                            24-Apr-2024 08:00                5424
function.gmp-invert.php                            24-Apr-2024 08:00                5567
function.gmp-jacobi.php                            24-Apr-2024 08:00                5872
function.gmp-kronecker.php                         24-Apr-2024 08:00                4210
function.gmp-lcm.php                               24-Apr-2024 08:00                3978
function.gmp-legendre.php                          24-Apr-2024 08:00                5891
function.gmp-mod.php                               24-Apr-2024 08:00                5104
function.gmp-mul.php                               24-Apr-2024 08:00                5186
function.gmp-neg.php                               24-Apr-2024 08:00                4517
function.gmp-nextprime.php                         24-Apr-2024 08:00                5167
function.gmp-or.php                                24-Apr-2024 08:00                5645
function.gmp-perfect-power.php                     24-Apr-2024 08:00                3483
function.gmp-perfect-square.php                    24-Apr-2024 08:00                5720
function.gmp-popcount.php                          24-Apr-2024 08:00                5012
function.gmp-pow.php                               24-Apr-2024 08:00                5870
function.gmp-powm.php                              24-Apr-2024 08:00                6138
function.gmp-prob-prime.php                        24-Apr-2024 08:00                5984
function.gmp-random-bits.php                       24-Apr-2024 08:00                6057
function.gmp-random-range.php                      24-Apr-2024 08:00                7422
function.gmp-random-seed.php                       24-Apr-2024 08:00                7639
function.gmp-random.php                            24-Apr-2024 08:00                6486
function.gmp-root.php                              24-Apr-2024 08:00                3326
function.gmp-rootrem.php                           24-Apr-2024 08:00                3492
function.gmp-scan0.php                             24-Apr-2024 08:00                5677
function.gmp-scan1.php                             24-Apr-2024 08:00                5689
function.gmp-setbit.php                            24-Apr-2024 08:00               11604
function.gmp-sign.php                              24-Apr-2024 08:00                5166
function.gmp-sqrt.php                              24-Apr-2024 08:00                5089
function.gmp-sqrtrem.php                           24-Apr-2024 08:00                6469
function.gmp-strval.php                            24-Apr-2024 08:00                4855
function.gmp-sub.php                               24-Apr-2024 08:00                5258
function.gmp-testbit.php                           24-Apr-2024 08:00                6126
function.gmp-xor.php                               24-Apr-2024 08:00                5651
function.gmstrftime.php                            24-Apr-2024 08:00                8991
function.gnupg-adddecryptkey.php                   24-Apr-2024 08:00                5360
function.gnupg-addencryptkey.php                   24-Apr-2024 08:00                4906
function.gnupg-addsignkey.php                      24-Apr-2024 08:00                5379
function.gnupg-cleardecryptkeys.php                24-Apr-2024 08:00                4450
function.gnupg-clearencryptkeys.php                24-Apr-2024 08:00                4455
function.gnupg-clearsignkeys.php                   24-Apr-2024 08:00                4397
function.gnupg-decrypt.php                         24-Apr-2024 08:00                6130
function.gnupg-decryptverify.php                   24-Apr-2024 08:00                7282
function.gnupg-deletekey.php                       24-Apr-2024 08:00                5193
function.gnupg-encrypt.php                         24-Apr-2024 08:00                6033
function.gnupg-encryptsign.php                     24-Apr-2024 08:00                6933
function.gnupg-export.php                          24-Apr-2024 08:00                5231
function.gnupg-getengineinfo.php                   24-Apr-2024 08:00                5594
function.gnupg-geterror.php                        24-Apr-2024 08:00                4384
function.gnupg-geterrorinfo.php                    24-Apr-2024 08:00                5697
function.gnupg-getprotocol.php                     24-Apr-2024 08:00                4472
function.gnupg-gettrustlist.php                    24-Apr-2024 08:00                5294
function.gnupg-import.php                          24-Apr-2024 08:00                5491
function.gnupg-init.php                            24-Apr-2024 08:00                7288
function.gnupg-keyinfo.php                         24-Apr-2024 08:00                5418
function.gnupg-listsignatures.php                  24-Apr-2024 08:00                5518
function.gnupg-setarmor.php                        24-Apr-2024 08:00                5666
function.gnupg-seterrormode.php                    24-Apr-2024 08:00                5732
function.gnupg-setsignmode.php                     24-Apr-2024 08:00                5801
function.gnupg-sign.php                            24-Apr-2024 08:00                6275
function.gnupg-verify.php                          24-Apr-2024 08:00                8523
function.grapheme-extract.php                      24-Apr-2024 08:00                8964
function.grapheme-stripos.php                      24-Apr-2024 08:00                8249
function.grapheme-stristr.php                      24-Apr-2024 08:00                7870
function.grapheme-strlen.php                       24-Apr-2024 08:00                5568
function.grapheme-strpos.php                       24-Apr-2024 08:00                7921
function.grapheme-strripos.php                     24-Apr-2024 08:00                7704
function.grapheme-strrpos.php                      24-Apr-2024 08:00                7368
function.grapheme-strstr.php                       24-Apr-2024 08:00                7519
function.grapheme-substr.php                       24-Apr-2024 08:00                8101
function.gregoriantojd.php                         24-Apr-2024 08:00                7668
function.gzclose.php                               24-Apr-2024 08:00                4299
function.gzcompress.php                            24-Apr-2024 08:00                6073
function.gzdecode.php                              24-Apr-2024 08:00                3797
function.gzdeflate.php                             24-Apr-2024 08:00                5720
function.gzencode.php                              24-Apr-2024 08:00                7027
function.gzeof.php                                 24-Apr-2024 08:00                4188
function.gzfile.php                                24-Apr-2024 08:00                4822
function.gzgetc.php                                24-Apr-2024 08:00                4739
function.gzgets.php                                24-Apr-2024 08:00                6181
function.gzgetss.php                               24-Apr-2024 08:00                6148
function.gzinflate.php                             24-Apr-2024 08:00                5445
function.gzopen.php                                24-Apr-2024 08:00                5763
function.gzpassthru.php                            24-Apr-2024 08:00                4786
function.gzputs.php                                24-Apr-2024 08:00                1673
function.gzread.php                                24-Apr-2024 08:00                6669
function.gzrewind.php                              24-Apr-2024 08:00                3320
function.gzseek.php                                24-Apr-2024 08:00                6397
function.gztell.php                                24-Apr-2024 08:00                3493
function.gzuncompress.php                          24-Apr-2024 08:00                5405
function.gzwrite.php                               24-Apr-2024 08:00                6674
function.halt-compiler.php                         24-Apr-2024 08:00                5096
function.hash-algos.php                            24-Apr-2024 08:00                5813
function.hash-copy.php                             24-Apr-2024 08:00                5535
function.hash-equals.php                           24-Apr-2024 08:00                7217
function.hash-file.php                             24-Apr-2024 08:00                7561
function.hash-final.php                            24-Apr-2024 08:00                4866
function.hash-hkdf.php                             24-Apr-2024 08:00                9833
function.hash-hmac-algos.php                       24-Apr-2024 08:00                5318
function.hash-hmac-file.php                        24-Apr-2024 08:00                8324
function.hash-hmac.php                             24-Apr-2024 08:00                7908
function.hash-init.php                             24-Apr-2024 08:00               10522
function.hash-pbkdf2.php                           24-Apr-2024 08:00               12122
function.hash-update-file.php                      24-Apr-2024 08:00                5822
function.hash-update-stream.php                    24-Apr-2024 08:00                7417
function.hash-update.php                           24-Apr-2024 08:00                4428
function.hash.php                                  24-Apr-2024 08:00                7334
function.header-register-callback.php              24-Apr-2024 08:00                6805
function.header-remove.php                         24-Apr-2024 08:00                6810
function.header.php                                24-Apr-2024 08:00               19367
function.headers-list.php                          24-Apr-2024 08:00                5978
function.headers-sent.php                          24-Apr-2024 08:00                8188
function.hebrev.php                                24-Apr-2024 08:00                3349
function.hebrevc.php                               24-Apr-2024 08:00                3768
function.hex2bin.php                               24-Apr-2024 08:00                5007
function.hexdec.php                                24-Apr-2024 08:00                6460
function.highlight-file.php                        24-Apr-2024 08:00                6090
function.highlight-string.php                      24-Apr-2024 08:00                6927
function.hrtime.php                                24-Apr-2024 08:00                5249
function.html-entity-decode.php                    24-Apr-2024 08:00               14449
function.htmlentities.php                          24-Apr-2024 08:00               17554
function.htmlspecialchars-decode.php               24-Apr-2024 08:00                9357
function.htmlspecialchars.php                      24-Apr-2024 08:00               22727
function.http-build-query.php                      24-Apr-2024 08:00               19800
function.http-response-code.php                    24-Apr-2024 08:00                7048
function.hypot.php                                 24-Apr-2024 08:00                3083
function.ibase-add-user.php                        24-Apr-2024 08:00                5178
function.ibase-affected-rows.php                   24-Apr-2024 08:00                3462
function.ibase-backup.php                          24-Apr-2024 08:00               10492
function.ibase-blob-add.php                        24-Apr-2024 08:00                4000
function.ibase-blob-cancel.php                     24-Apr-2024 08:00                3701
function.ibase-blob-close.php                      24-Apr-2024 08:00                3984
function.ibase-blob-create.php                     24-Apr-2024 08:00                4051
function.ibase-blob-echo.php                       24-Apr-2024 08:00                4228
function.ibase-blob-get.php                        24-Apr-2024 08:00                6583
function.ibase-blob-import.php                     24-Apr-2024 08:00                8000
function.ibase-blob-info.php                       24-Apr-2024 08:00                3531
function.ibase-blob-open.php                       24-Apr-2024 08:00                4446
function.ibase-close.php                           24-Apr-2024 08:00                3803
function.ibase-commit-ret.php                      24-Apr-2024 08:00                3326
function.ibase-commit.php                          24-Apr-2024 08:00                3127
function.ibase-connect.php                         24-Apr-2024 08:00               10530
function.ibase-db-info.php                         24-Apr-2024 08:00                2747
function.ibase-delete-user.php                     24-Apr-2024 08:00                3594
function.ibase-drop-db.php                         24-Apr-2024 08:00                3701
function.ibase-errcode.php                         24-Apr-2024 08:00                2696
function.ibase-errmsg.php                          24-Apr-2024 08:00                2689
function.ibase-execute.php                         24-Apr-2024 08:00                6967
function.ibase-fetch-assoc.php                     24-Apr-2024 08:00                4737
function.ibase-fetch-object.php                    24-Apr-2024 08:00                6665
function.ibase-fetch-row.php                       24-Apr-2024 08:00                4554
function.ibase-field-info.php                      24-Apr-2024 08:00                6961
function.ibase-free-event-handler.php              24-Apr-2024 08:00                3539
function.ibase-free-query.php                      24-Apr-2024 08:00                2842
function.ibase-free-result.php                     24-Apr-2024 08:00                2934
function.ibase-gen-id.php                          24-Apr-2024 08:00                2862
function.ibase-maintain-db.php                     24-Apr-2024 08:00                3167
function.ibase-modify-user.php                     24-Apr-2024 08:00                5183
function.ibase-name-result.php                     24-Apr-2024 08:00                5793
function.ibase-num-fields.php                      24-Apr-2024 08:00                6422
function.ibase-num-params.php                      24-Apr-2024 08:00                3452
function.ibase-param-info.php                      24-Apr-2024 08:00                3704
function.ibase-pconnect.php                        24-Apr-2024 08:00                7931
function.ibase-prepare.php                         24-Apr-2024 08:00                4680
function.ibase-query.php                           24-Apr-2024 08:00                7236
function.ibase-restore.php                         24-Apr-2024 08:00               10799
function.ibase-rollback-ret.php                    24-Apr-2024 08:00                3367
function.ibase-rollback.php                        24-Apr-2024 08:00                3172
function.ibase-server-info.php                     24-Apr-2024 08:00                9852
function.ibase-service-attach.php                  24-Apr-2024 08:00               11042
function.ibase-service-detach.php                  24-Apr-2024 08:00                6153
function.ibase-set-event-handler.php               24-Apr-2024 08:00                7877
function.ibase-trans.php                           24-Apr-2024 08:00                5902
function.ibase-wait-event.php                      24-Apr-2024 08:00                4353
function.iconv-get-encoding.php                    24-Apr-2024 08:00                5703
function.iconv-mime-decode-headers.php             24-Apr-2024 08:00               10458
function.iconv-mime-decode.php                     24-Apr-2024 08:00                8372
function.iconv-mime-encode.php                     24-Apr-2024 08:00               11999
function.iconv-set-encoding.php                    24-Apr-2024 08:00                5004
function.iconv-strlen.php                          24-Apr-2024 08:00                5091
function.iconv-strpos.php                          24-Apr-2024 08:00                7520
function.iconv-strrpos.php                         24-Apr-2024 08:00                6732
function.iconv-substr.php                          24-Apr-2024 08:00                8521
function.iconv.php                                 24-Apr-2024 08:00                9051
function.idate.php                                 24-Apr-2024 08:00               11183
function.idn-to-ascii.php                          24-Apr-2024 08:00                7942
function.idn-to-utf8.php                           24-Apr-2024 08:00                7960
function.igbinary-serialize.php                    24-Apr-2024 08:00                9903
function.igbinary-unserialize.php                  24-Apr-2024 08:00                9913
function.ignore-user-abort.php                     24-Apr-2024 08:00                7407
function.image-type-to-extension.php               24-Apr-2024 08:00                5437
function.image-type-to-mime-type.php               24-Apr-2024 08:00                9073
function.image2wbmp.php                            24-Apr-2024 08:00                6525
function.imageaffine.php                           24-Apr-2024 08:00                4867
function.imageaffinematrixconcat.php               24-Apr-2024 08:00                6650
function.imageaffinematrixget.php                  24-Apr-2024 08:00                6721
function.imagealphablending.php                    24-Apr-2024 08:00                7726
function.imageantialias.php                        24-Apr-2024 08:00               10910
function.imagearc.php                              24-Apr-2024 08:00               13790
function.imageavif.php                             24-Apr-2024 08:00                6085
function.imagebmp.php                              24-Apr-2024 08:00                8269
function.imagechar.php                             24-Apr-2024 08:00               10174
function.imagecharup.php                           24-Apr-2024 08:00               10039
function.imagecolorallocate.php                    24-Apr-2024 08:00               10044
function.imagecolorallocatealpha.php               24-Apr-2024 08:00               18203
function.imagecolorat.php                          24-Apr-2024 08:00               10336
function.imagecolorclosest.php                     24-Apr-2024 08:00               12164
function.imagecolorclosestalpha.php                24-Apr-2024 08:00               12636
function.imagecolorclosesthwb.php                  24-Apr-2024 08:00                6691
function.imagecolordeallocate.php                  24-Apr-2024 08:00                5976
function.imagecolorexact.php                       24-Apr-2024 08:00                8554
function.imagecolorexactalpha.php                  24-Apr-2024 08:00                9516
function.imagecolormatch.php                       24-Apr-2024 08:00                8505
function.imagecolorresolve.php                     24-Apr-2024 08:00                7733
function.imagecolorresolvealpha.php                24-Apr-2024 08:00                8473
function.imagecolorset.php                         24-Apr-2024 08:00                8942
function.imagecolorsforindex.php                   24-Apr-2024 08:00                7438
function.imagecolorstotal.php                      24-Apr-2024 08:00                5880
function.imagecolortransparent.php                 24-Apr-2024 08:00                9215
function.imageconvolution.php                      24-Apr-2024 08:00               11880
function.imagecopy.php                             24-Apr-2024 08:00                9459
function.imagecopymerge.php                        24-Apr-2024 08:00                9721
function.imagecopymergegray.php                    24-Apr-2024 08:00               10244
function.imagecopyresampled.php                    24-Apr-2024 08:00               19202
function.imagecopyresized.php                      24-Apr-2024 08:00               14104
function.imagecreate.php                           24-Apr-2024 08:00                8372
function.imagecreatefromavif.php                   24-Apr-2024 08:00                2919
function.imagecreatefrombmp.php                    24-Apr-2024 08:00                5607
function.imagecreatefromgd.php                     24-Apr-2024 08:00                6184
function.imagecreatefromgd2.php                    24-Apr-2024 08:00                6452
function.imagecreatefromgd2part.php                24-Apr-2024 08:00                9009
function.imagecreatefromgif.php                    24-Apr-2024 08:00                9770
function.imagecreatefromjpeg.php                   24-Apr-2024 08:00                9421
function.imagecreatefrompng.php                    24-Apr-2024 08:00                9365
function.imagecreatefromstring.php                 24-Apr-2024 08:00                8106
function.imagecreatefromtga.php                    24-Apr-2024 08:00                3560
function.imagecreatefromwbmp.php                   24-Apr-2024 08:00                9407
function.imagecreatefromwebp.php                   24-Apr-2024 08:00                5759
function.imagecreatefromxbm.php                    24-Apr-2024 08:00                5599
function.imagecreatefromxpm.php                    24-Apr-2024 08:00                6244
function.imagecreatetruecolor.php                  24-Apr-2024 08:00                7237
function.imagecrop.php                             24-Apr-2024 08:00                7895
function.imagecropauto.php                         24-Apr-2024 08:00               10784
function.imagedashedline.php                       24-Apr-2024 08:00               12786
function.imagedestroy.php                          24-Apr-2024 08:00                5177
function.imageellipse.php                          24-Apr-2024 08:00               10233
function.imagefill.php                             24-Apr-2024 08:00                7729
function.imagefilledarc.php                        24-Apr-2024 08:00               19109
function.imagefilledellipse.php                    24-Apr-2024 08:00                9934
function.imagefilledpolygon.php                    24-Apr-2024 08:00               12225
function.imagefilledrectangle.php                  24-Apr-2024 08:00                8526
function.imagefilltoborder.php                     24-Apr-2024 08:00               11357
function.imagefilter.php                           24-Apr-2024 08:00               34034
function.imageflip.php                             24-Apr-2024 08:00                9898
function.imagefontheight.php                       24-Apr-2024 08:00                6527
function.imagefontwidth.php                        24-Apr-2024 08:00                6480
function.imageftbbox.php                           24-Apr-2024 08:00               14189
function.imagefttext.php                           24-Apr-2024 08:00               15951
function.imagegammacorrect.php                     24-Apr-2024 08:00                6061
function.imagegd.php                               24-Apr-2024 08:00               10750
function.imagegd2.php                              24-Apr-2024 08:00               11704
function.imagegetclip.php                          24-Apr-2024 08:00                6156
function.imagegetinterpolation.php                 24-Apr-2024 08:00                3806
function.imagegif.php                              24-Apr-2024 08:00               16705
function.imagegrabscreen.php                       24-Apr-2024 08:00                4830
function.imagegrabwindow.php                       24-Apr-2024 08:00                9952
function.imageinterlace.php                        24-Apr-2024 08:00                7282
function.imageistruecolor.php                      24-Apr-2024 08:00                7468
function.imagejpeg.php                             24-Apr-2024 08:00               15025
function.imagelayereffect.php                      24-Apr-2024 08:00               12117
function.imageline.php                             24-Apr-2024 08:00               15657
function.imageloadfont.php                         24-Apr-2024 08:00                9408
function.imageopenpolygon.php                      24-Apr-2024 08:00               10585
function.imagepalettecopy.php                      24-Apr-2024 08:00                7485
function.imagepalettetotruecolor.php               24-Apr-2024 08:00                9872
function.imagepng.php                              24-Apr-2024 08:00                9057
function.imagepolygon.php                          24-Apr-2024 08:00               10839
function.imagerectangle.php                        24-Apr-2024 08:00               10701
function.imageresolution.php                       24-Apr-2024 08:00                7949
function.imagerotate.php                           24-Apr-2024 08:00                9236
function.imagesavealpha.php                        24-Apr-2024 08:00                7763
function.imagescale.php                            24-Apr-2024 08:00                6895
function.imagesetbrush.php                         24-Apr-2024 08:00                9488
function.imagesetclip.php                          24-Apr-2024 08:00                5354
function.imagesetinterpolation.php                 24-Apr-2024 08:00               11672
function.imagesetpixel.php                         24-Apr-2024 08:00               11573
function.imagesetstyle.php                         24-Apr-2024 08:00               12454
function.imagesetthickness.php                     24-Apr-2024 08:00                8531
function.imagesettile.php                          24-Apr-2024 08:00                8509
function.imagestring.php                           24-Apr-2024 08:00               10374
function.imagestringup.php                         24-Apr-2024 08:00                9561
function.imagesx.php                               24-Apr-2024 08:00                5116
function.imagesy.php                               24-Apr-2024 08:00                5138
function.imagetruecolortopalette.php               24-Apr-2024 08:00                6989
function.imagettfbbox.php                          24-Apr-2024 08:00               19463
function.imagettftext.php                          24-Apr-2024 08:00               18186
function.imagetypes.php                            24-Apr-2024 08:00                5103
function.imagewbmp.php                             24-Apr-2024 08:00               15207
function.imagewebp.php                             24-Apr-2024 08:00                7606
function.imagexbm.php                              24-Apr-2024 08:00               11978
function.imap-8bit.php                             24-Apr-2024 08:00                3177
function.imap-alerts.php                           24-Apr-2024 08:00                3275
function.imap-append.php                           24-Apr-2024 08:00                9644
function.imap-base64.php                           24-Apr-2024 08:00                3528
function.imap-binary.php                           24-Apr-2024 08:00                3140
function.imap-body.php                             24-Apr-2024 08:00                5647
function.imap-bodystruct.php                       24-Apr-2024 08:00                4744
function.imap-check.php                            24-Apr-2024 08:00                6078
function.imap-clearflag-full.php                   24-Apr-2024 08:00                6503
function.imap-close.php                            24-Apr-2024 08:00                5016
function.imap-create.php                           24-Apr-2024 08:00                1777
function.imap-createmailbox.php                    24-Apr-2024 08:00               13853
function.imap-delete.php                           24-Apr-2024 08:00               10531
function.imap-deletemailbox.php                    24-Apr-2024 08:00                4965
function.imap-errors.php                           24-Apr-2024 08:00                3462
function.imap-expunge.php                          24-Apr-2024 08:00                3650
function.imap-fetch-overview.php                   24-Apr-2024 08:00               11335
function.imap-fetchbody.php                        24-Apr-2024 08:00                6243
function.imap-fetchheader.php                      24-Apr-2024 08:00                5894
function.imap-fetchmime.php                        24-Apr-2024 08:00                6432
function.imap-fetchstructure.php                   24-Apr-2024 08:00                9746
function.imap-fetchtext.php                        24-Apr-2024 08:00                1758
function.imap-gc.php                               24-Apr-2024 08:00                5885
function.imap-get-quota.php                        24-Apr-2024 08:00               12230
function.imap-get-quotaroot.php                    24-Apr-2024 08:00                9189
function.imap-getacl.php                           24-Apr-2024 08:00                5917
function.imap-getmailboxes.php                     24-Apr-2024 08:00               12195
function.imap-getsubscribed.php                    24-Apr-2024 08:00                7934
function.imap-header.php                           24-Apr-2024 08:00                1965
function.imap-headerinfo.php                       24-Apr-2024 08:00               11809
function.imap-headers.php                          24-Apr-2024 08:00                3533
function.imap-is-open.php                          24-Apr-2024 08:00                4228
function.imap-last-error.php                       24-Apr-2024 08:00                3191
function.imap-list.php                             24-Apr-2024 08:00                8708
function.imap-listmailbox.php                      24-Apr-2024 08:00                1763
function.imap-listscan.php                         24-Apr-2024 08:00                6983
function.imap-listsubscribed.php                   24-Apr-2024 08:00                1784
function.imap-lsub.php                             24-Apr-2024 08:00                6028
function.imap-mail-compose.php                     24-Apr-2024 08:00               16581
function.imap-mail-copy.php                        24-Apr-2024 08:00                6293
function.imap-mail-move.php                        24-Apr-2024 08:00                6673
function.imap-mail.php                             24-Apr-2024 08:00                7404
function.imap-mailboxmsginfo.php                   24-Apr-2024 08:00                9303
function.imap-mime-header-decode.php               24-Apr-2024 08:00                6502
function.imap-msgno.php                            24-Apr-2024 08:00                4218
function.imap-mutf7-to-utf8.php                    24-Apr-2024 08:00                3362
function.imap-num-msg.php                          24-Apr-2024 08:00                4075
function.imap-num-recent.php                       24-Apr-2024 08:00                3882
function.imap-open.php                             24-Apr-2024 08:00               21755
function.imap-ping.php                             24-Apr-2024 08:00                4948
function.imap-qprint.php                           24-Apr-2024 08:00                3186
function.imap-rename.php                           24-Apr-2024 08:00                1780
function.imap-renamemailbox.php                    24-Apr-2024 08:00                5606
function.imap-reopen.php                           24-Apr-2024 08:00                8806
function.imap-rfc822-parse-adrlist.php             24-Apr-2024 08:00                7892
function.imap-rfc822-parse-headers.php             24-Apr-2024 08:00                3744
function.imap-rfc822-write-address.php             24-Apr-2024 08:00                5405
function.imap-savebody.php                         24-Apr-2024 08:00                6629
function.imap-scan.php                             24-Apr-2024 08:00                1745
function.imap-scanmailbox.php                      24-Apr-2024 08:00                1775
function.imap-search.php                           24-Apr-2024 08:00               13591
function.imap-set-quota.php                        24-Apr-2024 08:00                6773
function.imap-setacl.php                           24-Apr-2024 08:00                5521
function.imap-setflag-full.php                     24-Apr-2024 08:00                8666
function.imap-sort.php                             24-Apr-2024 08:00                8583
function.imap-status.php                           24-Apr-2024 08:00               10764
function.imap-subscribe.php                        24-Apr-2024 08:00                4473
function.imap-thread.php                           24-Apr-2024 08:00                7926
function.imap-timeout.php                          24-Apr-2024 08:00                4796
function.imap-uid.php                              24-Apr-2024 08:00                4628
function.imap-undelete.php                         24-Apr-2024 08:00                5021
function.imap-unsubscribe.php                      24-Apr-2024 08:00                4550
function.imap-utf7-decode.php                      24-Apr-2024 08:00                3774
function.imap-utf7-encode.php                      24-Apr-2024 08:00                3291
function.imap-utf8-to-mutf7.php                    24-Apr-2024 08:00                3365
function.imap-utf8.php                             24-Apr-2024 08:00                4264
function.implode.php                               24-Apr-2024 08:00                7761
function.in-array.php                              24-Apr-2024 08:00               11664
function.include-once.php                          24-Apr-2024 08:00                2329
function.include.php                               24-Apr-2024 08:00               19812
function.inet-ntop.php                             24-Apr-2024 08:00                6318
function.inet-pton.php                             24-Apr-2024 08:00                4886
function.inflate-add.php                           24-Apr-2024 08:00                6278
function.inflate-get-read-len.php                  24-Apr-2024 08:00                3465
function.inflate-get-status.php                    24-Apr-2024 08:00                3272
function.inflate-init.php                          24-Apr-2024 08:00                7097
function.ini-alter.php                             24-Apr-2024 08:00                1712
function.ini-get-all.php                           24-Apr-2024 08:00               10326
function.ini-get.php                               24-Apr-2024 08:00               10530
function.ini-parse-quantity.php                    24-Apr-2024 08:00                7620
function.ini-restore.php                           24-Apr-2024 08:00                6394
function.ini-set.php                               24-Apr-2024 08:00                6772
function.inotify-add-watch.php                     24-Apr-2024 08:00                4460
function.inotify-init.php                          24-Apr-2024 08:00                8957
function.inotify-queue-len.php                     24-Apr-2024 08:00                3851
function.inotify-read.php                          24-Apr-2024 08:00                4449
function.inotify-rm-watch.php                      24-Apr-2024 08:00                3696
function.intdiv.php                                24-Apr-2024 08:00                7600
function.interface-exists.php                      24-Apr-2024 08:00                5425
function.intl-error-name.php                       24-Apr-2024 08:00                5061
function.intl-get-error-code.php                   24-Apr-2024 08:00                4544
function.intl-get-error-message.php                24-Apr-2024 08:00                4555
function.intl-is-failure.php                       24-Apr-2024 08:00                5614
function.intval.php                                24-Apr-2024 08:00               13721
function.ip2long.php                               24-Apr-2024 08:00                9232
function.iptcembed.php                             24-Apr-2024 08:00               11770
function.iptcparse.php                             24-Apr-2024 08:00                4663
function.is-a.php                                  24-Apr-2024 08:00                6962
function.is-array.php                              24-Apr-2024 08:00                5720
function.is-bool.php                               24-Apr-2024 08:00                5565
function.is-callable.php                           24-Apr-2024 08:00               10941
function.is-countable.php                          24-Apr-2024 08:00                6356
function.is-dir.php                                24-Apr-2024 08:00                6573
function.is-double.php                             24-Apr-2024 08:00                1716
function.is-executable.php                         24-Apr-2024 08:00                6397
function.is-file.php                               24-Apr-2024 08:00                6003
function.is-finite.php                             24-Apr-2024 08:00                6222
function.is-float.php                              24-Apr-2024 08:00                6589
function.is-infinite.php                           24-Apr-2024 08:00                5412
function.is-int.php                                24-Apr-2024 08:00                6612
function.is-integer.php                            24-Apr-2024 08:00                1709
function.is-iterable.php                           24-Apr-2024 08:00                5845
function.is-link.php                               24-Apr-2024 08:00                5652
function.is-long.php                               24-Apr-2024 08:00                1690
function.is-nan.php                                24-Apr-2024 08:00                6508
function.is-null.php                               24-Apr-2024 08:00                6073
function.is-numeric.php                            24-Apr-2024 08:00               11974
function.is-object.php                             24-Apr-2024 08:00                7202
function.is-readable.php                           24-Apr-2024 08:00                6212
function.is-real.php                               24-Apr-2024 08:00                1881
function.is-resource.php                           24-Apr-2024 08:00                5186
function.is-scalar.php                             24-Apr-2024 08:00                8217
function.is-soap-fault.php                         24-Apr-2024 08:00                8163
function.is-string.php                             24-Apr-2024 08:00                6709
function.is-subclass-of.php                        24-Apr-2024 08:00               12389
function.is-tainted.php                            24-Apr-2024 08:00                2396
function.is-uploaded-file.php                      24-Apr-2024 08:00                6785
function.is-writable.php                           24-Apr-2024 08:00                5850
function.is-writeable.php                          24-Apr-2024 08:00                1758
function.isset.php                                 24-Apr-2024 08:00               16083
function.iterator-apply.php                        24-Apr-2024 08:00                6809
function.iterator-count.php                        24-Apr-2024 08:00                8735
function.iterator-to-array.php                     24-Apr-2024 08:00                8000
function.jddayofweek.php                           24-Apr-2024 08:00                3858
function.jdmonthname.php                           24-Apr-2024 08:00                5052
function.jdtofrench.php                            24-Apr-2024 08:00                3158
function.jdtogregorian.php                         24-Apr-2024 08:00                3188
function.jdtojewish.php                            24-Apr-2024 08:00                7491
function.jdtojulian.php                            24-Apr-2024 08:00                3166
function.jdtounix.php                              24-Apr-2024 08:00                4427
function.jewishtojd.php                            24-Apr-2024 08:00                4639
function.join.php                                  24-Apr-2024 08:00                1667
function.jpeg2wbmp.php                             24-Apr-2024 08:00                6699
function.json-decode.php                           24-Apr-2024 08:00               20297
function.json-encode.php                           24-Apr-2024 08:00               31082
function.json-last-error-msg.php                   24-Apr-2024 08:00                3095
function.json-last-error.php                       24-Apr-2024 08:00               14015
function.json-validate.php                         24-Apr-2024 08:00                8668
function.juliantojd.php                            24-Apr-2024 08:00                4498
function.key-exists.php                            24-Apr-2024 08:00                1743
function.key.php                                   24-Apr-2024 08:00                8084
function.krsort.php                                24-Apr-2024 08:00                8839
function.ksort.php                                 24-Apr-2024 08:00               10789
function.lcfirst.php                               24-Apr-2024 08:00                5874
function.lcg-value.php                             24-Apr-2024 08:00                5158
function.lchgrp.php                                24-Apr-2024 08:00                5929
function.lchown.php                                24-Apr-2024 08:00                5785
function.ldap-8859-to-t61.php                      24-Apr-2024 08:00                3399
function.ldap-add-ext.php                          24-Apr-2024 08:00                5796
function.ldap-add.php                              24-Apr-2024 08:00               10437
function.ldap-bind-ext.php                         24-Apr-2024 08:00                5997
function.ldap-bind.php                             24-Apr-2024 08:00                9527
function.ldap-close.php                            24-Apr-2024 08:00                1728
function.ldap-compare.php                          24-Apr-2024 08:00               10371
function.ldap-connect-wallet.php                   24-Apr-2024 08:00                4423
function.ldap-connect.php                          24-Apr-2024 08:00                9822
function.ldap-control-paged-result-response.php    24-Apr-2024 08:00                5909
function.ldap-control-paged-result.php             24-Apr-2024 08:00               14506
function.ldap-count-entries.php                    24-Apr-2024 08:00                5767
function.ldap-count-references.php                 24-Apr-2024 08:00                4796
function.ldap-delete-ext.php                       24-Apr-2024 08:00                5342
function.ldap-delete.php                           24-Apr-2024 08:00                5361
function.ldap-dn2ufn.php                           24-Apr-2024 08:00                2784
function.ldap-err2str.php                          24-Apr-2024 08:00                4671
function.ldap-errno.php                            24-Apr-2024 08:00                7573
function.ldap-error.php                            24-Apr-2024 08:00                4562
function.ldap-escape.php                           24-Apr-2024 08:00                6385
function.ldap-exop-passwd.php                      24-Apr-2024 08:00               10390
function.ldap-exop-refresh.php                     24-Apr-2024 08:00                5208
function.ldap-exop-sync.php                        24-Apr-2024 08:00                5438
function.ldap-exop-whoami.php                      24-Apr-2024 08:00                3982
function.ldap-exop.php                             24-Apr-2024 08:00               12536
function.ldap-explode-dn.php                       24-Apr-2024 08:00                3690
function.ldap-first-attribute.php                  24-Apr-2024 08:00                5504
function.ldap-first-entry.php                      24-Apr-2024 08:00                5845
function.ldap-first-reference.php                  24-Apr-2024 08:00                2393
function.ldap-free-result.php                      24-Apr-2024 08:00                4148
function.ldap-get-attributes.php                   24-Apr-2024 08:00                8271
function.ldap-get-dn.php                           24-Apr-2024 08:00                4364
function.ldap-get-entries.php                      24-Apr-2024 08:00                6172
function.ldap-get-option.php                       24-Apr-2024 08:00               16742
function.ldap-get-values-len.php                   24-Apr-2024 08:00                5563
function.ldap-get-values.php                       24-Apr-2024 08:00                8675
function.ldap-list.php                             24-Apr-2024 08:00               15493
function.ldap-mod-add.php                          24-Apr-2024 08:00                6844
function.ldap-mod-del.php                          24-Apr-2024 08:00                6409
function.ldap-mod-replace.php                      24-Apr-2024 08:00                6789
function.ldap-mod_add-ext.php                      24-Apr-2024 08:00                5811
function.ldap-mod_del-ext.php                      24-Apr-2024 08:00                5827
function.ldap-mod_replace-ext.php                  24-Apr-2024 08:00                5889
function.ldap-modify-batch.php                     24-Apr-2024 08:00               19016
function.ldap-modify.php                           24-Apr-2024 08:00                2130
function.ldap-next-attribute.php                   24-Apr-2024 08:00                5283
function.ldap-next-entry.php                       24-Apr-2024 08:00                5864
function.ldap-next-reference.php                   24-Apr-2024 08:00                2320
function.ldap-parse-exop.php                       24-Apr-2024 08:00                6024
function.ldap-parse-reference.php                  24-Apr-2024 08:00                2462
function.ldap-parse-result.php                     24-Apr-2024 08:00                9968
function.ldap-read.php                             24-Apr-2024 08:00               12815
function.ldap-rename-ext.php                       24-Apr-2024 08:00                6161
function.ldap-rename.php                           24-Apr-2024 08:00                7253
function.ldap-sasl-bind.php                        24-Apr-2024 08:00                7116
function.ldap-search.php                           24-Apr-2024 08:00               15699
function.ldap-set-option.php                       24-Apr-2024 08:00               19327
function.ldap-set-rebind-proc.php                  24-Apr-2024 08:00                3282
function.ldap-sort.php                             24-Apr-2024 08:00                7251
function.ldap-start-tls.php                        24-Apr-2024 08:00                2076
function.ldap-t61-to-8859.php                      24-Apr-2024 08:00                2228
function.ldap-unbind.php                           24-Apr-2024 08:00                3888
function.levenshtein.php                           24-Apr-2024 08:00               12408
function.libxml-clear-errors.php                   24-Apr-2024 08:00                2877
function.libxml-disable-entity-loader.php          24-Apr-2024 08:00                4984
function.libxml-get-errors.php                     24-Apr-2024 08:00               10723
function.libxml-get-external-entity-loader.php     24-Apr-2024 08:00                3513
function.libxml-get-last-error.php                 24-Apr-2024 08:00                3247
function.libxml-set-external-entity-loader.php     24-Apr-2024 08:00               10554
function.libxml-set-streams-context.php            24-Apr-2024 08:00                5093
function.libxml-use-internal-errors.php            24-Apr-2024 08:00                6706
function.link.php                                  24-Apr-2024 08:00                5886
function.linkinfo.php                              24-Apr-2024 08:00                4556
function.list.php                                  24-Apr-2024 08:00               16778
function.localeconv.php                            24-Apr-2024 08:00                9541
function.localtime.php                             24-Apr-2024 08:00                9319
function.log.php                                   24-Apr-2024 08:00                4057
function.log10.php                                 24-Apr-2024 08:00                2720
function.log1p.php                                 24-Apr-2024 08:00                3488
function.long2ip.php                               24-Apr-2024 08:00                4483
function.lstat.php                                 24-Apr-2024 08:00                6505
function.ltrim.php                                 24-Apr-2024 08:00                9609
function.lzf-compress.php                          24-Apr-2024 08:00                3000
function.lzf-decompress.php                        24-Apr-2024 08:00                3089
function.lzf-optimized-for.php                     24-Apr-2024 08:00                2276
function.mail.php                                  24-Apr-2024 08:00               25913
function.mailparse-determine-best-xfer-encoding..> 24-Apr-2024 08:00                4323
function.mailparse-msg-create.php                  24-Apr-2024 08:00                3412
function.mailparse-msg-extract-part-file.php       24-Apr-2024 08:00                5386
function.mailparse-msg-extract-part.php            24-Apr-2024 08:00                4147
function.mailparse-msg-extract-whole-part-file.php 24-Apr-2024 08:00                4174
function.mailparse-msg-free.php                    24-Apr-2024 08:00                3668
function.mailparse-msg-get-part-data.php           24-Apr-2024 08:00                2618
function.mailparse-msg-get-part.php                24-Apr-2024 08:00                2901
function.mailparse-msg-get-structure.php           24-Apr-2024 08:00                2638
function.mailparse-msg-parse-file.php              24-Apr-2024 08:00                4286
function.mailparse-msg-parse.php                   24-Apr-2024 08:00                3587
function.mailparse-rfc822-parse-addresses.php      24-Apr-2024 08:00                5713
function.mailparse-stream-encode.php               24-Apr-2024 08:00                5953
function.mailparse-uudecode-all.php                24-Apr-2024 08:00                6960
function.max.php                                   24-Apr-2024 08:00               12305
function.mb-check-encoding.php                     24-Apr-2024 08:00                5573
function.mb-chr.php                                24-Apr-2024 08:00                7079
function.mb-convert-case.php                       24-Apr-2024 08:00               11973
function.mb-convert-encoding.php                   24-Apr-2024 08:00               11914
function.mb-convert-kana.php                       24-Apr-2024 08:00               10248
function.mb-convert-variables.php                  24-Apr-2024 08:00                6737
function.mb-decode-mimeheader.php                  24-Apr-2024 08:00                3331
function.mb-decode-numericentity.php               24-Apr-2024 08:00               34072
function.mb-detect-encoding.php                    24-Apr-2024 08:00               16501
function.mb-detect-order.php                       24-Apr-2024 08:00                8980
function.mb-encode-mimeheader.php                  24-Apr-2024 08:00                9996
function.mb-encode-numericentity.php               24-Apr-2024 08:00               12801
function.mb-encoding-aliases.php                   24-Apr-2024 08:00                6438
function.mb-ereg-match.php                         24-Apr-2024 08:00                5667
function.mb-ereg-replace-callback.php              24-Apr-2024 08:00               12550
function.mb-ereg-replace.php                       24-Apr-2024 08:00                7280
function.mb-ereg-search-getpos.php                 24-Apr-2024 08:00                3923
function.mb-ereg-search-getregs.php                24-Apr-2024 08:00                4402
function.mb-ereg-search-init.php                   24-Apr-2024 08:00                6190
function.mb-ereg-search-pos.php                    24-Apr-2024 08:00                6064
function.mb-ereg-search-regs.php                   24-Apr-2024 08:00                5816
function.mb-ereg-search-setpos.php                 24-Apr-2024 08:00                4590
function.mb-ereg-search.php                        24-Apr-2024 08:00                5757
function.mb-ereg.php                               24-Apr-2024 08:00                6541
function.mb-eregi-replace.php                      24-Apr-2024 08:00                7164
function.mb-eregi.php                              24-Apr-2024 08:00                6585
function.mb-get-info.php                           24-Apr-2024 08:00                6258
function.mb-http-input.php                         24-Apr-2024 08:00                5073
function.mb-http-output.php                        24-Apr-2024 08:00                4996
function.mb-internal-encoding.php                  24-Apr-2024 08:00                7051
function.mb-language.php                           24-Apr-2024 08:00                6637
function.mb-list-encodings.php                     24-Apr-2024 08:00                5117
function.mb-ord.php                                24-Apr-2024 08:00                6898
function.mb-output-handler.php                     24-Apr-2024 08:00                5285
function.mb-parse-str.php                          24-Apr-2024 08:00                4714
function.mb-preferred-mime-name.php                24-Apr-2024 08:00                4595
function.mb-regex-encoding.php                     24-Apr-2024 08:00                4644
function.mb-regex-set-options.php                  24-Apr-2024 08:00                8679
function.mb-scrub.php                              24-Apr-2024 08:00                4173
function.mb-send-mail.php                          24-Apr-2024 08:00                9993
function.mb-split.php                              24-Apr-2024 08:00                4865
function.mb-str-pad.php                            24-Apr-2024 08:00                8663
function.mb-str-split.php                          24-Apr-2024 08:00                5461
function.mb-strcut.php                             24-Apr-2024 08:00                7655
function.mb-strimwidth.php                         24-Apr-2024 08:00                8113
function.mb-stripos.php                            24-Apr-2024 08:00                6540
function.mb-stristr.php                            24-Apr-2024 08:00                6808
function.mb-strlen.php                             24-Apr-2024 08:00                5232
function.mb-strpos.php                             24-Apr-2024 08:00                6644
function.mb-strrchr.php                            24-Apr-2024 08:00                6656
function.mb-strrichr.php                           24-Apr-2024 08:00                6711
function.mb-strripos.php                           24-Apr-2024 08:00                6403
function.mb-strrpos.php                            24-Apr-2024 08:00                6963
function.mb-strstr.php                             24-Apr-2024 08:00                6613
function.mb-strtolower.php                         24-Apr-2024 08:00                7224
function.mb-strtoupper.php                         24-Apr-2024 08:00                7229
function.mb-strwidth.php                           24-Apr-2024 08:00                9234
function.mb-substitute-character.php               24-Apr-2024 08:00                7392
function.mb-substr-count.php                       24-Apr-2024 08:00                6200
function.mb-substr.php                             24-Apr-2024 08:00                6681
function.mcrypt-create-iv.php                      24-Apr-2024 08:00                6990
function.mcrypt-decrypt.php                        24-Apr-2024 08:00                5944
function.mcrypt-enc-get-algorithms-name.php        24-Apr-2024 08:00                5381
function.mcrypt-enc-get-block-size.php             24-Apr-2024 08:00                3059
function.mcrypt-enc-get-iv-size.php                24-Apr-2024 08:00                3184
function.mcrypt-enc-get-key-size.php               24-Apr-2024 08:00                3063
function.mcrypt-enc-get-modes-name.php             24-Apr-2024 08:00                5283
function.mcrypt-enc-get-supported-key-sizes.php    24-Apr-2024 08:00                5065
function.mcrypt-enc-is-block-algorithm-mode.php    24-Apr-2024 08:00                3633
function.mcrypt-enc-is-block-algorithm.php         24-Apr-2024 08:00                3354
function.mcrypt-enc-is-block-mode.php              24-Apr-2024 08:00                3461
function.mcrypt-enc-self-test.php                  24-Apr-2024 08:00                3145
function.mcrypt-encrypt.php                        24-Apr-2024 08:00               13910
function.mcrypt-generic-deinit.php                 24-Apr-2024 08:00                4072
function.mcrypt-generic-init.php                   24-Apr-2024 08:00                5284
function.mcrypt-generic.php                        24-Apr-2024 08:00                5922
function.mcrypt-get-block-size.php                 24-Apr-2024 08:00                6713
function.mcrypt-get-cipher-name.php                24-Apr-2024 08:00                5102
function.mcrypt-get-iv-size.php                    24-Apr-2024 08:00                6534
function.mcrypt-get-key-size.php                   24-Apr-2024 08:00                6871
function.mcrypt-list-algorithms.php                24-Apr-2024 08:00                4843
function.mcrypt-list-modes.php                     24-Apr-2024 08:00                4704
function.mcrypt-module-close.php                   24-Apr-2024 08:00                3508
function.mcrypt-module-get-algo-block-size.php     24-Apr-2024 08:00                3575
function.mcrypt-module-get-algo-key-size.php       24-Apr-2024 08:00                3642
function.mcrypt-module-get-supported-key-sizes.php 24-Apr-2024 08:00                4710
function.mcrypt-module-is-block-algorithm-mode.php 24-Apr-2024 08:00                4568
function.mcrypt-module-is-block-algorithm.php      24-Apr-2024 08:00                4109
function.mcrypt-module-is-block-mode.php           24-Apr-2024 08:00                4599
function.mcrypt-module-open.php                    24-Apr-2024 08:00               14129
function.mcrypt-module-self-test.php               24-Apr-2024 08:00                5121
function.md5-file.php                              24-Apr-2024 08:00                5266
function.md5.php                                   24-Apr-2024 08:00                5992
function.mdecrypt-generic.php                      24-Apr-2024 08:00               10910
function.memcache-debug.php                        24-Apr-2024 08:00                3781
function.memory-get-peak-usage.php                 24-Apr-2024 08:00                3739
function.memory-get-usage.php                      24-Apr-2024 08:00                5611
function.memory-reset-peak-usage.php               24-Apr-2024 08:00                5014
function.metaphone.php                             24-Apr-2024 08:00                8234
function.method-exists.php                         24-Apr-2024 08:00                6613
function.mhash-count.php                           24-Apr-2024 08:00                4664
function.mhash-get-block-size.php                  24-Apr-2024 08:00                4610
function.mhash-get-hash-name.php                   24-Apr-2024 08:00                4565
function.mhash-keygen-s2k.php                      24-Apr-2024 08:00                5737
function.mhash.php                                 24-Apr-2024 08:00                4887
function.microtime.php                             24-Apr-2024 08:00                8116
function.mime-content-type.php                     24-Apr-2024 08:00                5103
function.min.php                                   24-Apr-2024 08:00               12849
function.mkdir.php                                 24-Apr-2024 08:00                9758
function.mktime.php                                24-Apr-2024 08:00               19167
function.money-format.php                          24-Apr-2024 08:00               18478
function.mongodb.bson-fromjson.php                 24-Apr-2024 08:00                5907
function.mongodb.bson-fromphp.php                  24-Apr-2024 08:00                6246
function.mongodb.bson-tocanonicalextendedjson.php  24-Apr-2024 08:00               13945
function.mongodb.bson-tojson.php                   24-Apr-2024 08:00               15019
function.mongodb.bson-tophp.php                    24-Apr-2024 08:00                9127
function.mongodb.bson-torelaxedextendedjson.php    24-Apr-2024 08:00               13642
function.mongodb.driver.monitoring.addsubscribe..> 24-Apr-2024 08:00                5100
function.mongodb.driver.monitoring.removesubscr..> 24-Apr-2024 08:00                4957
function.move-uploaded-file.php                    24-Apr-2024 08:00                8526
function.mqseries-back.php                         24-Apr-2024 08:00                6497
function.mqseries-begin.php                        24-Apr-2024 08:00                7459
function.mqseries-close.php                        24-Apr-2024 08:00                6680
function.mqseries-cmit.php                         24-Apr-2024 08:00                6424
function.mqseries-conn.php                         24-Apr-2024 08:00                6005
function.mqseries-connx.php                        24-Apr-2024 08:00               12707
function.mqseries-disc.php                         24-Apr-2024 08:00                5707
function.mqseries-get.php                          24-Apr-2024 08:00               12325
function.mqseries-inq.php                          24-Apr-2024 08:00                9383
function.mqseries-open.php                         24-Apr-2024 08:00                7316
function.mqseries-put.php                          24-Apr-2024 08:00               12604
function.mqseries-put1.php                         24-Apr-2024 08:00                6349
function.mqseries-set.php                          24-Apr-2024 08:00                6275
function.mqseries-strerror.php                     24-Apr-2024 08:00                4295
function.msg-get-queue.php                         24-Apr-2024 08:00                5677
function.msg-queue-exists.php                      24-Apr-2024 08:00                3444
function.msg-receive.php                           24-Apr-2024 08:00               11471
function.msg-remove-queue.php                      24-Apr-2024 08:00                4636
function.msg-send.php                              24-Apr-2024 08:00                9595
function.msg-set-queue.php                         24-Apr-2024 08:00                5294
function.msg-stat-queue.php                        24-Apr-2024 08:00                6680
function.mt-getrandmax.php                         24-Apr-2024 08:00                3316
function.mt-rand.php                               24-Apr-2024 08:00               10392
function.mt-srand.php                              24-Apr-2024 08:00                8464
function.mysql-affected-rows.php                   24-Apr-2024 08:00               12007
function.mysql-client-encoding.php                 24-Apr-2024 08:00                6170
function.mysql-close.php                           24-Apr-2024 08:00                7356
function.mysql-connect.php                         24-Apr-2024 08:00               17103
function.mysql-create-db.php                       24-Apr-2024 08:00                8399
function.mysql-data-seek.php                       24-Apr-2024 08:00               11884
function.mysql-db-name.php                         24-Apr-2024 08:00                7741
function.mysql-db-query.php                        24-Apr-2024 08:00                9909
function.mysql-drop-db.php                         24-Apr-2024 08:00                7693
function.mysql-errno.php                           24-Apr-2024 08:00                8141
function.mysql-error.php                           24-Apr-2024 08:00                8107
function.mysql-escape-string.php                   24-Apr-2024 08:00                6532
function.mysql-fetch-array.php                     24-Apr-2024 08:00               15606
function.mysql-fetch-assoc.php                     24-Apr-2024 08:00               11372
function.mysql-fetch-field.php                     24-Apr-2024 08:00               12944
function.mysql-fetch-lengths.php                   24-Apr-2024 08:00                7615
function.mysql-fetch-object.php                    24-Apr-2024 08:00               11828
function.mysql-fetch-row.php                       24-Apr-2024 08:00                7696
function.mysql-field-flags.php                     24-Apr-2024 08:00                8578
function.mysql-field-len.php                       24-Apr-2024 08:00                6994
function.mysql-field-name.php                      24-Apr-2024 08:00                9060
function.mysql-field-seek.php                      24-Apr-2024 08:00                5099
function.mysql-field-table.php                     24-Apr-2024 08:00                7634
function.mysql-field-type.php                      24-Apr-2024 08:00               11661
function.mysql-free-result.php                     24-Apr-2024 08:00                7732
function.mysql-get-client-info.php                 24-Apr-2024 08:00                5104
function.mysql-get-host-info.php                   24-Apr-2024 08:00                6936
function.mysql-get-proto-info.php                  24-Apr-2024 08:00                6511
function.mysql-get-server-info.php                 24-Apr-2024 08:00                6994
function.mysql-info.php                            24-Apr-2024 08:00                6276
function.mysql-insert-id.php                       24-Apr-2024 08:00                8213
function.mysql-list-dbs.php                        24-Apr-2024 08:00                8684
function.mysql-list-fields.php                     24-Apr-2024 08:00                8845
function.mysql-list-processes.php                  24-Apr-2024 08:00                7554
function.mysql-list-tables.php                     24-Apr-2024 08:00                9504
function.mysql-num-fields.php                      24-Apr-2024 08:00                6560
function.mysql-num-rows.php                        24-Apr-2024 08:00                8011
function.mysql-pconnect.php                        24-Apr-2024 08:00                8364
function.mysql-ping.php                            24-Apr-2024 08:00                7841
function.mysql-query.php                           24-Apr-2024 08:00               13743
function.mysql-real-escape-string.php              24-Apr-2024 08:00               15204
function.mysql-result.php                          24-Apr-2024 08:00                9549
function.mysql-select-db.php                       24-Apr-2024 08:00                7634
function.mysql-set-charset.php                     24-Apr-2024 08:00                5825
function.mysql-stat.php                            24-Apr-2024 08:00                9244
function.mysql-tablename.php                       24-Apr-2024 08:00                8087
function.mysql-thread-id.php                       24-Apr-2024 08:00                6563
function.mysql-unbuffered-query.php                24-Apr-2024 08:00                7101
function.mysql-xdevapi-expression.php              24-Apr-2024 08:00                4854
function.mysql-xdevapi-getsession.php              24-Apr-2024 08:00               13118
function.mysqli-connect.php                        24-Apr-2024 08:00                2372
function.mysqli-escape-string.php                  24-Apr-2024 08:00                1971
function.mysqli-execute.php                        24-Apr-2024 08:00                2521
function.mysqli-get-client-stats.php               24-Apr-2024 08:00                8427
function.mysqli-get-links-stats.php                24-Apr-2024 08:00                3421
function.mysqli-report.php                         24-Apr-2024 08:00                1773
function.mysqli-set-opt.php                        24-Apr-2024 08:00                1860
function.natcasesort.php                           24-Apr-2024 08:00                7732
function.natsort.php                               24-Apr-2024 08:00               10986
function.net-get-interfaces.php                    24-Apr-2024 08:00                4777
function.next.php                                  24-Apr-2024 08:00                9746
function.ngettext.php                              24-Apr-2024 08:00                5802
function.nl-langinfo.php                           24-Apr-2024 08:00               15468
function.nl2br.php                                 24-Apr-2024 08:00                6886
function.number-format.php                         24-Apr-2024 08:00                8750
function.oauth-get-sbs.php                         24-Apr-2024 08:00                3186
function.oauth-urlencode.php                       24-Apr-2024 08:00                2627
function.ob-clean.php                              24-Apr-2024 08:00                4600
function.ob-end-clean.php                          24-Apr-2024 08:00                5795
function.ob-end-flush.php                          24-Apr-2024 08:00                5656
function.ob-flush.php                              24-Apr-2024 08:00                4703
function.ob-get-clean.php                          24-Apr-2024 08:00                6875
function.ob-get-contents.php                       24-Apr-2024 08:00                4820
function.ob-get-flush.php                          24-Apr-2024 08:00                6664
function.ob-get-length.php                         24-Apr-2024 08:00                4757
function.ob-get-level.php                          24-Apr-2024 08:00                3656
function.ob-get-status.php                         24-Apr-2024 08:00               10107
function.ob-gzhandler.php                          24-Apr-2024 08:00                5943
function.ob-iconv-handler.php                      24-Apr-2024 08:00                5160
function.ob-implicit-flush.php                     24-Apr-2024 08:00                5262
function.ob-list-handlers.php                      24-Apr-2024 08:00               13905
function.ob-start.php                              24-Apr-2024 08:00               15440
function.ob-tidyhandler.php                        24-Apr-2024 08:00                4422
function.oci-bind-array-by-name.php                24-Apr-2024 08:00               13939
function.oci-bind-by-name.php                      24-Apr-2024 08:00               79342
function.oci-cancel.php                            24-Apr-2024 08:00                2730
function.oci-client-version.php                    24-Apr-2024 08:00                4048
function.oci-close.php                             24-Apr-2024 08:00               18613
function.oci-commit.php                            24-Apr-2024 08:00               11040
function.oci-connect.php                           24-Apr-2024 08:00               35419
function.oci-define-by-name.php                    24-Apr-2024 08:00               23980
function.oci-error.php                             24-Apr-2024 08:00               11943
function.oci-execute.php                           24-Apr-2024 08:00               21404
function.oci-fetch-all.php                         24-Apr-2024 08:00               24822
function.oci-fetch-array.php                       24-Apr-2024 08:00               64597
function.oci-fetch-assoc.php                       24-Apr-2024 08:00                8938
function.oci-fetch-object.php                      24-Apr-2024 08:00               18303
function.oci-fetch-row.php                         24-Apr-2024 08:00                8860
function.oci-fetch.php                             24-Apr-2024 08:00               13558
function.oci-field-is-null.php                     24-Apr-2024 08:00                7931
function.oci-field-name.php                        24-Apr-2024 08:00                9844
function.oci-field-precision.php                   24-Apr-2024 08:00                8702
function.oci-field-scale.php                       24-Apr-2024 08:00                8680
function.oci-field-size.php                        24-Apr-2024 08:00               10296
function.oci-field-type-raw.php                    24-Apr-2024 08:00                7961
function.oci-field-type.php                        24-Apr-2024 08:00               10698
function.oci-free-descriptor.php                   24-Apr-2024 08:00                3555
function.oci-free-statement.php                    24-Apr-2024 08:00                3010
function.oci-get-implicit-resultset.php            24-Apr-2024 08:00               28240
function.oci-internal-debug.php                    24-Apr-2024 08:00                3119
function.oci-lob-copy.php                          24-Apr-2024 08:00                4619
function.oci-lob-is-equal.php                      24-Apr-2024 08:00                3323
function.oci-new-collection.php                    24-Apr-2024 08:00                5148
function.oci-new-connect.php                       24-Apr-2024 08:00               16677
function.oci-new-cursor.php                        24-Apr-2024 08:00                7804
function.oci-new-descriptor.php                    24-Apr-2024 08:00               18290
function.oci-num-fields.php                        24-Apr-2024 08:00                6968
function.oci-num-rows.php                          24-Apr-2024 08:00                7974
function.oci-parse.php                             24-Apr-2024 08:00               12618
function.oci-password-change.php                   24-Apr-2024 08:00               13583
function.oci-pconnect.php                          24-Apr-2024 08:00               15090
function.oci-register-taf-callback.php             24-Apr-2024 08:00                5816
function.oci-result.php                            24-Apr-2024 08:00                8657
function.oci-rollback.php                          24-Apr-2024 08:00               14395
function.oci-server-version.php                    24-Apr-2024 08:00                4832
function.oci-set-action.php                        24-Apr-2024 08:00                8456
function.oci-set-call-timout.php                   24-Apr-2024 08:00                6002
function.oci-set-client-identifier.php             24-Apr-2024 08:00                8170
function.oci-set-client-info.php                   24-Apr-2024 08:00                8378
function.oci-set-db-operation.php                  24-Apr-2024 08:00                7841
function.oci-set-edition.php                       24-Apr-2024 08:00                9778
function.oci-set-module-name.php                   24-Apr-2024 08:00                8572
function.oci-set-prefetch-lob.php                  24-Apr-2024 08:00                8894
function.oci-set-prefetch.php                      24-Apr-2024 08:00               20753
function.oci-statement-type.php                    24-Apr-2024 08:00                7093
function.oci-unregister-taf-callback.php           24-Apr-2024 08:00                3667
function.ocibindbyname.php                         24-Apr-2024 08:00                2000
function.ocicancel.php                             24-Apr-2024 08:00                1942
function.ocicloselob.php                           24-Apr-2024 08:00                1941
function.ocicollappend.php                         24-Apr-2024 08:00                2006
function.ocicollassign.php                         24-Apr-2024 08:00                2011
function.ocicollassignelem.php                     24-Apr-2024 08:00                2056
function.ocicollgetelem.php                        24-Apr-2024 08:00                2023
function.ocicollmax.php                            24-Apr-2024 08:00                1975
function.ocicollsize.php                           24-Apr-2024 08:00                1978
function.ocicolltrim.php                           24-Apr-2024 08:00                1988
function.ocicolumnisnull.php                       24-Apr-2024 08:00                2012
function.ocicolumnname.php                         24-Apr-2024 08:00                2004
function.ocicolumnprecision.php                    24-Apr-2024 08:00                2047
function.ocicolumnscale.php                        24-Apr-2024 08:00                2011
function.ocicolumnsize.php                         24-Apr-2024 08:00                1992
function.ocicolumntype.php                         24-Apr-2024 08:00                1996
function.ocicolumntyperaw.php                      24-Apr-2024 08:00                2019
function.ocicommit.php                             24-Apr-2024 08:00                1956
function.ocidefinebyname.php                       24-Apr-2024 08:00                2002
function.ocierror.php                              24-Apr-2024 08:00                1933
function.ociexecute.php                            24-Apr-2024 08:00                1937
function.ocifetch.php                              24-Apr-2024 08:00                1927
function.ocifetchinto.php                          24-Apr-2024 08:00                2674
function.ocifetchstatement.php                     24-Apr-2024 08:00                2020
function.ocifreecollection.php                     24-Apr-2024 08:00                2038
function.ocifreecursor.php                         24-Apr-2024 08:00                2010
function.ocifreedesc.php                           24-Apr-2024 08:00                1954
function.ocifreestatement.php                      24-Apr-2024 08:00                2029
function.ociinternaldebug.php                      24-Apr-2024 08:00                2043
function.ociloadlob.php                            24-Apr-2024 08:00                1939
function.ocilogoff.php                             24-Apr-2024 08:00                1926
function.ocilogon.php                              24-Apr-2024 08:00                1941
function.ocinewcollection.php                      24-Apr-2024 08:00                2027
function.ocinewcursor.php                          24-Apr-2024 08:00                1995
function.ocinewdescriptor.php                      24-Apr-2024 08:00                2017
function.ocinlogon.php                             24-Apr-2024 08:00                1966
function.ocinumcols.php                            24-Apr-2024 08:00                1951
function.ociparse.php                              24-Apr-2024 08:00                1921
function.ociplogon.php                             24-Apr-2024 08:00                1936
function.ociresult.php                             24-Apr-2024 08:00                1934
function.ocirollback.php                           24-Apr-2024 08:00                1956
function.ocirowcount.php                           24-Apr-2024 08:00                1958
function.ocisavelob.php                            24-Apr-2024 08:00                1939
function.ocisavelobfile.php                        24-Apr-2024 08:00                1977
function.ociserverversion.php                      24-Apr-2024 08:00                2031
function.ocisetprefetch.php                        24-Apr-2024 08:00                2017
function.ocistatementtype.php                      24-Apr-2024 08:00                2037
function.ociwritelobtofile.php                     24-Apr-2024 08:00                2018
function.ociwritetemporarylob.php                  24-Apr-2024 08:00                2041
function.octdec.php                                24-Apr-2024 08:00                5886
function.odbc-autocommit.php                       24-Apr-2024 08:00                5302
function.odbc-binmode.php                          24-Apr-2024 08:00                7435
function.odbc-close-all.php                        24-Apr-2024 08:00                2614
function.odbc-close.php                            24-Apr-2024 08:00                2936
function.odbc-columnprivileges.php                 24-Apr-2024 08:00                8816
function.odbc-columns.php                          24-Apr-2024 08:00               11794
function.odbc-commit.php                           24-Apr-2024 08:00                2762
function.odbc-connect.php                          24-Apr-2024 08:00                8887
function.odbc-connection-string-is-quoted.php      24-Apr-2024 08:00                3734
function.odbc-connection-string-quote.php          24-Apr-2024 08:00                5788
function.odbc-connection-string-should-quote.php   24-Apr-2024 08:00                3998
function.odbc-cursor.php                           24-Apr-2024 08:00                2747
function.odbc-data-source.php                      24-Apr-2024 08:00                5960
function.odbc-do.php                               24-Apr-2024 08:00                1707
function.odbc-error.php                            24-Apr-2024 08:00                4215
function.odbc-errormsg.php                         24-Apr-2024 08:00                4268
function.odbc-exec.php                             24-Apr-2024 08:00                4110
function.odbc-execute.php                          24-Apr-2024 08:00                7123
function.odbc-fetch-array.php                      24-Apr-2024 08:00                4377
function.odbc-fetch-into.php                       24-Apr-2024 08:00                5298
function.odbc-fetch-object.php                     24-Apr-2024 08:00                4383
function.odbc-fetch-row.php                        24-Apr-2024 08:00                4923
function.odbc-field-len.php                        24-Apr-2024 08:00                3506
function.odbc-field-name.php                       24-Apr-2024 08:00                3121
function.odbc-field-num.php                        24-Apr-2024 08:00                3141
function.odbc-field-precision.php                  24-Apr-2024 08:00                2233
function.odbc-field-scale.php                      24-Apr-2024 08:00                3136
function.odbc-field-type.php                       24-Apr-2024 08:00                3121
function.odbc-foreignkeys.php                      24-Apr-2024 08:00                9168
function.odbc-free-result.php                      24-Apr-2024 08:00                3422
function.odbc-gettypeinfo.php                      24-Apr-2024 08:00                4637
function.odbc-longreadlen.php                      24-Apr-2024 08:00                4037
function.odbc-next-result.php                      24-Apr-2024 08:00                9026
function.odbc-num-fields.php                       24-Apr-2024 08:00                2659
function.odbc-num-rows.php                         24-Apr-2024 08:00                3296
function.odbc-pconnect.php                         24-Apr-2024 08:00                4857
function.odbc-prepare.php                          24-Apr-2024 08:00                6479
function.odbc-primarykeys.php                      24-Apr-2024 08:00                7989
function.odbc-procedurecolumns.php                 24-Apr-2024 08:00               12012
function.odbc-procedures.php                       24-Apr-2024 08:00                9772
function.odbc-result-all.php                       24-Apr-2024 08:00                4235
function.odbc-result.php                           24-Apr-2024 08:00                5948
function.odbc-rollback.php                         24-Apr-2024 08:00                2781
function.odbc-setoption.php                        24-Apr-2024 08:00                7221
function.odbc-specialcolumns.php                   24-Apr-2024 08:00                8043
function.odbc-statistics.php                       24-Apr-2024 08:00               10112
function.odbc-tableprivileges.php                  24-Apr-2024 08:00                8387
function.odbc-tables.php                           24-Apr-2024 08:00               12699
function.opcache-compile-file.php                  24-Apr-2024 08:00                3894
function.opcache-get-configuration.php             24-Apr-2024 08:00                3323
function.opcache-get-status.php                    24-Apr-2024 08:00                3870
function.opcache-invalidate.php                    24-Apr-2024 08:00                4421
function.opcache-is-script-cached.php              24-Apr-2024 08:00                3475
function.opcache-reset.php                         24-Apr-2024 08:00                3413
function.openal-buffer-create.php                  24-Apr-2024 08:00                2904
function.openal-buffer-data.php                    24-Apr-2024 08:00                5027
function.openal-buffer-destroy.php                 24-Apr-2024 08:00                3220
function.openal-buffer-get.php                     24-Apr-2024 08:00                4023
function.openal-buffer-loadwav.php                 24-Apr-2024 08:00                3761
function.openal-context-create.php                 24-Apr-2024 08:00                3427
function.openal-context-current.php                24-Apr-2024 08:00                3275
function.openal-context-destroy.php                24-Apr-2024 08:00                3261
function.openal-context-process.php                24-Apr-2024 08:00                3649
function.openal-context-suspend.php                24-Apr-2024 08:00                3643
function.openal-device-close.php                   24-Apr-2024 08:00                3227
function.openal-device-open.php                    24-Apr-2024 08:00                3420
function.openal-listener-get.php                   24-Apr-2024 08:00                3459
function.openal-listener-set.php                   24-Apr-2024 08:00                3858
function.openal-source-create.php                  24-Apr-2024 08:00                3097
function.openal-source-destroy.php                 24-Apr-2024 08:00                3228
function.openal-source-get.php                     24-Apr-2024 08:00                5648
function.openal-source-pause.php                   24-Apr-2024 08:00                3529
function.openal-source-play.php                    24-Apr-2024 08:00                3528
function.openal-source-rewind.php                  24-Apr-2024 08:00                3538
function.openal-source-set.php                     24-Apr-2024 08:00                6387
function.openal-source-stop.php                    24-Apr-2024 08:00                3510
function.openal-stream.php                         24-Apr-2024 08:00                4450
function.opendir.php                               24-Apr-2024 08:00                8003
function.openlog.php                               24-Apr-2024 08:00                9864
function.openssl-cipher-iv-length.php              24-Apr-2024 08:00                4559
function.openssl-cipher-key-length.php             24-Apr-2024 08:00                4470
function.openssl-cms-decrypt.php                   24-Apr-2024 08:00                5558
function.openssl-cms-encrypt.php                   24-Apr-2024 08:00                6731
function.openssl-cms-read.php                      24-Apr-2024 08:00                3308
function.openssl-cms-sign.php                      24-Apr-2024 08:00                8304
function.openssl-cms-verify.php                    24-Apr-2024 08:00                7493
function.openssl-csr-export-to-file.php            24-Apr-2024 08:00                8595
function.openssl-csr-export.php                    24-Apr-2024 08:00                8536
function.openssl-csr-get-public-key.php            24-Apr-2024 08:00                8869
function.openssl-csr-get-subject.php               24-Apr-2024 08:00                9614
function.openssl-csr-new.php                       24-Apr-2024 08:00               22065
function.openssl-csr-sign.php                      24-Apr-2024 08:00               13551
function.openssl-decrypt.php                       24-Apr-2024 08:00                8039
function.openssl-dh-compute-key.php                24-Apr-2024 08:00               16443
function.openssl-digest.php                        24-Apr-2024 08:00                4682
function.openssl-encrypt.php                       24-Apr-2024 08:00               18245
function.openssl-error-string.php                  24-Apr-2024 08:00                3848
function.openssl-free-key.php                      24-Apr-2024 08:00                3799
function.openssl-get-cert-locations.php            24-Apr-2024 08:00                4101
function.openssl-get-cipher-methods.php            24-Apr-2024 08:00               14178
function.openssl-get-curve-names.php               24-Apr-2024 08:00                7214
function.openssl-get-md-methods.php                24-Apr-2024 08:00                7116
function.openssl-get-privatekey.php                24-Apr-2024 08:00                1932
function.openssl-get-publickey.php                 24-Apr-2024 08:00                1903
function.openssl-open.php                          24-Apr-2024 08:00               10252
function.openssl-pbkdf2.php                        24-Apr-2024 08:00                7575
function.openssl-pkcs12-export-to-file.php         24-Apr-2024 08:00                7534
function.openssl-pkcs12-export.php                 24-Apr-2024 08:00                7532
function.openssl-pkcs12-read.php                   24-Apr-2024 08:00                5680
function.openssl-pkcs7-decrypt.php                 24-Apr-2024 08:00                7738
function.openssl-pkcs7-encrypt.php                 24-Apr-2024 08:00               10840
function.openssl-pkcs7-read.php                    24-Apr-2024 08:00                6983
function.openssl-pkcs7-sign.php                    24-Apr-2024 08:00               12114
function.openssl-pkcs7-verify.php                  24-Apr-2024 08:00                8493
function.openssl-pkey-derive.php                   24-Apr-2024 08:00                8163
function.openssl-pkey-export-to-file.php           24-Apr-2024 08:00                6659
function.openssl-pkey-export.php                   24-Apr-2024 08:00                6522
function.openssl-pkey-free.php                     24-Apr-2024 08:00                4031
function.openssl-pkey-get-details.php              24-Apr-2024 08:00                9734
function.openssl-pkey-get-private.php              24-Apr-2024 08:00                6162
function.openssl-pkey-get-public.php               24-Apr-2024 08:00                5577
function.openssl-pkey-new.php                      24-Apr-2024 08:00                7087
function.openssl-private-decrypt.php               24-Apr-2024 08:00                6908
function.openssl-private-encrypt.php               24-Apr-2024 08:00                6601
function.openssl-public-decrypt.php                24-Apr-2024 08:00                6655
function.openssl-public-encrypt.php                24-Apr-2024 08:00                6992
function.openssl-random-pseudo-bytes.php           24-Apr-2024 08:00                9407
function.openssl-seal.php                          24-Apr-2024 08:00               11482
function.openssl-sign.php                          24-Apr-2024 08:00               12824
function.openssl-spki-export-challenge.php         24-Apr-2024 08:00                7646
function.openssl-spki-export.php                   24-Apr-2024 08:00                8455
function.openssl-spki-new.php                      24-Apr-2024 08:00                9249
function.openssl-spki-verify.php                   24-Apr-2024 08:00                7813
function.openssl-verify.php                        24-Apr-2024 08:00               13420
function.openssl-x509-check-private-key.php        24-Apr-2024 08:00                5923
function.openssl-x509-checkpurpose.php             24-Apr-2024 08:00                7541
function.openssl-x509-export-to-file.php           24-Apr-2024 08:00                5188
function.openssl-x509-export.php                   24-Apr-2024 08:00                5150
function.openssl-x509-fingerprint.php              24-Apr-2024 08:00                5462
function.openssl-x509-free.php                     24-Apr-2024 08:00                4056
function.openssl-x509-parse.php                    24-Apr-2024 08:00                4845
function.openssl-x509-read.php                     24-Apr-2024 08:00                4578
function.openssl-x509-verify.php                   24-Apr-2024 08:00               12532
function.ord.php                                   24-Apr-2024 08:00                7201
function.output-add-rewrite-var.php                24-Apr-2024 08:00                9490
function.output-reset-rewrite-vars.php             24-Apr-2024 08:00                6664
function.pack.php                                  24-Apr-2024 08:00               12668
function.parse-ini-file.php                        24-Apr-2024 08:00               20419
function.parse-ini-string.php                      24-Apr-2024 08:00                7609
function.parse-str.php                             24-Apr-2024 08:00               10049
function.parse-url.php                             24-Apr-2024 08:00               16831
function.passthru.php                              24-Apr-2024 08:00                7477
function.password-algos.php                        24-Apr-2024 08:00                3417
function.password-get-info.php                     24-Apr-2024 08:00                3570
function.password-hash.php                         24-Apr-2024 08:00               22669
function.password-needs-rehash.php                 24-Apr-2024 08:00                8126
function.password-verify.php                       24-Apr-2024 08:00                6789
function.pathinfo.php                              24-Apr-2024 08:00               14319
function.pclose.php                                24-Apr-2024 08:00                4859
function.pcntl-alarm.php                           24-Apr-2024 08:00                3005
function.pcntl-async-signals.php                   24-Apr-2024 08:00                4261
function.pcntl-errno.php                           24-Apr-2024 08:00                1795
function.pcntl-exec.php                            24-Apr-2024 08:00                3856
function.pcntl-fork.php                            24-Apr-2024 08:00                5047
function.pcntl-get-last-error.php                  24-Apr-2024 08:00                2795
function.pcntl-getpriority.php                     24-Apr-2024 08:00                5861
function.pcntl-rfork.php                           24-Apr-2024 08:00                7714
function.pcntl-setpriority.php                     24-Apr-2024 08:00                5747
function.pcntl-signal-dispatch.php                 24-Apr-2024 08:00                5685
function.pcntl-signal-get-handler.php              24-Apr-2024 08:00                6825
function.pcntl-signal.php                          24-Apr-2024 08:00               11323
function.pcntl-sigprocmask.php                     24-Apr-2024 08:00                6143
function.pcntl-sigtimedwait.php                    24-Apr-2024 08:00                5196
function.pcntl-sigwaitinfo.php                     24-Apr-2024 08:00                7555
function.pcntl-strerror.php                        24-Apr-2024 08:00                3003
function.pcntl-unshare.php                         24-Apr-2024 08:00                4667
function.pcntl-wait.php                            24-Apr-2024 08:00                8117
function.pcntl-waitpid.php                         24-Apr-2024 08:00                9564
function.pcntl-wexitstatus.php                     24-Apr-2024 08:00                3808
function.pcntl-wifexited.php                       24-Apr-2024 08:00                3530
function.pcntl-wifsignaled.php                     24-Apr-2024 08:00                3582
function.pcntl-wifstopped.php                      24-Apr-2024 08:00                3652
function.pcntl-wstopsig.php                        24-Apr-2024 08:00                3813
function.pcntl-wtermsig.php                        24-Apr-2024 08:00                3988
function.pfsockopen.php                            24-Apr-2024 08:00                5724
function.pg-affected-rows.php                      24-Apr-2024 08:00                6839
function.pg-cancel-query.php                       24-Apr-2024 08:00                7499
function.pg-client-encoding.php                    24-Apr-2024 08:00                6888
function.pg-close.php                              24-Apr-2024 08:00                6978
function.pg-connect-poll.php                       24-Apr-2024 08:00                4181
function.pg-connect.php                            24-Apr-2024 08:00               11089
function.pg-connection-busy.php                    24-Apr-2024 08:00                5801
function.pg-connection-reset.php                   24-Apr-2024 08:00                5790
function.pg-connection-status.php                  24-Apr-2024 08:00                5615
function.pg-consume-input.php                      24-Apr-2024 08:00                3721
function.pg-convert.php                            24-Apr-2024 08:00                9907
function.pg-copy-from.php                          24-Apr-2024 08:00                8164
function.pg-copy-to.php                            24-Apr-2024 08:00                7519
function.pg-dbname.php                             24-Apr-2024 08:00                5421
function.pg-delete.php                             24-Apr-2024 08:00                9889
function.pg-end-copy.php                           24-Apr-2024 08:00                7416
function.pg-escape-bytea.php                       24-Apr-2024 08:00                7879
function.pg-escape-identifier.php                  24-Apr-2024 08:00                7873
function.pg-escape-literal.php                     24-Apr-2024 08:00                8238
function.pg-escape-string.php                      24-Apr-2024 08:00                7753
function.pg-execute.php                            24-Apr-2024 08:00               10411
function.pg-fetch-all-columns.php                  24-Apr-2024 08:00                7134
function.pg-fetch-all.php                          24-Apr-2024 08:00                9344
function.pg-fetch-array.php                        24-Apr-2024 08:00               12910
function.pg-fetch-assoc.php                        24-Apr-2024 08:00                9530
function.pg-fetch-object.php                       24-Apr-2024 08:00               11928
function.pg-fetch-result.php                       24-Apr-2024 08:00                9439
function.pg-fetch-row.php                          24-Apr-2024 08:00               10022
function.pg-field-is-null.php                      24-Apr-2024 08:00                8576
function.pg-field-name.php                         24-Apr-2024 08:00                9010
function.pg-field-num.php                          24-Apr-2024 08:00                6600
function.pg-field-prtlen.php                       24-Apr-2024 08:00               10937
function.pg-field-size.php                         24-Apr-2024 08:00                9240
function.pg-field-table.php                        24-Apr-2024 08:00                8741
function.pg-field-type-oid.php                     24-Apr-2024 08:00                7514
function.pg-field-type.php                         24-Apr-2024 08:00                7306
function.pg-flush.php                              24-Apr-2024 08:00                3723
function.pg-free-result.php                        24-Apr-2024 08:00                7380
function.pg-get-notify.php                         24-Apr-2024 08:00                7642
function.pg-get-pid.php                            24-Apr-2024 08:00                5173
function.pg-get-result.php                         24-Apr-2024 08:00                8730
function.pg-host.php                               24-Apr-2024 08:00                6430
function.pg-insert.php                             24-Apr-2024 08:00               11802
function.pg-last-error.php                         24-Apr-2024 08:00                7487
function.pg-last-notice.php                        24-Apr-2024 08:00                8472
function.pg-last-oid.php                           24-Apr-2024 08:00                7639
function.pg-lo-close.php                           24-Apr-2024 08:00                7191
function.pg-lo-create.php                          24-Apr-2024 08:00                8701
function.pg-lo-export.php                          24-Apr-2024 08:00                8252
function.pg-lo-import.php                          24-Apr-2024 08:00                7501
function.pg-lo-open.php                            24-Apr-2024 08:00                9072
function.pg-lo-read-all.php                        24-Apr-2024 08:00                6426
function.pg-lo-read.php                            24-Apr-2024 08:00                7199
function.pg-lo-seek.php                            24-Apr-2024 08:00                7999
function.pg-lo-tell.php                            24-Apr-2024 08:00                6966
function.pg-lo-truncate.php                        24-Apr-2024 08:00                6684
function.pg-lo-unlink.php                          24-Apr-2024 08:00                7232
function.pg-lo-write.php                           24-Apr-2024 08:00                8296
function.pg-meta-data.php                          24-Apr-2024 08:00                7605
function.pg-num-fields.php                         24-Apr-2024 08:00                6028
function.pg-num-rows.php                           24-Apr-2024 08:00                6001
function.pg-options.php                            24-Apr-2024 08:00                5759
function.pg-parameter-status.php                   24-Apr-2024 08:00                8546
function.pg-pconnect.php                           24-Apr-2024 08:00                9794
function.pg-ping.php                               24-Apr-2024 08:00                6156
function.pg-port.php                               24-Apr-2024 08:00                5936
function.pg-prepare.php                            24-Apr-2024 08:00               10373
function.pg-put-line.php                           24-Apr-2024 08:00                8768
function.pg-query-params.php                       24-Apr-2024 08:00               10858
function.pg-query.php                              24-Apr-2024 08:00               12326
function.pg-result-error-field.php                 24-Apr-2024 08:00                9771
function.pg-result-error.php                       24-Apr-2024 08:00                8171
function.pg-result-seek.php                        24-Apr-2024 08:00                7350
function.pg-result-status.php                      24-Apr-2024 08:00                8743
function.pg-select.php                             24-Apr-2024 08:00               12294
function.pg-send-execute.php                       24-Apr-2024 08:00               10477
function.pg-send-prepare.php                       24-Apr-2024 08:00               10925
function.pg-send-query-params.php                  24-Apr-2024 08:00                8154
function.pg-send-query.php                         24-Apr-2024 08:00                9863
function.pg-set-client-encoding.php                24-Apr-2024 08:00                8877
function.pg-set-error-context-visibility.php       24-Apr-2024 08:00                7067
function.pg-set-error-verbosity.php                24-Apr-2024 08:00                9027
function.pg-socket.php                             24-Apr-2024 08:00                3859
function.pg-trace.php                              24-Apr-2024 08:00                9266
function.pg-transaction-status.php                 24-Apr-2024 08:00                6702
function.pg-tty.php                                24-Apr-2024 08:00                6223
function.pg-unescape-bytea.php                     24-Apr-2024 08:00                6342
function.pg-untrace.php                            24-Apr-2024 08:00                6852
function.pg-update.php                             24-Apr-2024 08:00               10855
function.pg-version.php                            24-Apr-2024 08:00                6610
function.php-ini-loaded-file.php                   24-Apr-2024 08:00                4647
function.php-ini-scanned-files.php                 24-Apr-2024 08:00                6286
function.php-sapi-name.php                         24-Apr-2024 08:00                5921
function.php-strip-whitespace.php                  24-Apr-2024 08:00                4722
function.php-uname.php                             24-Apr-2024 08:00                9080
function.phpcredits.php                            24-Apr-2024 08:00                8256
function.phpdbg-break-file.php                     24-Apr-2024 08:00                3766
function.phpdbg-break-function.php                 24-Apr-2024 08:00                3502
function.phpdbg-break-method.php                   24-Apr-2024 08:00                3836
function.phpdbg-break-next.php                     24-Apr-2024 08:00                3139
function.phpdbg-clear.php                          24-Apr-2024 08:00                3399
function.phpdbg-color.php                          24-Apr-2024 08:00                3702
function.phpdbg-end-oplog.php                      24-Apr-2024 08:00                2654
function.phpdbg-exec.php                           24-Apr-2024 08:00                3144
function.phpdbg-get-executable.php                 24-Apr-2024 08:00                2597
function.phpdbg-prompt.php                         24-Apr-2024 08:00                2845
function.phpdbg-start-oplog.php                    24-Apr-2024 08:00                2295
function.phpinfo.php                               24-Apr-2024 08:00                9365
function.phpversion.php                            24-Apr-2024 08:00               10826
function.pi.php                                    24-Apr-2024 08:00                3063
function.png2wbmp.php                              24-Apr-2024 08:00                6676
function.popen.php                                 24-Apr-2024 08:00                8462
function.pos.php                                   24-Apr-2024 08:00                1639
function.posix-access.php                          24-Apr-2024 08:00                6658
function.posix-ctermid.php                         24-Apr-2024 08:00                4502
function.posix-eaccess.php                         24-Apr-2024 08:00                7447
function.posix-errno.php                           24-Apr-2024 08:00                1801
function.posix-fpathconf.php                       24-Apr-2024 08:00                6936
function.posix-get-last-error.php                  24-Apr-2024 08:00                4195
function.posix-getcwd.php                          24-Apr-2024 08:00                4326
function.posix-getegid.php                         24-Apr-2024 08:00                5259
function.posix-geteuid.php                         24-Apr-2024 08:00                5250
function.posix-getgid.php                          24-Apr-2024 08:00                4690
function.posix-getgrgid.php                        24-Apr-2024 08:00                6507
function.posix-getgrnam.php                        24-Apr-2024 08:00                6453
function.posix-getgroups.php                       24-Apr-2024 08:00                4193
function.posix-getlogin.php                        24-Apr-2024 08:00                3650
function.posix-getpgid.php                         24-Apr-2024 08:00                4669
function.posix-getpgrp.php                         24-Apr-2024 08:00                2611
function.posix-getpid.php                          24-Apr-2024 08:00                3366
function.posix-getppid.php                         24-Apr-2024 08:00                3024
function.posix-getpwnam.php                        24-Apr-2024 08:00                6850
function.posix-getpwuid.php                        24-Apr-2024 08:00                6849
function.posix-getrlimit.php                       24-Apr-2024 08:00                8476
function.posix-getsid.php                          24-Apr-2024 08:00                4792
function.posix-getuid.php                          24-Apr-2024 08:00                3402
function.posix-initgroups.php                      24-Apr-2024 08:00                3322
function.posix-isatty.php                          24-Apr-2024 08:00                4531
function.posix-kill.php                            24-Apr-2024 08:00                3503
function.posix-mkfifo.php                          24-Apr-2024 08:00                3573
function.posix-mknod.php                           24-Apr-2024 08:00                7485
function.posix-pathconf.php                        24-Apr-2024 08:00                6297
function.posix-setegid.php                         24-Apr-2024 08:00                5142
function.posix-seteuid.php                         24-Apr-2024 08:00                3552
function.posix-setgid.php                          24-Apr-2024 08:00                5354
function.posix-setpgid.php                         24-Apr-2024 08:00                3424
function.posix-setrlimit.php                       24-Apr-2024 08:00                4623
function.posix-setsid.php                          24-Apr-2024 08:00                2537
function.posix-setuid.php                          24-Apr-2024 08:00                5502
function.posix-strerror.php                        24-Apr-2024 08:00                4850
function.posix-sysconf.php                         24-Apr-2024 08:00                4068
function.posix-times.php                           24-Apr-2024 08:00                4702
function.posix-ttyname.php                         24-Apr-2024 08:00                5372
function.posix-uname.php                           24-Apr-2024 08:00                4846
function.pow.php                                   24-Apr-2024 08:00                6782
function.preg-filter.php                           24-Apr-2024 08:00               10246
function.preg-grep.php                             24-Apr-2024 08:00                5987
function.preg-last-error-msg.php                   24-Apr-2024 08:00                4076
function.preg-last-error.php                       24-Apr-2024 08:00                5142
function.preg-match-all.php                        24-Apr-2024 08:00               25491
function.preg-match.php                            24-Apr-2024 08:00               23495
function.preg-quote.php                            24-Apr-2024 08:00                8551
function.preg-replace-callback-array.php           24-Apr-2024 08:00               10524
function.preg-replace-callback.php                 24-Apr-2024 08:00               17378
function.preg-replace.php                          24-Apr-2024 08:00               24515
function.preg-split.php                            24-Apr-2024 08:00               12703
function.prev.php                                  24-Apr-2024 08:00                9254
function.print-r.php                               24-Apr-2024 08:00                9324
function.print.php                                 24-Apr-2024 08:00               12524
function.printf.php                                24-Apr-2024 08:00               28134
function.proc-close.php                            24-Apr-2024 08:00                3712
function.proc-get-status.php                       24-Apr-2024 08:00                6841
function.proc-nice.php                             24-Apr-2024 08:00                7727
function.proc-open.php                             24-Apr-2024 08:00               22357
function.proc-terminate.php                        24-Apr-2024 08:00                4778
function.property-exists.php                       24-Apr-2024 08:00                8569
function.ps-add-bookmark.php                       24-Apr-2024 08:00                5140
function.ps-add-launchlink.php                     24-Apr-2024 08:00                5839
function.ps-add-locallink.php                      24-Apr-2024 08:00                6623
function.ps-add-note.php                           24-Apr-2024 08:00                7349
function.ps-add-pdflink.php                        24-Apr-2024 08:00                6996
function.ps-add-weblink.php                        24-Apr-2024 08:00                5925
function.ps-arc.php                                24-Apr-2024 08:00                5343
function.ps-arcn.php                               24-Apr-2024 08:00                5349
function.ps-begin-page.php                         24-Apr-2024 08:00                7004
function.ps-begin-pattern.php                      24-Apr-2024 08:00               13440
function.ps-begin-template.php                     24-Apr-2024 08:00               11422
function.ps-circle.php                             24-Apr-2024 08:00                4862
function.ps-clip.php                               24-Apr-2024 08:00                3141
function.ps-close-image.php                        24-Apr-2024 08:00                4038
function.ps-close.php                              24-Apr-2024 08:00                3779
function.ps-closepath-stroke.php                   24-Apr-2024 08:00                3214
function.ps-closepath.php                          24-Apr-2024 08:00                3375
function.ps-continue-text.php                      24-Apr-2024 08:00                4187
function.ps-curveto.php                            24-Apr-2024 08:00                5218
function.ps-delete.php                             24-Apr-2024 08:00                3658
function.ps-end-page.php                           24-Apr-2024 08:00                3384
function.ps-end-pattern.php                        24-Apr-2024 08:00                3315
function.ps-end-template.php                       24-Apr-2024 08:00                3322
function.ps-fill-stroke.php                        24-Apr-2024 08:00                3420
function.ps-fill.php                               24-Apr-2024 08:00                3353
function.ps-findfont.php                           24-Apr-2024 08:00                7244
function.ps-get-buffer.php                         24-Apr-2024 08:00                3284
function.ps-get-parameter.php                      24-Apr-2024 08:00                8006
function.ps-get-value.php                          24-Apr-2024 08:00                9527
function.ps-hyphenate.php                          24-Apr-2024 08:00                7386
function.ps-include-file.php                       24-Apr-2024 08:00                3223
function.ps-lineto.php                             24-Apr-2024 08:00                8338
function.ps-makespotcolor.php                      24-Apr-2024 08:00               10262
function.ps-moveto.php                             24-Apr-2024 08:00                3952
function.ps-new.php                                24-Apr-2024 08:00                3075
function.ps-open-file.php                          24-Apr-2024 08:00                3793
function.ps-open-image-file.php                    24-Apr-2024 08:00                5019
function.ps-open-image.php                         24-Apr-2024 08:00                7106
function.ps-open-memory-image.php                  24-Apr-2024 08:00                2916
function.ps-place-image.php                        24-Apr-2024 08:00                5353
function.ps-rect.php                               24-Apr-2024 08:00                5073
function.ps-restore.php                            24-Apr-2024 08:00                3497
function.ps-rotate.php                             24-Apr-2024 08:00               12209
function.ps-save.php                               24-Apr-2024 08:00                3244
function.ps-scale.php                              24-Apr-2024 08:00                3861
function.ps-set-border-color.php                   24-Apr-2024 08:00                4979
function.ps-set-border-dash.php                    24-Apr-2024 08:00                4567
function.ps-set-border-style.php                   24-Apr-2024 08:00                4631
function.ps-set-info.php                           24-Apr-2024 08:00                6103
function.ps-set-parameter.php                      24-Apr-2024 08:00                4041
function.ps-set-text-pos.php                       24-Apr-2024 08:00                9415
function.ps-set-value.php                          24-Apr-2024 08:00                4853
function.ps-setcolor.php                           24-Apr-2024 08:00                6058
function.ps-setdash.php                            24-Apr-2024 08:00                3748
function.ps-setflat.php                            24-Apr-2024 08:00                3210
function.ps-setfont.php                            24-Apr-2024 08:00                4166
function.ps-setgray.php                            24-Apr-2024 08:00                3421
function.ps-setlinecap.php                         24-Apr-2024 08:00                3947
function.ps-setlinejoin.php                        24-Apr-2024 08:00                3965
function.ps-setlinewidth.php                       24-Apr-2024 08:00                3829
function.ps-setmiterlimit.php                      24-Apr-2024 08:00                4249
function.ps-setoverprintmode.php                   24-Apr-2024 08:00                3247
function.ps-setpolydash.php                        24-Apr-2024 08:00                7834
function.ps-shading-pattern.php                    24-Apr-2024 08:00                4357
function.ps-shading.php                            24-Apr-2024 08:00                7292
function.ps-shfill.php                             24-Apr-2024 08:00                4070
function.ps-show-boxed.php                         24-Apr-2024 08:00               12847
function.ps-show-xy.php                            24-Apr-2024 08:00                4349
function.ps-show-xy2.php                           24-Apr-2024 08:00                3220
function.ps-show.php                               24-Apr-2024 08:00                5854
function.ps-show2.php                              24-Apr-2024 08:00                3418
function.ps-string-geometry.php                    24-Apr-2024 08:00                4966
function.ps-stringwidth.php                        24-Apr-2024 08:00                4443
function.ps-stroke.php                             24-Apr-2024 08:00                3550
function.ps-symbol-name.php                        24-Apr-2024 08:00                3971
function.ps-symbol-width.php                       24-Apr-2024 08:00                4515
function.ps-symbol.php                             24-Apr-2024 08:00                3816
function.ps-translate.php                          24-Apr-2024 08:00               14228
function.pspell-add-to-personal.php                24-Apr-2024 08:00                6466
function.pspell-add-to-session.php                 24-Apr-2024 08:00                4120
function.pspell-check.php                          24-Apr-2024 08:00                5051
function.pspell-clear-session.php                  24-Apr-2024 08:00                5878
function.pspell-config-create.php                  24-Apr-2024 08:00                8063
function.pspell-config-data-dir.php                24-Apr-2024 08:00                3426
function.pspell-config-dict-dir.php                24-Apr-2024 08:00                3425
function.pspell-config-ignore.php                  24-Apr-2024 08:00                5762
function.pspell-config-mode.php                    24-Apr-2024 08:00                6606
function.pspell-config-personal.php                24-Apr-2024 08:00                6549
function.pspell-config-repl.php                    24-Apr-2024 08:00                6852
function.pspell-config-runtogether.php             24-Apr-2024 08:00                6415
function.pspell-config-save-repl.php               24-Apr-2024 08:00                5353
function.pspell-new-config.php                     24-Apr-2024 08:00                6400
function.pspell-new-personal.php                   24-Apr-2024 08:00               10996
function.pspell-new.php                            24-Apr-2024 08:00                9529
function.pspell-save-wordlist.php                  24-Apr-2024 08:00                6071
function.pspell-store-replacement.php              24-Apr-2024 08:00                7746
function.pspell-suggest.php                        24-Apr-2024 08:00                5587
function.putenv.php                                24-Apr-2024 08:00                4105
function.quoted-printable-decode.php               24-Apr-2024 08:00                5155
function.quoted-printable-encode.php               24-Apr-2024 08:00                5091
function.quotemeta.php                             24-Apr-2024 08:00                5697
function.rad2deg.php                               24-Apr-2024 08:00                3609
function.radius-acct-open.php                      24-Apr-2024 08:00                3260
function.radius-add-server.php                     24-Apr-2024 08:00                7807
function.radius-auth-open.php                      24-Apr-2024 08:00                3270
function.radius-close.php                          24-Apr-2024 08:00                2697
function.radius-config.php                         24-Apr-2024 08:00                4110
function.radius-create-request.php                 24-Apr-2024 08:00                5358
function.radius-cvt-addr.php                       24-Apr-2024 08:00                6236
function.radius-cvt-int.php                        24-Apr-2024 08:00                5636
function.radius-cvt-string.php                     24-Apr-2024 08:00                5690
function.radius-demangle-mppe-key.php              24-Apr-2024 08:00                3273
function.radius-demangle.php                       24-Apr-2024 08:00                3004
function.radius-get-attr.php                       24-Apr-2024 08:00                6490
function.radius-get-tagged-attr-data.php           24-Apr-2024 08:00                6577
function.radius-get-tagged-attr-tag.php            24-Apr-2024 08:00                6630
function.radius-get-vendor-attr.php                24-Apr-2024 08:00                8231
function.radius-put-addr.php                       24-Apr-2024 08:00                5644
function.radius-put-attr.php                       24-Apr-2024 08:00                8876
function.radius-put-int.php                        24-Apr-2024 08:00                7613
function.radius-put-string.php                     24-Apr-2024 08:00                7993
function.radius-put-vendor-addr.php                24-Apr-2024 08:00                5593
function.radius-put-vendor-attr.php                24-Apr-2024 08:00                7855
function.radius-put-vendor-int.php                 24-Apr-2024 08:00                6367
function.radius-put-vendor-string.php              24-Apr-2024 08:00                6760
function.radius-request-authenticator.php          24-Apr-2024 08:00                3197
function.radius-salt-encrypt-attr.php              24-Apr-2024 08:00                4284
function.radius-send-request.php                   24-Apr-2024 08:00                4037
function.radius-server-secret.php                  24-Apr-2024 08:00                2732
function.radius-strerror.php                       24-Apr-2024 08:00                2625
function.rand.php                                  24-Apr-2024 08:00               10273
function.random-bytes.php                          24-Apr-2024 08:00                9588
function.random-int.php                            24-Apr-2024 08:00                9471
function.range.php                                 24-Apr-2024 08:00               16970
function.rar-wrapper-cache-stats.php               24-Apr-2024 08:00                2372
function.rawurldecode.php                          24-Apr-2024 08:00                4616
function.rawurlencode.php                          24-Apr-2024 08:00                6246
function.read-exif-data.php                        24-Apr-2024 08:00                2477
function.readdir.php                               24-Apr-2024 08:00               10339
function.readfile.php                              24-Apr-2024 08:00                9936
function.readgzfile.php                            24-Apr-2024 08:00                4563
function.readline-add-history.php                  24-Apr-2024 08:00                2810
function.readline-callback-handler-install.php     24-Apr-2024 08:00                9449
function.readline-callback-handler-remove.php      24-Apr-2024 08:00                3917
function.readline-callback-read-char.php           24-Apr-2024 08:00                3832
function.readline-clear-history.php                24-Apr-2024 08:00                2531
function.readline-completion-function.php          24-Apr-2024 08:00                3077
function.readline-info.php                         24-Apr-2024 08:00                4946
function.readline-list-history.php                 24-Apr-2024 08:00                2365
function.readline-on-new-line.php                  24-Apr-2024 08:00                2693
function.readline-read-history.php                 24-Apr-2024 08:00                3509
function.readline-redisplay.php                    24-Apr-2024 08:00                2270
function.readline-write-history.php                24-Apr-2024 08:00                3465
function.readline.php                              24-Apr-2024 08:00                5178
function.readlink.php                              24-Apr-2024 08:00                4501
function.realpath-cache-get.php                    24-Apr-2024 08:00                4229
function.realpath-cache-size.php                   24-Apr-2024 08:00                3701
function.realpath.php                              24-Apr-2024 08:00                8534
function.recode-file.php                           24-Apr-2024 08:00                5882
function.recode-string.php                         24-Apr-2024 08:00                5193
function.recode.php                                24-Apr-2024 08:00                1744
function.register-shutdown-function.php            24-Apr-2024 08:00                7572
function.register-tick-function.php                24-Apr-2024 08:00                5460
function.rename.php                                24-Apr-2024 08:00                5966
function.require-once.php                          24-Apr-2024 08:00                1827
function.require.php                               24-Apr-2024 08:00                1997
function.reset.php                                 24-Apr-2024 08:00                9743
function.restore-error-handler.php                 24-Apr-2024 08:00                5772
function.restore-exception-handler.php             24-Apr-2024 08:00                6558
function.restore-include-path.php                  24-Apr-2024 08:00                5225
function.return.php                                24-Apr-2024 08:00                4317
function.rewind.php                                24-Apr-2024 08:00                6331
function.rewinddir.php                             24-Apr-2024 08:00                3592
function.rmdir.php                                 24-Apr-2024 08:00                5219
function.rnp-backend-string.php                    24-Apr-2024 08:00                2269
function.rnp-backend-version.php                   24-Apr-2024 08:00                2202
function.rnp-decrypt.php                           24-Apr-2024 08:00                3242
function.rnp-dump-packets-to-json.php              24-Apr-2024 08:00                3156
function.rnp-dump-packets.php                      24-Apr-2024 08:00                3110
function.rnp-ffi-create.php                        24-Apr-2024 08:00                3205
function.rnp-ffi-destroy.php                       24-Apr-2024 08:00                2452
function.rnp-ffi-set-pass-provider.php             24-Apr-2024 08:00                6728
function.rnp-import-keys.php                       24-Apr-2024 08:00                3494
function.rnp-import-signatures.php                 24-Apr-2024 08:00                3484
function.rnp-key-export-autocrypt.php              24-Apr-2024 08:00                4545
function.rnp-key-export-revocation.php             24-Apr-2024 08:00                5195
function.rnp-key-export.php                        24-Apr-2024 08:00                3464
function.rnp-key-get-info.php                      24-Apr-2024 08:00                7982
function.rnp-key-remove.php                        24-Apr-2024 08:00                3604
function.rnp-key-revoke.php                        24-Apr-2024 08:00                4841
function.rnp-list-keys.php                         24-Apr-2024 08:00                3147
function.rnp-load-keys-from-path.php               24-Apr-2024 08:00                3843
function.rnp-load-keys.php                         24-Apr-2024 08:00                3799
function.rnp-locate-key.php                        24-Apr-2024 08:00                3567
function.rnp-op-encrypt.php                        24-Apr-2024 08:00                7934
function.rnp-op-generate-key.php                   24-Apr-2024 08:00                7553
function.rnp-op-sign-cleartext.php                 24-Apr-2024 08:00                5203
function.rnp-op-sign-detached.php                  24-Apr-2024 08:00                5082
function.rnp-op-sign.php                           24-Apr-2024 08:00                6163
function.rnp-op-verify-detached.php                24-Apr-2024 08:00                7092
function.rnp-op-verify.php                         24-Apr-2024 08:00                6831
function.rnp-save-keys-to-path.php                 24-Apr-2024 08:00                3857
function.rnp-save-keys.php                         24-Apr-2024 08:00                3830
function.rnp-supported-features.php                24-Apr-2024 08:00                2924
function.rnp-version-string-full.php               24-Apr-2024 08:00                2287
function.rnp-version-string.php                    24-Apr-2024 08:00                2184
function.round.php                                 24-Apr-2024 08:00               23950
function.rpmaddtag.php                             24-Apr-2024 08:00                3326
function.rpmdbinfo.php                             24-Apr-2024 08:00                5227
function.rpmdbsearch.php                           24-Apr-2024 08:00                6127
function.rpmgetsymlink.php                         24-Apr-2024 08:00                2979
function.rpminfo.php                               24-Apr-2024 08:00                5409
function.rpmvercmp.php                             24-Apr-2024 08:00                4904
function.rrd-create.php                            24-Apr-2024 08:00                2951
function.rrd-error.php                             24-Apr-2024 08:00                2114
function.rrd-fetch.php                             24-Apr-2024 08:00                2957
function.rrd-first.php                             24-Apr-2024 08:00                2928
function.rrd-graph.php                             24-Apr-2024 08:00                3180
function.rrd-info.php                              24-Apr-2024 08:00                2513
function.rrd-last.php                              24-Apr-2024 08:00                2470
function.rrd-lastupdate.php                        24-Apr-2024 08:00                2643
function.rrd-restore.php                           24-Apr-2024 08:00                3337
function.rrd-tune.php                              24-Apr-2024 08:00                3019
function.rrd-update.php                            24-Apr-2024 08:00                3092
function.rrd-version.php                           24-Apr-2024 08:00                2208
function.rrd-xport.php                             24-Apr-2024 08:00                2687
function.rrdc-disconnect.php                       24-Apr-2024 08:00                2558
function.rsort.php                                 24-Apr-2024 08:00                9115
function.rtrim.php                                 24-Apr-2024 08:00                9614
function.runkit7-constant-add.php                  24-Apr-2024 08:00                4423
function.runkit7-constant-redefine.php             24-Apr-2024 08:00                4314
function.runkit7-constant-remove.php               24-Apr-2024 08:00                3630
function.runkit7-function-add.php                  24-Apr-2024 08:00                9726
function.runkit7-function-copy.php                 24-Apr-2024 08:00                5493
function.runkit7-function-redefine.php             24-Apr-2024 08:00               10122
function.runkit7-function-remove.php               24-Apr-2024 08:00                4075
function.runkit7-function-rename.php               24-Apr-2024 08:00                4352
function.runkit7-import.php                        24-Apr-2024 08:00                3830
function.runkit7-method-add.php                    24-Apr-2024 08:00               11752
function.runkit7-method-copy.php                   24-Apr-2024 08:00                7066
function.runkit7-method-redefine.php               24-Apr-2024 08:00               12188
function.runkit7-method-remove.php                 24-Apr-2024 08:00                6423
function.runkit7-method-rename.php                 24-Apr-2024 08:00                6585
function.runkit7-object-id.php                     24-Apr-2024 08:00                3760
function.runkit7-superglobals.php                  24-Apr-2024 08:00                2639
function.runkit7-zval-inspect.php                  24-Apr-2024 08:00                5113
function.sapi-windows-cp-conv.php                  24-Apr-2024 08:00                4742
function.sapi-windows-cp-get.php                   24-Apr-2024 08:00                3465
function.sapi-windows-cp-is-utf8.php               24-Apr-2024 08:00                2743
function.sapi-windows-cp-set.php                   24-Apr-2024 08:00                3066
function.sapi-windows-generate-ctrl-event.php      24-Apr-2024 08:00                7765
function.sapi-windows-set-ctrl-handler.php         24-Apr-2024 08:00                7574
function.sapi-windows-vt100-support.php            24-Apr-2024 08:00               11185
function.scandir.php                               24-Apr-2024 08:00                9016
function.scoutapm-get-calls.php                    24-Apr-2024 08:00                4467
function.scoutapm-list-instrumented-functions.php  24-Apr-2024 08:00                3804
function.seaslog-get-author.php                    24-Apr-2024 08:00                3124
function.seaslog-get-version.php                   24-Apr-2024 08:00                3122
function.sem-acquire.php                           24-Apr-2024 08:00                5280
function.sem-get.php                               24-Apr-2024 08:00                7140
function.sem-release.php                           24-Apr-2024 08:00                4294
function.sem-remove.php                            24-Apr-2024 08:00                4260
function.serialize.php                             24-Apr-2024 08:00               10626
function.session-abort.php                         24-Apr-2024 08:00                4172
function.session-cache-expire.php                  24-Apr-2024 08:00                7515
function.session-cache-limiter.php                 24-Apr-2024 08:00                8979
function.session-commit.php                        24-Apr-2024 08:00                1846
function.session-create-id.php                     24-Apr-2024 08:00                9864
function.session-decode.php                        24-Apr-2024 08:00                3774
function.session-destroy.php                       24-Apr-2024 08:00                8741
function.session-encode.php                        24-Apr-2024 08:00                3896
function.session-gc.php                            24-Apr-2024 08:00                7606
function.session-get-cookie-params.php             24-Apr-2024 08:00                5510
function.session-id.php                            24-Apr-2024 08:00                6089
function.session-module-name.php                   24-Apr-2024 08:00                4384
function.session-name.php                          24-Apr-2024 08:00                7651
function.session-regenerate-id.php                 24-Apr-2024 08:00               15620
function.session-register-shutdown.php             24-Apr-2024 08:00                2753
function.session-reset.php                         24-Apr-2024 08:00                4259
function.session-save-path.php                     24-Apr-2024 08:00                4726
function.session-set-cookie-params.php             24-Apr-2024 08:00               10817
function.session-set-save-handler.php              24-Apr-2024 08:00               23629
function.session-start.php                         24-Apr-2024 08:00               14292
function.session-status.php                        24-Apr-2024 08:00                3280
function.session-unset.php                         24-Apr-2024 08:00                4892
function.session-write-close.php                   24-Apr-2024 08:00                4090
function.set-error-handler.php                     24-Apr-2024 08:00               26067
function.set-exception-handler.php                 24-Apr-2024 08:00                6973
function.set-file-buffer.php                       24-Apr-2024 08:00                1811
function.set-include-path.php                      24-Apr-2024 08:00                6266
function.set-time-limit.php                        24-Apr-2024 08:00                4678
function.setcookie.php                             24-Apr-2024 08:00               26721
function.setlocale.php                             24-Apr-2024 08:00               15114
function.setrawcookie.php                          24-Apr-2024 08:00                6337
function.settype.php                               24-Apr-2024 08:00                6378
function.sha1-file.php                             24-Apr-2024 08:00                5704
function.sha1.php                                  24-Apr-2024 08:00                5864
function.shell-exec.php                            24-Apr-2024 08:00                5791
function.shm-attach.php                            24-Apr-2024 08:00                6011
function.shm-detach.php                            24-Apr-2024 08:00                4521
function.shm-get-var.php                           24-Apr-2024 08:00                4363
function.shm-has-var.php                           24-Apr-2024 08:00                4386
function.shm-put-var.php                           24-Apr-2024 08:00                5426
function.shm-remove-var.php                        24-Apr-2024 08:00                4264
function.shm-remove.php                            24-Apr-2024 08:00                3991
function.shmop-close.php                           24-Apr-2024 08:00                4843
function.shmop-delete.php                          24-Apr-2024 08:00                4249
function.shmop-open.php                            24-Apr-2024 08:00                9536
function.shmop-read.php                            24-Apr-2024 08:00                6716
function.shmop-size.php                            24-Apr-2024 08:00                4277
function.shmop-write.php                           24-Apr-2024 08:00                6197
function.show-source.php                           24-Apr-2024 08:00                1768
function.shuffle.php                               24-Apr-2024 08:00                7099
function.simdjson-decode.php                       24-Apr-2024 08:00               16997
function.simdjson-is-valid.php                     24-Apr-2024 08:00               10468
function.simdjson-key-count.php                    24-Apr-2024 08:00                4820
function.simdjson-key-exists.php                   24-Apr-2024 08:00                4615
function.simdjson-key-value.php                    24-Apr-2024 08:00                7363
function.similar-text.php                          24-Apr-2024 08:00                7320
function.simplexml-import-dom.php                  24-Apr-2024 08:00                6377
function.simplexml-load-file.php                   24-Apr-2024 08:00               10202
function.simplexml-load-string.php                 24-Apr-2024 08:00                9940
function.sin.php                                   24-Apr-2024 08:00                4545
function.sinh.php                                  24-Apr-2024 08:00                3188
function.sizeof.php                                24-Apr-2024 08:00                1659
function.sleep.php                                 24-Apr-2024 08:00                7205
function.snmp-get-quick-print.php                  24-Apr-2024 08:00                3701
function.snmp-get-valueretrieval.php               24-Apr-2024 08:00                4447
function.snmp-read-mib.php                         24-Apr-2024 08:00                4880
function.snmp-set-enum-print.php                   24-Apr-2024 08:00                5374
function.snmp-set-oid-numeric-print.php            24-Apr-2024 08:00                2341
function.snmp-set-oid-output-format.php            24-Apr-2024 08:00                7804
function.snmp-set-quick-print.php                  24-Apr-2024 08:00                7226
function.snmp-set-valueretrieval.php               24-Apr-2024 08:00                9509
function.snmp2-get.php                             24-Apr-2024 08:00                5806
function.snmp2-getnext.php                         24-Apr-2024 08:00                6174
function.snmp2-real-walk.php                       24-Apr-2024 08:00                6613
function.snmp2-set.php                             24-Apr-2024 08:00               10973
function.snmp2-walk.php                            24-Apr-2024 08:00                7098
function.snmp3-get.php                             24-Apr-2024 08:00                8902
function.snmp3-getnext.php                         24-Apr-2024 08:00                9230
function.snmp3-real-walk.php                       24-Apr-2024 08:00                9915
function.snmp3-set.php                             24-Apr-2024 08:00               13752
function.snmp3-walk.php                            24-Apr-2024 08:00               10375
function.snmpget.php                               24-Apr-2024 08:00                5800
function.snmpgetnext.php                           24-Apr-2024 08:00                6049
function.snmprealwalk.php                          24-Apr-2024 08:00                6483
function.snmpset.php                               24-Apr-2024 08:00               11004
function.snmpwalk.php                              24-Apr-2024 08:00                7119
function.snmpwalkoid.php                           24-Apr-2024 08:00                7779
function.socket-accept.php                         24-Apr-2024 08:00                6802
function.socket-addrinfo-bind.php                  24-Apr-2024 08:00                5436
function.socket-addrinfo-connect.php               24-Apr-2024 08:00                5244
function.socket-addrinfo-explain.php               24-Apr-2024 08:00                4484
function.socket-addrinfo-lookup.php                24-Apr-2024 08:00                6081
function.socket-atmark.php                         24-Apr-2024 08:00                4966
function.socket-bind.php                           24-Apr-2024 08:00               11000
function.socket-clear-error.php                    24-Apr-2024 08:00                4643
function.socket-close.php                          24-Apr-2024 08:00                4590
function.socket-cmsg-space.php                     24-Apr-2024 08:00                3772
function.socket-connect.php                        24-Apr-2024 08:00                7752
function.socket-create-listen.php                  24-Apr-2024 08:00                7148
function.socket-create-pair.php                    24-Apr-2024 08:00               19789
function.socket-create.php                         24-Apr-2024 08:00               12643
function.socket-export-stream.php                  24-Apr-2024 08:00                3530
function.socket-get-option.php                     24-Apr-2024 08:00               32156
function.socket-get-status.php                     24-Apr-2024 08:00                1844
function.socket-getopt.php                         24-Apr-2024 08:00                1825
function.socket-getpeername.php                    24-Apr-2024 08:00                8374
function.socket-getsockname.php                    24-Apr-2024 08:00                7693
function.socket-import-stream.php                  24-Apr-2024 08:00                5166
function.socket-last-error.php                     24-Apr-2024 08:00                7308
function.socket-listen.php                         24-Apr-2024 08:00                7336
function.socket-read.php                           24-Apr-2024 08:00                8018
function.socket-recv.php                           24-Apr-2024 08:00               16456
function.socket-recvfrom.php                       24-Apr-2024 08:00               13826
function.socket-recvmsg.php                        24-Apr-2024 08:00                4438
function.socket-select.php                         24-Apr-2024 08:00               15682
function.socket-send.php                           24-Apr-2024 08:00                6893
function.socket-sendmsg.php                        24-Apr-2024 08:00                4560
function.socket-sendto.php                         24-Apr-2024 08:00               10145
function.socket-set-block.php                      24-Apr-2024 08:00                6167
function.socket-set-blocking.php                   24-Apr-2024 08:00                1864
function.socket-set-nonblock.php                   24-Apr-2024 08:00                6583
function.socket-set-option.php                     24-Apr-2024 08:00               11500
function.socket-set-timeout.php                    24-Apr-2024 08:00                1832
function.socket-setopt.php                         24-Apr-2024 08:00                1819
function.socket-shutdown.php                       24-Apr-2024 08:00                5004
function.socket-strerror.php                       24-Apr-2024 08:00                7187
function.socket-write.php                          24-Apr-2024 08:00                7370
function.socket-wsaprotocol-info-export.php        24-Apr-2024 08:00                5075
function.socket-wsaprotocol-info-import.php        24-Apr-2024 08:00                4460
function.socket-wsaprotocol-info-release.php       24-Apr-2024 08:00                3642
function.sodium-add.php                            24-Apr-2024 08:00                3200
function.sodium-base642bin.php                     24-Apr-2024 08:00                4484
function.sodium-bin2base64.php                     24-Apr-2024 08:00                4014
function.sodium-bin2hex.php                        24-Apr-2024 08:00                2711
function.sodium-compare.php                        24-Apr-2024 08:00                3238
function.sodium-crypto-aead-aes256gcm-decrypt.php  24-Apr-2024 08:00                4703
function.sodium-crypto-aead-aes256gcm-encrypt.php  24-Apr-2024 08:00                4418
function.sodium-crypto-aead-aes256gcm-is-availa..> 24-Apr-2024 08:00                2850
function.sodium-crypto-aead-aes256gcm-keygen.php   24-Apr-2024 08:00                2840
function.sodium-crypto-aead-chacha20poly1305-de..> 24-Apr-2024 08:00                4568
function.sodium-crypto-aead-chacha20poly1305-en..> 24-Apr-2024 08:00                4287
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Apr-2024 08:00                4798
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Apr-2024 08:00                4453
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Apr-2024 08:00                3034
function.sodium-crypto-aead-chacha20poly1305-ke..> 24-Apr-2024 08:00                2969
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Apr-2024 08:00                4976
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Apr-2024 08:00                4671
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Apr-2024 08:00                3010
function.sodium-crypto-auth-keygen.php             24-Apr-2024 08:00                2661
function.sodium-crypto-auth-verify.php             24-Apr-2024 08:00                3887
function.sodium-crypto-auth.php                    24-Apr-2024 08:00                3367
function.sodium-crypto-box-keypair-from-secretk..> 24-Apr-2024 08:00                3446
function.sodium-crypto-box-keypair.php             24-Apr-2024 08:00                2942
function.sodium-crypto-box-open.php                24-Apr-2024 08:00                4003
function.sodium-crypto-box-publickey-from-secre..> 24-Apr-2024 08:00                3277
function.sodium-crypto-box-publickey.php           24-Apr-2024 08:00                2990
function.sodium-crypto-box-seal-open.php           24-Apr-2024 08:00                6051
function.sodium-crypto-box-seal.php                24-Apr-2024 08:00                7189
function.sodium-crypto-box-secretkey.php           24-Apr-2024 08:00                2957
function.sodium-crypto-box-seed-keypair.php        24-Apr-2024 08:00                3016
function.sodium-crypto-box.php                     24-Apr-2024 08:00                4236
function.sodium-crypto-core-ristretto255-add.php   24-Apr-2024 08:00                6139
function.sodium-crypto-core-ristretto255-from-h..> 24-Apr-2024 08:00                5499
function.sodium-crypto-core-ristretto255-is-val..> 24-Apr-2024 08:00                5664
function.sodium-crypto-core-ristretto255-random..> 24-Apr-2024 08:00                5644
function.sodium-crypto-core-ristretto255-scalar..> 24-Apr-2024 08:00                6406
function.sodium-crypto-core-ristretto255-scalar..> 24-Apr-2024 08:00                3647
function.sodium-crypto-core-ristretto255-scalar..> 24-Apr-2024 08:00                5498
function.sodium-crypto-core-ristretto255-scalar..> 24-Apr-2024 08:00                3906
function.sodium-crypto-core-ristretto255-scalar..> 24-Apr-2024 08:00                5482
function.sodium-crypto-core-ristretto255-scalar..> 24-Apr-2024 08:00                5803
function.sodium-crypto-core-ristretto255-scalar..> 24-Apr-2024 08:00                3591
function.sodium-crypto-core-ristretto255-scalar..> 24-Apr-2024 08:00                6397
function.sodium-crypto-core-ristretto255-sub.php   24-Apr-2024 08:00                6176
function.sodium-crypto-generichash-final.php       24-Apr-2024 08:00                6902
function.sodium-crypto-generichash-init.php        24-Apr-2024 08:00                6852
function.sodium-crypto-generichash-keygen.php      24-Apr-2024 08:00                2471
function.sodium-crypto-generichash-update.php      24-Apr-2024 08:00                6582
function.sodium-crypto-generichash.php             24-Apr-2024 08:00                3772
function.sodium-crypto-kdf-derive-from-key.php     24-Apr-2024 08:00                3983
function.sodium-crypto-kdf-keygen.php              24-Apr-2024 08:00                2573
function.sodium-crypto-kx-client-session-keys.php  24-Apr-2024 08:00                3399
function.sodium-crypto-kx-keypair.php              24-Apr-2024 08:00                5021
function.sodium-crypto-kx-publickey.php            24-Apr-2024 08:00                2809
function.sodium-crypto-kx-secretkey.php            24-Apr-2024 08:00                2820
function.sodium-crypto-kx-seed-keypair.php         24-Apr-2024 08:00                2751
function.sodium-crypto-kx-server-session-keys.php  24-Apr-2024 08:00                3465
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Apr-2024 08:00                3356
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Apr-2024 08:00                3559
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Apr-2024 08:00                6465
function.sodium-crypto-pwhash-str-needs-rehash.php 24-Apr-2024 08:00                4039
function.sodium-crypto-pwhash-str-verify.php       24-Apr-2024 08:00                4788
function.sodium-crypto-pwhash-str.php              24-Apr-2024 08:00                8630
function.sodium-crypto-pwhash.php                  24-Apr-2024 08:00               10457
function.sodium-crypto-scalarmult-base.php         24-Apr-2024 08:00                2072
function.sodium-crypto-scalarmult-ristretto255-..> 24-Apr-2024 08:00                3560
function.sodium-crypto-scalarmult-ristretto255.php 24-Apr-2024 08:00                3909
function.sodium-crypto-scalarmult.php              24-Apr-2024 08:00                3088
function.sodium-crypto-secretbox-keygen.php        24-Apr-2024 08:00                6286
function.sodium-crypto-secretbox-open.php          24-Apr-2024 08:00                8793
function.sodium-crypto-secretbox.php               24-Apr-2024 08:00                8711
function.sodium-crypto-secretstream-xchacha20po..> 24-Apr-2024 08:00               10909
function.sodium-crypto-secretstream-xchacha20po..> 24-Apr-2024 08:00               10243
function.sodium-crypto-secretstream-xchacha20po..> 24-Apr-2024 08:00                2737
function.sodium-crypto-secretstream-xchacha20po..> 24-Apr-2024 08:00                5846
function.sodium-crypto-secretstream-xchacha20po..> 24-Apr-2024 08:00                5857
function.sodium-crypto-secretstream-xchacha20po..> 24-Apr-2024 08:00                2995
function.sodium-crypto-shorthash-keygen.php        24-Apr-2024 08:00                2714
function.sodium-crypto-shorthash.php               24-Apr-2024 08:00                3200
function.sodium-crypto-sign-detached.php           24-Apr-2024 08:00                3193
function.sodium-crypto-sign-ed25519-pk-to-curve..> 24-Apr-2024 08:00                2977
function.sodium-crypto-sign-ed25519-sk-to-curve..> 24-Apr-2024 08:00                3033
function.sodium-crypto-sign-keypair-from-secret..> 24-Apr-2024 08:00                3272
function.sodium-crypto-sign-keypair.php            24-Apr-2024 08:00                2459
function.sodium-crypto-sign-open.php               24-Apr-2024 08:00                3369
function.sodium-crypto-sign-publickey-from-secr..> 24-Apr-2024 08:00                2835
function.sodium-crypto-sign-publickey.php          24-Apr-2024 08:00                2845
function.sodium-crypto-sign-secretkey.php          24-Apr-2024 08:00                2821
function.sodium-crypto-sign-seed-keypair.php       24-Apr-2024 08:00                3054
function.sodium-crypto-sign-verify-detached.php    24-Apr-2024 08:00                3664
function.sodium-crypto-sign.php                    24-Apr-2024 08:00                3271
function.sodium-crypto-stream-keygen.php           24-Apr-2024 08:00                2642
function.sodium-crypto-stream-xchacha20-keygen.php 24-Apr-2024 08:00                2800
function.sodium-crypto-stream-xchacha20-xor-ic.php 24-Apr-2024 08:00                9640
function.sodium-crypto-stream-xchacha20-xor.php    24-Apr-2024 08:00                4713
function.sodium-crypto-stream-xchacha20.php        24-Apr-2024 08:00                3727
function.sodium-crypto-stream-xor.php              24-Apr-2024 08:00                3513
function.sodium-crypto-stream.php                  24-Apr-2024 08:00                3446
function.sodium-hex2bin.php                        24-Apr-2024 08:00                3319
function.sodium-increment.php                      24-Apr-2024 08:00                2535
function.sodium-memcmp.php                         24-Apr-2024 08:00                3542
function.sodium-memzero.php                        24-Apr-2024 08:00                2530
function.sodium-pad.php                            24-Apr-2024 08:00                2768
function.sodium-unpad.php                          24-Apr-2024 08:00                2723
function.solr-get-version.php                      24-Apr-2024 08:00                3958
function.sort.php                                  24-Apr-2024 08:00               12276
function.soundex.php                               24-Apr-2024 08:00                7252
function.spl-autoload-call.php                     24-Apr-2024 08:00                2664
function.spl-autoload-extensions.php               24-Apr-2024 08:00                5004
function.spl-autoload-functions.php                24-Apr-2024 08:00                3267
function.spl-autoload-register.php                 24-Apr-2024 08:00               13480
function.spl-autoload-unregister.php               24-Apr-2024 08:00                3106
function.spl-autoload.php                          24-Apr-2024 08:00                4712
function.spl-classes.php                           24-Apr-2024 08:00                3818
function.spl-object-hash.php                       24-Apr-2024 08:00                5049
function.spl-object-id.php                         24-Apr-2024 08:00                4152
function.sprintf.php                               24-Apr-2024 08:00               28819
function.sqlsrv-begin-transaction.php              24-Apr-2024 08:00               11269
function.sqlsrv-cancel.php                         24-Apr-2024 08:00               10343
function.sqlsrv-client-info.php                    24-Apr-2024 08:00                6776
function.sqlsrv-close.php                          24-Apr-2024 08:00                5613
function.sqlsrv-commit.php                         24-Apr-2024 08:00               11128
function.sqlsrv-configure.php                      24-Apr-2024 08:00                4746
function.sqlsrv-connect.php                        24-Apr-2024 08:00               12224
function.sqlsrv-errors.php                         24-Apr-2024 08:00               10064
function.sqlsrv-execute.php                        24-Apr-2024 08:00               10166
function.sqlsrv-fetch-array.php                    24-Apr-2024 08:00               15644
function.sqlsrv-fetch-object.php                   24-Apr-2024 08:00               12401
function.sqlsrv-fetch.php                          24-Apr-2024 08:00               10849
function.sqlsrv-field-metadata.php                 24-Apr-2024 08:00                8887
function.sqlsrv-free-stmt.php                      24-Apr-2024 08:00                7744
function.sqlsrv-get-config.php                     24-Apr-2024 08:00                3362
function.sqlsrv-get-field.php                      24-Apr-2024 08:00               10221
function.sqlsrv-has-rows.php                       24-Apr-2024 08:00                6380
function.sqlsrv-next-result.php                    24-Apr-2024 08:00                9294
function.sqlsrv-num-fields.php                     24-Apr-2024 08:00                8214
function.sqlsrv-num-rows.php                       24-Apr-2024 08:00                7941
function.sqlsrv-prepare.php                        24-Apr-2024 08:00               14558
function.sqlsrv-query.php                          24-Apr-2024 08:00               11911
function.sqlsrv-rollback.php                       24-Apr-2024 08:00               10598
function.sqlsrv-rows-affected.php                  24-Apr-2024 08:00                7991
function.sqlsrv-send-stream-data.php               24-Apr-2024 08:00                8560
function.sqlsrv-server-info.php                    24-Apr-2024 08:00                6181
function.sqrt.php                                  24-Apr-2024 08:00                4597
function.srand.php                                 24-Apr-2024 08:00                7165
function.sscanf.php                                24-Apr-2024 08:00               11538
function.ssdeep-fuzzy-compare.php                  24-Apr-2024 08:00                3305
function.ssdeep-fuzzy-hash-filename.php            24-Apr-2024 08:00                3027
function.ssdeep-fuzzy-hash.php                     24-Apr-2024 08:00                2869
function.ssh2-auth-agent.php                       24-Apr-2024 08:00                4777
function.ssh2-auth-hostbased-file.php              24-Apr-2024 08:00                7753
function.ssh2-auth-none.php                        24-Apr-2024 08:00                4893
function.ssh2-auth-password.php                    24-Apr-2024 08:00                5039
function.ssh2-auth-pubkey-file.php                 24-Apr-2024 08:00                7254
function.ssh2-connect.php                          24-Apr-2024 08:00               15783
function.ssh2-disconnect.php                       24-Apr-2024 08:00                3117
function.ssh2-exec.php                             24-Apr-2024 08:00                7647
function.ssh2-fetch-stream.php                     24-Apr-2024 08:00                5567
function.ssh2-fingerprint.php                      24-Apr-2024 08:00                5564
function.ssh2-forward-accept.php                   24-Apr-2024 08:00                3090
function.ssh2-forward-listen.php                   24-Apr-2024 08:00                4531
function.ssh2-methods-negotiated.php               24-Apr-2024 08:00                8025
function.ssh2-poll.php                             24-Apr-2024 08:00                3581
function.ssh2-publickey-add.php                    24-Apr-2024 08:00                8438
function.ssh2-publickey-init.php                   24-Apr-2024 08:00                4689
function.ssh2-publickey-list.php                   24-Apr-2024 08:00                8849
function.ssh2-publickey-remove.php                 24-Apr-2024 08:00                4725
function.ssh2-scp-recv.php                         24-Apr-2024 08:00                5482
function.ssh2-scp-send.php                         24-Apr-2024 08:00                6093
function.ssh2-send-eof.php                         24-Apr-2024 08:00                3470
function.ssh2-sftp-chmod.php                       24-Apr-2024 08:00                5992
function.ssh2-sftp-lstat.php                       24-Apr-2024 08:00                7318
function.ssh2-sftp-mkdir.php                       24-Apr-2024 08:00                6869
function.ssh2-sftp-readlink.php                    24-Apr-2024 08:00                5370
function.ssh2-sftp-realpath.php                    24-Apr-2024 08:00                5594
function.ssh2-sftp-rename.php                      24-Apr-2024 08:00                5582
function.ssh2-sftp-rmdir.php                       24-Apr-2024 08:00                5574
function.ssh2-sftp-stat.php                        24-Apr-2024 08:00                7233
function.ssh2-sftp-symlink.php                     24-Apr-2024 08:00                5780
function.ssh2-sftp-unlink.php                      24-Apr-2024 08:00                5051
function.ssh2-sftp.php                             24-Apr-2024 08:00                5493
function.ssh2-shell.php                            24-Apr-2024 08:00                8108
function.ssh2-tunnel.php                           24-Apr-2024 08:00                5360
function.stat.php                                  24-Apr-2024 08:00               15937
function.stats-absolute-deviation.php              24-Apr-2024 08:00                2863
function.stats-cdf-beta.php                        24-Apr-2024 08:00                5227
function.stats-cdf-binomial.php                    24-Apr-2024 08:00                5212
function.stats-cdf-cauchy.php                      24-Apr-2024 08:00                5247
function.stats-cdf-chisquare.php                   24-Apr-2024 08:00                4566
function.stats-cdf-exponential.php                 24-Apr-2024 08:00                4597
function.stats-cdf-f.php                           24-Apr-2024 08:00                5152
function.stats-cdf-gamma.php                       24-Apr-2024 08:00                5211
function.stats-cdf-laplace.php                     24-Apr-2024 08:00                5232
function.stats-cdf-logistic.php                    24-Apr-2024 08:00                5267
function.stats-cdf-negative-binomial.php           24-Apr-2024 08:00                5355
function.stats-cdf-noncentral-chisquare.php        24-Apr-2024 08:00                5457
function.stats-cdf-noncentral-f.php                24-Apr-2024 08:00                6031
function.stats-cdf-noncentral-t.php                24-Apr-2024 08:00                5317
function.stats-cdf-normal.php                      24-Apr-2024 08:00                5249
function.stats-cdf-poisson.php                     24-Apr-2024 08:00                4531
function.stats-cdf-t.php                           24-Apr-2024 08:00                4459
function.stats-cdf-uniform.php                     24-Apr-2024 08:00                5212
function.stats-cdf-weibull.php                     24-Apr-2024 08:00                5249
function.stats-covariance.php                      24-Apr-2024 08:00                3060
function.stats-dens-beta.php                       24-Apr-2024 08:00                3546
function.stats-dens-cauchy.php                     24-Apr-2024 08:00                3604
function.stats-dens-chisquare.php                  24-Apr-2024 08:00                3274
function.stats-dens-exponential.php                24-Apr-2024 08:00                3264
function.stats-dens-f.php                          24-Apr-2024 08:00                3544
function.stats-dens-gamma.php                      24-Apr-2024 08:00                3597
function.stats-dens-laplace.php                    24-Apr-2024 08:00                3631
function.stats-dens-logistic.php                   24-Apr-2024 08:00                3643
function.stats-dens-normal.php                     24-Apr-2024 08:00                3614
function.stats-dens-pmf-binomial.php               24-Apr-2024 08:00                3668
function.stats-dens-pmf-hypergeometric.php         24-Apr-2024 08:00                4320
function.stats-dens-pmf-negative-binomial.php      24-Apr-2024 08:00                3797
function.stats-dens-pmf-poisson.php                24-Apr-2024 08:00                3265
function.stats-dens-t.php                          24-Apr-2024 08:00                3178
function.stats-dens-uniform.php                    24-Apr-2024 08:00                3579
function.stats-dens-weibull.php                    24-Apr-2024 08:00                3611
function.stats-harmonic-mean.php                   24-Apr-2024 08:00                2759
function.stats-kurtosis.php                        24-Apr-2024 08:00                2767
function.stats-rand-gen-beta.php                   24-Apr-2024 08:00                3073
function.stats-rand-gen-chisquare.php              24-Apr-2024 08:00                2746
function.stats-rand-gen-exponential.php            24-Apr-2024 08:00                2744
function.stats-rand-gen-f.php                      24-Apr-2024 08:00                3127
function.stats-rand-gen-funiform.php               24-Apr-2024 08:00                3054
function.stats-rand-gen-gamma.php                  24-Apr-2024 08:00                3140
function.stats-rand-gen-ibinomial-negative.php     24-Apr-2024 08:00                3220
function.stats-rand-gen-ibinomial.php              24-Apr-2024 08:00                3144
function.stats-rand-gen-int.php                    24-Apr-2024 08:00                2312
function.stats-rand-gen-ipoisson.php               24-Apr-2024 08:00                2719
function.stats-rand-gen-iuniform.php               24-Apr-2024 08:00                3121
function.stats-rand-gen-noncentral-chisquare.php   24-Apr-2024 08:00                3262
function.stats-rand-gen-noncentral-f.php           24-Apr-2024 08:00                3615
function.stats-rand-gen-noncentral-t.php           24-Apr-2024 08:00                3175
function.stats-rand-gen-normal.php                 24-Apr-2024 08:00                3088
function.stats-rand-gen-t.php                      24-Apr-2024 08:00                2638
function.stats-rand-get-seeds.php                  24-Apr-2024 08:00                2355
function.stats-rand-phrase-to-seeds.php            24-Apr-2024 08:00                2727
function.stats-rand-ranf.php                       24-Apr-2024 08:00                2356
function.stats-rand-setall.php                     24-Apr-2024 08:00                2996
function.stats-skew.php                            24-Apr-2024 08:00                2733
function.stats-standard-deviation.php              24-Apr-2024 08:00                3903
function.stats-stat-binomial-coef.php              24-Apr-2024 08:00                3033
function.stats-stat-correlation.php                24-Apr-2024 08:00                3240
function.stats-stat-factorial.php                  24-Apr-2024 08:00                2606
function.stats-stat-independent-t.php              24-Apr-2024 08:00                3351
function.stats-stat-innerproduct.php               24-Apr-2024 08:00                3182
function.stats-stat-paired-t.php                   24-Apr-2024 08:00                3119
function.stats-stat-percentile.php                 24-Apr-2024 08:00                2985
function.stats-stat-powersum.php                   24-Apr-2024 08:00                2977
function.stats-variance.php                        24-Apr-2024 08:00                3404
function.stomp-connect-error.php                   24-Apr-2024 08:00                3728
function.stomp-version.php                         24-Apr-2024 08:00                3156
function.str-contains.php                          24-Apr-2024 08:00                8265
function.str-decrement.php                         24-Apr-2024 08:00                6539
function.str-ends-with.php                         24-Apr-2024 08:00                8192
function.str-getcsv.php                            24-Apr-2024 08:00                9216
function.str-increment.php                         24-Apr-2024 08:00                6226
function.str-ireplace.php                          24-Apr-2024 08:00                9515
function.str-pad.php                               24-Apr-2024 08:00                8411
function.str-repeat.php                            24-Apr-2024 08:00                4729
function.str-replace.php                           24-Apr-2024 08:00               17084
function.str-rot13.php                             24-Apr-2024 08:00                3631
function.str-shuffle.php                           24-Apr-2024 08:00                6103
function.str-split.php                             24-Apr-2024 08:00                8708
function.str-starts-with.php                       24-Apr-2024 08:00                8220
function.str-word-count.php                        24-Apr-2024 08:00                9164
function.strcasecmp.php                            24-Apr-2024 08:00                6229
function.strchr.php                                24-Apr-2024 08:00                1682
function.strcmp.php                                24-Apr-2024 08:00                6042
function.strcoll.php                               24-Apr-2024 08:00                5074
function.strcspn.php                               24-Apr-2024 08:00               11546
function.stream-bucket-append.php                  24-Apr-2024 08:00                2313
function.stream-bucket-make-writeable.php          24-Apr-2024 08:00                4437
function.stream-bucket-new.php                     24-Apr-2024 08:00                2344
function.stream-bucket-prepend.php                 24-Apr-2024 08:00                6344
function.stream-context-create.php                 24-Apr-2024 08:00                7807
function.stream-context-get-default.php            24-Apr-2024 08:00                8886
function.stream-context-get-options.php            24-Apr-2024 08:00                4522
function.stream-context-get-params.php             24-Apr-2024 08:00                5560
function.stream-context-set-default.php            24-Apr-2024 08:00                6252
function.stream-context-set-option.php             24-Apr-2024 08:00                5549
function.stream-context-set-options.php            24-Apr-2024 08:00                6439
function.stream-context-set-params.php             24-Apr-2024 08:00                4704
function.stream-copy-to-stream.php                 24-Apr-2024 08:00                7742
function.stream-filter-append.php                  24-Apr-2024 08:00               10918
function.stream-filter-prepend.php                 24-Apr-2024 08:00                8236
function.stream-filter-register.php                24-Apr-2024 08:00               18414
function.stream-filter-remove.php                  24-Apr-2024 08:00                6683
function.stream-get-contents.php                   24-Apr-2024 08:00                9005
function.stream-get-filters.php                    24-Apr-2024 08:00                4073
function.stream-get-line.php                       24-Apr-2024 08:00                5003
function.stream-get-meta-data.php                  24-Apr-2024 08:00               14688
function.stream-get-transports.php                 24-Apr-2024 08:00                4059
function.stream-get-wrappers.php                   24-Apr-2024 08:00                4823
function.stream-is-local.php                       24-Apr-2024 08:00                4287
function.stream-isatty.php                         24-Apr-2024 08:00                4020
function.stream-notification-callback.php          24-Apr-2024 08:00               22360
function.stream-register-wrapper.php               24-Apr-2024 08:00                1947
function.stream-resolve-include-path.php           24-Apr-2024 08:00                4392
function.stream-select.php                         24-Apr-2024 08:00               16403
function.stream-set-blocking.php                   24-Apr-2024 08:00                4842
function.stream-set-chunk-size.php                 24-Apr-2024 08:00                4321
function.stream-set-read-buffer.php                24-Apr-2024 08:00                3771
function.stream-set-timeout.php                    24-Apr-2024 08:00                8090
function.stream-set-write-buffer.php               24-Apr-2024 08:00                5857
function.stream-socket-accept.php                  24-Apr-2024 08:00                7561
function.stream-socket-client.php                  24-Apr-2024 08:00               17680
function.stream-socket-enable-crypto.php           24-Apr-2024 08:00               11993
function.stream-socket-get-name.php                24-Apr-2024 08:00                3921
function.stream-socket-pair.php                    24-Apr-2024 08:00                9916
function.stream-socket-recvfrom.php                24-Apr-2024 08:00               10719
function.stream-socket-sendto.php                  24-Apr-2024 08:00                7469
function.stream-socket-server.php                  24-Apr-2024 08:00               15363
function.stream-socket-shutdown.php                24-Apr-2024 08:00                6635
function.stream-supports-lock.php                  24-Apr-2024 08:00                3249
function.stream-wrapper-register.php               24-Apr-2024 08:00                9320
function.stream-wrapper-restore.php                24-Apr-2024 08:00                2951
function.stream-wrapper-unregister.php             24-Apr-2024 08:00                3152
function.strftime.php                              24-Apr-2024 08:00               55496
function.strip-tags.php                            24-Apr-2024 08:00                9447
function.stripcslashes.php                         24-Apr-2024 08:00                4012
function.stripos.php                               24-Apr-2024 08:00               11881
function.stripslashes.php                          24-Apr-2024 08:00                7565
function.stristr.php                               24-Apr-2024 08:00               10467
function.strlen.php                                24-Apr-2024 08:00                5013
function.strnatcasecmp.php                         24-Apr-2024 08:00                7554
function.strnatcmp.php                             24-Apr-2024 08:00                8772
function.strncasecmp.php                           24-Apr-2024 08:00                6841
function.strncmp.php                               24-Apr-2024 08:00                6830
function.strpbrk.php                               24-Apr-2024 08:00                5332
function.strpos.php                                24-Apr-2024 08:00               13817
function.strptime.php                              24-Apr-2024 08:00               11796
function.strrchr.php                               24-Apr-2024 08:00                8523
function.strrev.php                                24-Apr-2024 08:00                3211
function.strripos.php                              24-Apr-2024 08:00               10810
function.strrpos.php                               24-Apr-2024 08:00               13435
function.strspn.php                                24-Apr-2024 08:00               10833
function.strstr.php                                24-Apr-2024 08:00                8830
function.strtok.php                                24-Apr-2024 08:00               13548
function.strtolower.php                            24-Apr-2024 08:00                5849
function.strtotime.php                             24-Apr-2024 08:00               12771
function.strtoupper.php                            24-Apr-2024 08:00                5854
function.strtr.php                                 24-Apr-2024 08:00               11850
function.strval.php                                24-Apr-2024 08:00                6405
function.substr-compare.php                        24-Apr-2024 08:00               11006
function.substr-count.php                          24-Apr-2024 08:00                9610
function.substr-replace.php                        24-Apr-2024 08:00               16395
function.substr.php                                24-Apr-2024 08:00               22664
function.svn-add.php                               24-Apr-2024 08:00                6441
function.svn-auth-get-parameter.php                24-Apr-2024 08:00                4005
function.svn-auth-set-parameter.php                24-Apr-2024 08:00                5444
function.svn-blame.php                             24-Apr-2024 08:00                5021
function.svn-cat.php                               24-Apr-2024 08:00                4869
function.svn-checkout.php                          24-Apr-2024 08:00                7442
function.svn-cleanup.php                           24-Apr-2024 08:00                5212
function.svn-client-version.php                    24-Apr-2024 08:00                3524
function.svn-commit.php                            24-Apr-2024 08:00                8143
function.svn-delete.php                            24-Apr-2024 08:00                4772
function.svn-diff.php                              24-Apr-2024 08:00               13438
function.svn-export.php                            24-Apr-2024 08:00                5385
function.svn-fs-abort-txn.php                      24-Apr-2024 08:00                3231
function.svn-fs-apply-text.php                     24-Apr-2024 08:00                2826
function.svn-fs-begin-txn2.php                     24-Apr-2024 08:00                2769
function.svn-fs-change-node-prop.php               24-Apr-2024 08:00                3297
function.svn-fs-check-path.php                     24-Apr-2024 08:00                2871
function.svn-fs-contents-changed.php               24-Apr-2024 08:00                3302
function.svn-fs-copy.php                           24-Apr-2024 08:00                4224
function.svn-fs-delete.php                         24-Apr-2024 08:00                3509
function.svn-fs-dir-entries.php                    24-Apr-2024 08:00                2884
function.svn-fs-file-contents.php                  24-Apr-2024 08:00                2907
function.svn-fs-file-length.php                    24-Apr-2024 08:00                2830
function.svn-fs-is-dir.php                         24-Apr-2024 08:00                3569
function.svn-fs-is-file.php                        24-Apr-2024 08:00                3557
function.svn-fs-make-dir.php                       24-Apr-2024 08:00                3533
function.svn-fs-make-file.php                      24-Apr-2024 08:00                3550
function.svn-fs-node-created-rev.php               24-Apr-2024 08:00                2873
function.svn-fs-node-prop.php                      24-Apr-2024 08:00                2971
function.svn-fs-props-changed.php                  24-Apr-2024 08:00                3289
function.svn-fs-revision-prop.php                  24-Apr-2024 08:00                2984
function.svn-fs-revision-root.php                  24-Apr-2024 08:00                2852
function.svn-fs-txn-root.php                       24-Apr-2024 08:00                2617
function.svn-fs-youngest-rev.php                   24-Apr-2024 08:00                2659
function.svn-import.php                            24-Apr-2024 08:00                6102
function.svn-log.php                               24-Apr-2024 08:00                9131
function.svn-ls.php                                24-Apr-2024 08:00                7385
function.svn-mkdir.php                             24-Apr-2024 08:00                3299
function.svn-repos-create.php                      24-Apr-2024 08:00                3037
function.svn-repos-fs-begin-txn-for-commit.php     24-Apr-2024 08:00                3357
function.svn-repos-fs-commit-txn.php               24-Apr-2024 08:00                2714
function.svn-repos-fs.php                          24-Apr-2024 08:00                2614
function.svn-repos-hotcopy.php                     24-Apr-2024 08:00                2983
function.svn-repos-open.php                        24-Apr-2024 08:00                2586
function.svn-repos-recover.php                     24-Apr-2024 08:00                2630
function.svn-revert.php                            24-Apr-2024 08:00                3636
function.svn-status.php                            24-Apr-2024 08:00               14771
function.svn-update.php                            24-Apr-2024 08:00                6259
function.swoole-async-dns-lookup.php               24-Apr-2024 08:00                3884
function.swoole-async-read.php                     24-Apr-2024 08:00                4505
function.swoole-async-readfile.php                 24-Apr-2024 08:00                3906
function.swoole-async-set.php                      24-Apr-2024 08:00                2452
function.swoole-async-write.php                    24-Apr-2024 08:00                3786
function.swoole-async-writefile.php                24-Apr-2024 08:00                3814
function.swoole-clear-error.php                    24-Apr-2024 08:00                2310
function.swoole-client-select.php                  24-Apr-2024 08:00                3537
function.swoole-cpu-num.php                        24-Apr-2024 08:00                2164
function.swoole-errno.php                          24-Apr-2024 08:00                2141
function.swoole-error-log.php                      24-Apr-2024 08:00                3603
function.swoole-event-add.php                      24-Apr-2024 08:00                3544
function.swoole-event-defer.php                    24-Apr-2024 08:00                2669
function.swoole-event-del.php                      24-Apr-2024 08:00                2635
function.swoole-event-exit.php                     24-Apr-2024 08:00                2207
function.swoole-event-set.php                      24-Apr-2024 08:00                3532
function.swoole-event-wait.php                     24-Apr-2024 08:00                2178
function.swoole-event-write.php                    24-Apr-2024 08:00                2907
function.swoole-get-local-ip.php                   24-Apr-2024 08:00                2235
function.swoole-last-error.php                     24-Apr-2024 08:00                2190
function.swoole-load-module.php                    24-Apr-2024 08:00                2348
function.swoole-select.php                         24-Apr-2024 08:00                3504
function.swoole-set-process-name.php               24-Apr-2024 08:00                2677
function.swoole-strerror.php                       24-Apr-2024 08:00                2631
function.swoole-timer-after.php                    24-Apr-2024 08:00                3055
function.swoole-timer-exists.php                   24-Apr-2024 08:00                2468
function.swoole-timer-tick.php                     24-Apr-2024 08:00                2932
function.swoole-version.php                        24-Apr-2024 08:00                2169
function.symlink.php                               24-Apr-2024 08:00                5568
function.sys-get-temp-dir.php                      24-Apr-2024 08:00                4167
function.sys-getloadavg.php                        24-Apr-2024 08:00                4178
function.syslog.php                                24-Apr-2024 08:00                9356
function.system.php                                24-Apr-2024 08:00                7678
function.taint.php                                 24-Apr-2024 08:00                2712
function.tan.php                                   24-Apr-2024 08:00                4275
function.tanh.php                                  24-Apr-2024 08:00                3198
function.tcpwrap-check.php                         24-Apr-2024 08:00                5855
function.tempnam.php                               24-Apr-2024 08:00                7128
function.textdomain.php                            24-Apr-2024 08:00                3273
function.tidy-access-count.php                     24-Apr-2024 08:00                6429
function.tidy-config-count.php                     24-Apr-2024 08:00                4346
function.tidy-error-count.php                      24-Apr-2024 08:00                5356
function.tidy-get-output.php                       24-Apr-2024 08:00                4307
function.tidy-warning-count.php                    24-Apr-2024 08:00                4917
function.time-nanosleep.php                        24-Apr-2024 08:00                8585
function.time-sleep-until.php                      24-Apr-2024 08:00                5764
function.time.php                                  24-Apr-2024 08:00                4600
function.timezone-abbreviations-list.php           24-Apr-2024 08:00                1946
function.timezone-identifiers-list.php             24-Apr-2024 08:00                1962
function.timezone-location-get.php                 24-Apr-2024 08:00                1918
function.timezone-name-from-abbr.php               24-Apr-2024 08:00                6281
function.timezone-name-get.php                     24-Apr-2024 08:00                1862
function.timezone-offset-get.php                   24-Apr-2024 08:00                1860
function.timezone-open.php                         24-Apr-2024 08:00                1848
function.timezone-transitions-get.php              24-Apr-2024 08:00                1921
function.timezone-version-get.php                  24-Apr-2024 08:00                4391
function.tmpfile.php                               24-Apr-2024 08:00                5436
function.token-get-all.php                         24-Apr-2024 08:00               11939
function.token-name.php                            24-Apr-2024 08:00                4180
function.touch.php                                 24-Apr-2024 08:00                8013
function.trader-acos.php                           24-Apr-2024 08:00                2511
function.trader-ad.php                             24-Apr-2024 08:00                3425
function.trader-add.php                            24-Apr-2024 08:00                2842
function.trader-adosc.php                          24-Apr-2024 08:00                4285
function.trader-adx.php                            24-Apr-2024 08:00                3511
function.trader-adxr.php                           24-Apr-2024 08:00                3522
function.trader-apo.php                            24-Apr-2024 08:00                3711
function.trader-aroon.php                          24-Apr-2024 08:00                3079
function.trader-aroonosc.php                       24-Apr-2024 08:00                3116
function.trader-asin.php                           24-Apr-2024 08:00                2526
function.trader-atan.php                           24-Apr-2024 08:00                2519
function.trader-atr.php                            24-Apr-2024 08:00                3501
function.trader-avgprice.php                       24-Apr-2024 08:00                3482
function.trader-bbands.php                         24-Apr-2024 08:00                4470
function.trader-beta.php                           24-Apr-2024 08:00                3047
function.trader-bop.php                            24-Apr-2024 08:00                3431
function.trader-cci.php                            24-Apr-2024 08:00                3506
function.trader-cdl2crows.php                      24-Apr-2024 08:00                3504
function.trader-cdl3blackcrows.php                 24-Apr-2024 08:00                3566
function.trader-cdl3inside.php                     24-Apr-2024 08:00                3547
function.trader-cdl3linestrike.php                 24-Apr-2024 08:00                3570
function.trader-cdl3outside.php                    24-Apr-2024 08:00                3562
function.trader-cdl3starsinsouth.php               24-Apr-2024 08:00                3611
function.trader-cdl3whitesoldiers.php              24-Apr-2024 08:00                3635
function.trader-cdlabandonedbaby.php               24-Apr-2024 08:00                4023
function.trader-cdladvanceblock.php                24-Apr-2024 08:00                3588
function.trader-cdlbelthold.php                    24-Apr-2024 08:00                3544
function.trader-cdlbreakaway.php                   24-Apr-2024 08:00                3558
function.trader-cdlclosingmarubozu.php             24-Apr-2024 08:00                3629
function.trader-cdlconcealbabyswall.php            24-Apr-2024 08:00                3652
function.trader-cdlcounterattack.php               24-Apr-2024 08:00                3616
function.trader-cdldarkcloudcover.php              24-Apr-2024 08:00                4017
function.trader-cdldoji.php                        24-Apr-2024 08:00                3501
function.trader-cdldojistar.php                    24-Apr-2024 08:00                3536
function.trader-cdldragonflydoji.php               24-Apr-2024 08:00                3591
function.trader-cdlengulfing.php                   24-Apr-2024 08:00                3576
function.trader-cdleveningdojistar.php             24-Apr-2024 08:00                4034
function.trader-cdleveningstar.php                 24-Apr-2024 08:00                4011
function.trader-cdlgapsidesidewhite.php            24-Apr-2024 08:00                3659
function.trader-cdlgravestonedoji.php              24-Apr-2024 08:00                3612
function.trader-cdlhammer.php                      24-Apr-2024 08:00                3527
function.trader-cdlhangingman.php                  24-Apr-2024 08:00                3548
function.trader-cdlharami.php                      24-Apr-2024 08:00                3529
function.trader-cdlharamicross.php                 24-Apr-2024 08:00                3571
function.trader-cdlhighwave.php                    24-Apr-2024 08:00                3545
function.trader-cdlhikkake.php                     24-Apr-2024 08:00                3534
function.trader-cdlhikkakemod.php                  24-Apr-2024 08:00                3575
function.trader-cdlhomingpigeon.php                24-Apr-2024 08:00                3596
function.trader-cdlidentical3crows.php             24-Apr-2024 08:00                3620
function.trader-cdlinneck.php                      24-Apr-2024 08:00                3546
function.trader-cdlinvertedhammer.php              24-Apr-2024 08:00                3594
function.trader-cdlkicking.php                     24-Apr-2024 08:00                3548
function.trader-cdlkickingbylength.php             24-Apr-2024 08:00                3654
function.trader-cdlladderbottom.php                24-Apr-2024 08:00                3604
function.trader-cdllongleggeddoji.php              24-Apr-2024 08:00                3609
function.trader-cdllongline.php                    24-Apr-2024 08:00                3553
function.trader-cdlmarubozu.php                    24-Apr-2024 08:00                3539
function.trader-cdlmatchinglow.php                 24-Apr-2024 08:00                3565
function.trader-cdlmathold.php                     24-Apr-2024 08:00                3957
function.trader-cdlmorningdojistar.php             24-Apr-2024 08:00                4030
function.trader-cdlmorningstar.php                 24-Apr-2024 08:00                3991
function.trader-cdlonneck.php                      24-Apr-2024 08:00                3526
function.trader-cdlpiercing.php                    24-Apr-2024 08:00                3543
function.trader-cdlrickshawman.php                 24-Apr-2024 08:00                3583
function.trader-cdlrisefall3methods.php            24-Apr-2024 08:00                3653
function.trader-cdlseparatinglines.php             24-Apr-2024 08:00                3635
function.trader-cdlshootingstar.php                24-Apr-2024 08:00                3594
function.trader-cdlshortline.php                   24-Apr-2024 08:00                3566
function.trader-cdlspinningtop.php                 24-Apr-2024 08:00                3581
function.trader-cdlstalledpattern.php              24-Apr-2024 08:00                3616
function.trader-cdlsticksandwich.php               24-Apr-2024 08:00                3597
function.trader-cdltakuri.php                      24-Apr-2024 08:00                3568
function.trader-cdltasukigap.php                   24-Apr-2024 08:00                3543
function.trader-cdlthrusting.php                   24-Apr-2024 08:00                3552
function.trader-cdltristar.php                     24-Apr-2024 08:00                3540
function.trader-cdlunique3river.php                24-Apr-2024 08:00                3591
function.trader-cdlupsidegap2crows.php             24-Apr-2024 08:00                3639
function.trader-cdlxsidegap3methods.php            24-Apr-2024 08:00                3638
function.trader-ceil.php                           24-Apr-2024 08:00                2543
function.trader-cmo.php                            24-Apr-2024 08:00                2760
function.trader-correl.php                         24-Apr-2024 08:00                3099
function.trader-cos.php                            24-Apr-2024 08:00                2509
function.trader-cosh.php                           24-Apr-2024 08:00                2525
function.trader-dema.php                           24-Apr-2024 08:00                2771
function.trader-div.php                            24-Apr-2024 08:00                2858
function.trader-dx.php                             24-Apr-2024 08:00                3487
function.trader-ema.php                            24-Apr-2024 08:00                2754
function.trader-errno.php                          24-Apr-2024 08:00                2234
function.trader-exp.php                            24-Apr-2024 08:00                2553
function.trader-floor.php                          24-Apr-2024 08:00                2535
function.trader-get-compat.php                     24-Apr-2024 08:00                2424
function.trader-get-unstable-period.php            24-Apr-2024 08:00                2757
function.trader-ht-dcperiod.php                    24-Apr-2024 08:00                2523
function.trader-ht-dcphase.php                     24-Apr-2024 08:00                2494
function.trader-ht-phasor.php                      24-Apr-2024 08:00                2475
function.trader-ht-sine.php                        24-Apr-2024 08:00                2454
function.trader-ht-trendline.php                   24-Apr-2024 08:00                2515
function.trader-ht-trendmode.php                   24-Apr-2024 08:00                2505
function.trader-kama.php                           24-Apr-2024 08:00                2809
function.trader-linearreg-angle.php                24-Apr-2024 08:00                2903
function.trader-linearreg-intercept.php            24-Apr-2024 08:00                2961
function.trader-linearreg-slope.php                24-Apr-2024 08:00                2913
function.trader-linearreg.php                      24-Apr-2024 08:00                2825
function.trader-ln.php                             24-Apr-2024 08:00                2511
function.trader-log10.php                          24-Apr-2024 08:00                2515
function.trader-ma.php                             24-Apr-2024 08:00                3175
function.trader-macd.php                           24-Apr-2024 08:00                3696
function.trader-macdext.php                        24-Apr-2024 08:00                5189
function.trader-macdfix.php                        24-Apr-2024 08:00                2855
function.trader-mama.php                           24-Apr-2024 08:00                3196
function.trader-mavp.php                           24-Apr-2024 08:00                4103
function.trader-max.php                            24-Apr-2024 08:00                2775
function.trader-maxindex.php                       24-Apr-2024 08:00                2832
function.trader-medprice.php                       24-Apr-2024 08:00                2746
function.trader-mfi.php                            24-Apr-2024 08:00                3850
function.trader-midpoint.php                       24-Apr-2024 08:00                2806
function.trader-midprice.php                       24-Apr-2024 08:00                3130
function.trader-min.php                            24-Apr-2024 08:00                2782
function.trader-minindex.php                       24-Apr-2024 08:00                2827
function.trader-minmax.php                         24-Apr-2024 08:00                2831
function.trader-minmaxindex.php                    24-Apr-2024 08:00                2882
function.trader-minus-di.php                       24-Apr-2024 08:00                3574
function.trader-minus-dm.php                       24-Apr-2024 08:00                3130
function.trader-mom.php                            24-Apr-2024 08:00                2746
function.trader-mult.php                           24-Apr-2024 08:00                2858
function.trader-natr.php                           24-Apr-2024 08:00                3512
function.trader-obv.php                            24-Apr-2024 08:00                2699
function.trader-plus-di.php                        24-Apr-2024 08:00                3545
function.trader-plus-dm.php                        24-Apr-2024 08:00                3117
function.trader-ppo.php                            24-Apr-2024 08:00                3715
function.trader-roc.php                            24-Apr-2024 08:00                2770
function.trader-rocp.php                           24-Apr-2024 08:00                2798
function.trader-rocr.php                           24-Apr-2024 08:00                2783
function.trader-rocr100.php                        24-Apr-2024 08:00                2823
function.trader-rsi.php                            24-Apr-2024 08:00                2751
function.trader-sar.php                            24-Apr-2024 08:00                3761
function.trader-sarext.php                         24-Apr-2024 08:00                7173
function.trader-set-compat.php                     24-Apr-2024 08:00                2661
function.trader-set-unstable-period.php            24-Apr-2024 08:00                3249
function.trader-sin.php                            24-Apr-2024 08:00                2533
function.trader-sinh.php                           24-Apr-2024 08:00                2521
function.trader-sma.php                            24-Apr-2024 08:00                2751
function.trader-sqrt.php                           24-Apr-2024 08:00                2514
function.trader-stddev.php                         24-Apr-2024 08:00                3095
function.trader-stoch.php                          24-Apr-2024 08:00                5379
function.trader-stochf.php                         24-Apr-2024 08:00                4486
function.trader-stochrsi.php                       24-Apr-2024 08:00                4228
function.trader-sub.php                            24-Apr-2024 08:00                2863
function.trader-sum.php                            24-Apr-2024 08:00                2733
function.trader-t3.php                             24-Apr-2024 08:00                3112
function.trader-tan.php                            24-Apr-2024 08:00                2502
function.trader-tanh.php                           24-Apr-2024 08:00                2526
function.trader-tema.php                           24-Apr-2024 08:00                2777
function.trader-trange.php                         24-Apr-2024 08:00                3034
function.trader-trima.php                          24-Apr-2024 08:00                2779
function.trader-trix.php                           24-Apr-2024 08:00                2789
function.trader-tsf.php                            24-Apr-2024 08:00                2758
function.trader-typprice.php                       24-Apr-2024 08:00                3057
function.trader-ultosc.php                         24-Apr-2024 08:00                4369
function.trader-var.php                            24-Apr-2024 08:00                3065
function.trader-wclprice.php                       24-Apr-2024 08:00                3062
function.trader-willr.php                          24-Apr-2024 08:00                3518
function.trader-wma.php                            24-Apr-2024 08:00                2765
function.trait-exists.php                          24-Apr-2024 08:00                3104
function.trigger-error.php                         24-Apr-2024 08:00                7841
function.trim.php                                  24-Apr-2024 08:00               13624
function.uasort.php                                24-Apr-2024 08:00               10357
function.ucfirst.php                               24-Apr-2024 08:00                6047
function.ucwords.php                               24-Apr-2024 08:00                9663
function.ui-draw-text-font-fontfamilies.php        24-Apr-2024 08:00                2437
function.ui-quit.php                               24-Apr-2024 08:00                2074
function.ui-run.php                                24-Apr-2024 08:00                2457
function.uksort.php                                24-Apr-2024 08:00                9774
function.umask.php                                 24-Apr-2024 08:00                5682
function.uniqid.php                                24-Apr-2024 08:00                8308
function.unixtojd.php                              24-Apr-2024 08:00                3895
function.unlink.php                                24-Apr-2024 08:00                6095
function.unpack.php                                24-Apr-2024 08:00               10511
function.unregister-tick-function.php              24-Apr-2024 08:00                3192
function.unserialize.php                           24-Apr-2024 08:00               17517
function.unset.php                                 24-Apr-2024 08:00               15138
function.untaint.php                               24-Apr-2024 08:00                2568
function.uopz-add-function.php                     24-Apr-2024 08:00                7158
function.uopz-allow-exit.php                       24-Apr-2024 08:00                4648
function.uopz-backup.php                           24-Apr-2024 08:00                4610
function.uopz-compose.php                          24-Apr-2024 08:00                6882
function.uopz-copy.php                             24-Apr-2024 08:00                5197
function.uopz-del-function.php                     24-Apr-2024 08:00                6595
function.uopz-delete.php                           24-Apr-2024 08:00                6022
function.uopz-extend.php                           24-Apr-2024 08:00                5051
function.uopz-flags.php                            24-Apr-2024 08:00               10982
function.uopz-function.php                         24-Apr-2024 08:00                7348
function.uopz-get-exit-status.php                  24-Apr-2024 08:00                4202
function.uopz-get-hook.php                         24-Apr-2024 08:00                5369
function.uopz-get-mock.php                         24-Apr-2024 08:00                4984
function.uopz-get-property.php                     24-Apr-2024 08:00                6232
function.uopz-get-return.php                       24-Apr-2024 08:00                4475
function.uopz-get-static.php                       24-Apr-2024 08:00                5184
function.uopz-implement.php                        24-Apr-2024 08:00                5076
function.uopz-overload.php                         24-Apr-2024 08:00                3963
function.uopz-redefine.php                         24-Apr-2024 08:00                5160
function.uopz-rename.php                           24-Apr-2024 08:00                6801
function.uopz-restore.php                          24-Apr-2024 08:00                4980
function.uopz-set-hook.php                         24-Apr-2024 08:00                5678
function.uopz-set-mock.php                         24-Apr-2024 08:00               10822
function.uopz-set-property.php                     24-Apr-2024 08:00                7527
function.uopz-set-return.php                       24-Apr-2024 08:00                9665
function.uopz-set-static.php                       24-Apr-2024 08:00                5780
function.uopz-undefine.php                         24-Apr-2024 08:00                4718
function.uopz-unset-hook.php                       24-Apr-2024 08:00                5569
function.uopz-unset-mock.php                       24-Apr-2024 08:00                5340
function.uopz-unset-return.php                     24-Apr-2024 08:00                4951
function.urldecode.php                             24-Apr-2024 08:00                6297
function.urlencode.php                             24-Apr-2024 08:00                9620
function.use-soap-error-handler.php                24-Apr-2024 08:00                3945
function.user-error.php                            24-Apr-2024 08:00                1740
function.usleep.php                                24-Apr-2024 08:00                6867
function.usort.php                                 24-Apr-2024 08:00               27064
function.utf8-decode.php                           24-Apr-2024 08:00               18675
function.utf8-encode.php                           24-Apr-2024 08:00               15241
function.var-dump.php                              24-Apr-2024 08:00                6891
function.var-export.php                            24-Apr-2024 08:00               16412
function.var-representation.php                    24-Apr-2024 08:00               13340
function.variant-abs.php                           24-Apr-2024 08:00                4207
function.variant-add.php                           24-Apr-2024 08:00                5535
function.variant-and.php                           24-Apr-2024 08:00                7627
function.variant-cast.php                          24-Apr-2024 08:00                3560
function.variant-cat.php                           24-Apr-2024 08:00                4741
function.variant-cmp.php                           24-Apr-2024 08:00                8042
function.variant-date-from-timestamp.php           24-Apr-2024 08:00                3675
function.variant-date-to-timestamp.php             24-Apr-2024 08:00                3799
function.variant-div.php                           24-Apr-2024 08:00                6446
function.variant-eqv.php                           24-Apr-2024 08:00                4478
function.variant-fix.php                           24-Apr-2024 08:00                5519
function.variant-get-type.php                      24-Apr-2024 08:00                3550
function.variant-idiv.php                          24-Apr-2024 08:00                5812
function.variant-imp.php                           24-Apr-2024 08:00                7179
function.variant-int.php                           24-Apr-2024 08:00                5017
function.variant-mod.php                           24-Apr-2024 08:00                4815
function.variant-mul.php                           24-Apr-2024 08:00                5927
function.variant-neg.php                           24-Apr-2024 08:00                3880
function.variant-not.php                           24-Apr-2024 08:00                4146
function.variant-or.php                            24-Apr-2024 08:00                7783
function.variant-pow.php                           24-Apr-2024 08:00                4660
function.variant-round.php                         24-Apr-2024 08:00                4540
function.variant-set-type.php                      24-Apr-2024 08:00                3689
function.variant-set.php                           24-Apr-2024 08:00                2923
function.variant-sub.php                           24-Apr-2024 08:00                5497
function.variant-xor.php                           24-Apr-2024 08:00                6522
function.version-compare.php                       24-Apr-2024 08:00               11432
function.vfprintf.php                              24-Apr-2024 08:00               20366
function.virtual.php                               24-Apr-2024 08:00                5281
function.vprintf.php                               24-Apr-2024 08:00               19776
function.vsprintf.php                              24-Apr-2024 08:00               19657
function.wddx-add-vars.php                         24-Apr-2024 08:00                3792
function.wddx-deserialize.php                      24-Apr-2024 08:00                3560
function.wddx-packet-end.php                       24-Apr-2024 08:00                2874
function.wddx-packet-start.php                     24-Apr-2024 08:00                3053
function.wddx-serialize-value.php                  24-Apr-2024 08:00                3283
function.wddx-serialize-vars.php                   24-Apr-2024 08:00                6009
function.win32-continue-service.php                24-Apr-2024 08:00                6739
function.win32-create-service.php                  24-Apr-2024 08:00               28828
function.win32-delete-service.php                  24-Apr-2024 08:00                7198
function.win32-get-last-control-message.php        24-Apr-2024 08:00                8573
function.win32-pause-service.php                   24-Apr-2024 08:00                6737
function.win32-query-service-status.php            24-Apr-2024 08:00                8823
function.win32-send-custom-control.php             24-Apr-2024 08:00                7401
function.win32-set-service-exit-code.php           24-Apr-2024 08:00                5901
function.win32-set-service-exit-mode.php           24-Apr-2024 08:00                6049
function.win32-set-service-status.php              24-Apr-2024 08:00                9339
function.win32-start-service-ctrl-dispatcher.php   24-Apr-2024 08:00               11373
function.win32-start-service.php                   24-Apr-2024 08:00                6741
function.win32-stop-service.php                    24-Apr-2024 08:00                6662
function.wincache-fcache-fileinfo.php              24-Apr-2024 08:00                9298
function.wincache-fcache-meminfo.php               24-Apr-2024 08:00                7118
function.wincache-lock.php                         24-Apr-2024 08:00                8556
function.wincache-ocache-fileinfo.php              24-Apr-2024 08:00                9960
function.wincache-ocache-meminfo.php               24-Apr-2024 08:00                7305
function.wincache-refresh-if-changed.php           24-Apr-2024 08:00                7858
function.wincache-rplist-fileinfo.php              24-Apr-2024 08:00                7665
function.wincache-rplist-meminfo.php               24-Apr-2024 08:00                7233
function.wincache-scache-info.php                  24-Apr-2024 08:00                9583
function.wincache-scache-meminfo.php               24-Apr-2024 08:00                6720
function.wincache-ucache-add.php                   24-Apr-2024 08:00               13614
function.wincache-ucache-cas.php                   24-Apr-2024 08:00                6516
function.wincache-ucache-clear.php                 24-Apr-2024 08:00                7610
function.wincache-ucache-dec.php                   24-Apr-2024 08:00                6468
function.wincache-ucache-delete.php                24-Apr-2024 08:00               11423
function.wincache-ucache-exists.php                24-Apr-2024 08:00                6222
function.wincache-ucache-get.php                   24-Apr-2024 08:00               10617
function.wincache-ucache-inc.php                   24-Apr-2024 08:00                6460
function.wincache-ucache-info.php                  24-Apr-2024 08:00               11404
function.wincache-ucache-meminfo.php               24-Apr-2024 08:00                6909
function.wincache-ucache-set.php                   24-Apr-2024 08:00               13680
function.wincache-unlock.php                       24-Apr-2024 08:00                7841
function.wordwrap.php                              24-Apr-2024 08:00                9271
function.xattr-get.php                             24-Apr-2024 08:00                6085
function.xattr-list.php                            24-Apr-2024 08:00                6536
function.xattr-remove.php                          24-Apr-2024 08:00                6318
function.xattr-set.php                             24-Apr-2024 08:00                8063
function.xattr-supported.php                       24-Apr-2024 08:00                5370
function.xdiff-file-bdiff-size.php                 24-Apr-2024 08:00                4881
function.xdiff-file-bdiff.php                      24-Apr-2024 08:00                5978
function.xdiff-file-bpatch.php                     24-Apr-2024 08:00                6535
function.xdiff-file-diff-binary.php                24-Apr-2024 08:00                6400
function.xdiff-file-diff.php                       24-Apr-2024 08:00                7415
function.xdiff-file-merge3.php                     24-Apr-2024 08:00                6843
function.xdiff-file-patch-binary.php               24-Apr-2024 08:00                6688
function.xdiff-file-patch.php                      24-Apr-2024 08:00                8951
function.xdiff-file-rabdiff.php                    24-Apr-2024 08:00                6534
function.xdiff-string-bdiff-size.php               24-Apr-2024 08:00                5196
function.xdiff-string-bdiff.php                    24-Apr-2024 08:00                3897
function.xdiff-string-bpatch.php                   24-Apr-2024 08:00                3995
function.xdiff-string-diff-binary.php              24-Apr-2024 08:00                4387
function.xdiff-string-diff.php                     24-Apr-2024 08:00                7667
function.xdiff-string-merge3.php                   24-Apr-2024 08:00                4844
function.xdiff-string-patch-binary.php             24-Apr-2024 08:00                4529
function.xdiff-string-patch.php                    24-Apr-2024 08:00                8317
function.xdiff-string-rabdiff.php                  24-Apr-2024 08:00                4499
function.xhprof-disable.php                        24-Apr-2024 08:00                4018
function.xhprof-enable.php                         24-Apr-2024 08:00                7147
function.xhprof-sample-disable.php                 24-Apr-2024 08:00                4700
function.xhprof-sample-enable.php                  24-Apr-2024 08:00                3508
function.xml-error-string.php                      24-Apr-2024 08:00                3377
function.xml-get-current-byte-index.php            24-Apr-2024 08:00                4444
function.xml-get-current-column-number.php         24-Apr-2024 08:00                4290
function.xml-get-current-line-number.php           24-Apr-2024 08:00                4092
function.xml-get-error-code.php                    24-Apr-2024 08:00                3749
function.xml-parse-into-struct.php                 24-Apr-2024 08:00               19452
function.xml-parse.php                             24-Apr-2024 08:00                8297
function.xml-parser-create-ns.php                  24-Apr-2024 08:00                5468
function.xml-parser-create.php                     24-Apr-2024 08:00                5020
function.xml-parser-free.php                       24-Apr-2024 08:00                4117
function.xml-parser-get-option.php                 24-Apr-2024 08:00                5994
function.xml-parser-set-option.php                 24-Apr-2024 08:00                7953
function.xml-set-character-data-handler.php        24-Apr-2024 08:00                5702
function.xml-set-default-handler.php               24-Apr-2024 08:00                5609
function.xml-set-element-handler.php               24-Apr-2024 08:00                9047
function.xml-set-end-namespace-decl-handler.php    24-Apr-2024 08:00                6534
function.xml-set-external-entity-ref-handler.php   24-Apr-2024 08:00                8569
function.xml-set-notation-decl-handler.php         24-Apr-2024 08:00                7799
function.xml-set-object.php                        24-Apr-2024 08:00                9251
function.xml-set-processing-instruction-handler..> 24-Apr-2024 08:00                6724
function.xml-set-start-namespace-decl-handler.php  24-Apr-2024 08:00                6870
function.xml-set-unparsed-entity-decl-handler.php  24-Apr-2024 08:00                8637
function.xmlrpc-decode-request.php                 24-Apr-2024 08:00                2819
function.xmlrpc-decode.php                         24-Apr-2024 08:00                4111
function.xmlrpc-encode-request.php                 24-Apr-2024 08:00                8526
function.xmlrpc-encode.php                         24-Apr-2024 08:00                2399
function.xmlrpc-get-type.php                       24-Apr-2024 08:00                6315
function.xmlrpc-is-fault.php                       24-Apr-2024 08:00                3916
function.xmlrpc-parse-method-descriptions.php      24-Apr-2024 08:00                2596
function.xmlrpc-server-add-introspection-data.php  24-Apr-2024 08:00                2794
function.xmlrpc-server-call-method.php             24-Apr-2024 08:00                3202
function.xmlrpc-server-create.php                  24-Apr-2024 08:00                2316
function.xmlrpc-server-destroy.php                 24-Apr-2024 08:00                2524
function.xmlrpc-server-register-introspection-c..> 24-Apr-2024 08:00                2878
function.xmlrpc-server-register-method.php         24-Apr-2024 08:00                2955
function.xmlrpc-set-type.php                       24-Apr-2024 08:00                5484
function.yaml-emit-file.php                        24-Apr-2024 08:00                6765
function.yaml-emit.php                             24-Apr-2024 08:00               12353
function.yaml-parse-file.php                       24-Apr-2024 08:00                6086
function.yaml-parse-url.php                        24-Apr-2024 08:00                6414
function.yaml-parse.php                            24-Apr-2024 08:00                9944
function.yaz-addinfo.php                           24-Apr-2024 08:00                3429
function.yaz-ccl-conf.php                          24-Apr-2024 08:00                5720
function.yaz-ccl-parse.php                         24-Apr-2024 08:00                6772
function.yaz-close.php                             24-Apr-2024 08:00                3571
function.yaz-connect.php                           24-Apr-2024 08:00                9137
function.yaz-database.php                          24-Apr-2024 08:00                3459
function.yaz-element.php                           24-Apr-2024 08:00                3891
function.yaz-errno.php                             24-Apr-2024 08:00                3664
function.yaz-error.php                             24-Apr-2024 08:00                3419
function.yaz-es-result.php                         24-Apr-2024 08:00                3337
function.yaz-es.php                                24-Apr-2024 08:00                7178
function.yaz-get-option.php                        24-Apr-2024 08:00                3414
function.yaz-hits.php                              24-Apr-2024 08:00                4902
function.yaz-itemorder.php                         24-Apr-2024 08:00                7088
function.yaz-present.php                           24-Apr-2024 08:00                3035
function.yaz-range.php                             24-Apr-2024 08:00                3649
function.yaz-record.php                            24-Apr-2024 08:00               14256
function.yaz-scan-result.php                       24-Apr-2024 08:00                4053
function.yaz-scan.php                              24-Apr-2024 08:00                9384
function.yaz-schema.php                            24-Apr-2024 08:00                3485
function.yaz-search.php                            24-Apr-2024 08:00                8719
function.yaz-set-option.php                        24-Apr-2024 08:00                7048
function.yaz-sort.php                              24-Apr-2024 08:00                5608
function.yaz-syntax.php                            24-Apr-2024 08:00                3443
function.yaz-wait.php                              24-Apr-2024 08:00                4162
function.zend-thread-id.php                        24-Apr-2024 08:00                3764
function.zend-version.php                          24-Apr-2024 08:00                3933
function.zip-close.php                             24-Apr-2024 08:00                3924
function.zip-entry-close.php                       24-Apr-2024 08:00                4156
function.zip-entry-compressedsize.php              24-Apr-2024 08:00                4450
function.zip-entry-compressionmethod.php           24-Apr-2024 08:00                4550
function.zip-entry-filesize.php                    24-Apr-2024 08:00                4379
function.zip-entry-name.php                        24-Apr-2024 08:00                4312
function.zip-entry-open.php                        24-Apr-2024 08:00                5825
function.zip-entry-read.php                        24-Apr-2024 08:00                5047
function.zip-open.php                              24-Apr-2024 08:00                4490
function.zip-read.php                              24-Apr-2024 08:00                4653
function.zlib-decode.php                           24-Apr-2024 08:00                3463
function.zlib-encode.php                           24-Apr-2024 08:00                5394
function.zlib-get-coding-type.php                  24-Apr-2024 08:00                2920
function.zookeeper-dispatch.php                    24-Apr-2024 08:00                8335
functional.parallel.php                            24-Apr-2024 08:00                2611
functions.anonymous.php                            24-Apr-2024 08:00               23842
functions.arguments.php                            24-Apr-2024 08:00               42388
functions.arrow.php                                24-Apr-2024 08:00               10043
functions.first_class_callable_syntax.php          24-Apr-2024 08:00               11138
functions.internal.php                             24-Apr-2024 08:00                7631
functions.returning-values.php                     24-Apr-2024 08:00                6165
functions.user-defined.php                         24-Apr-2024 08:00                9190
functions.variable-functions.php                   24-Apr-2024 08:00               11412
gearman.configuration.php                          24-Apr-2024 08:00                1280
gearman.constants.php                              24-Apr-2024 08:00               23870
gearman.examples-reverse-bg.php                    24-Apr-2024 08:00               10718
gearman.examples-reverse-task.php                  24-Apr-2024 08:00               17367
gearman.examples-reverse.php                       24-Apr-2024 08:00               12793
gearman.examples.php                               24-Apr-2024 08:00                1629
gearman.installation.php                           24-Apr-2024 08:00                1608
gearman.requirements.php                           24-Apr-2024 08:00                1531
gearman.resources.php                              24-Apr-2024 08:00                1255
gearman.setup.php                                  24-Apr-2024 08:00                1636
gearmanclient.addoptions.php                       24-Apr-2024 08:00                3369
gearmanclient.addserver.php                        24-Apr-2024 08:00                5472
gearmanclient.addservers.php                       24-Apr-2024 08:00                4924
gearmanclient.addtask.php                          24-Apr-2024 08:00               15145
gearmanclient.addtaskbackground.php                24-Apr-2024 08:00               20909
gearmanclient.addtaskhigh.php                      24-Apr-2024 08:00               11654
gearmanclient.addtaskhighbackground.php            24-Apr-2024 08:00                6569
gearmanclient.addtasklow.php                       24-Apr-2024 08:00               11636
gearmanclient.addtasklowbackground.php             24-Apr-2024 08:00                6562
gearmanclient.addtaskstatus.php                    24-Apr-2024 08:00                9840
gearmanclient.clearcallbacks.php                   24-Apr-2024 08:00                4375
gearmanclient.clone.php                            24-Apr-2024 08:00                2676
gearmanclient.construct.php                        24-Apr-2024 08:00                2849
gearmanclient.context.php                          24-Apr-2024 08:00                2917
gearmanclient.data.php                             24-Apr-2024 08:00                3182
gearmanclient.do.php                               24-Apr-2024 08:00               22171
gearmanclient.dobackground.php                     24-Apr-2024 08:00                9662
gearmanclient.dohigh.php                           24-Apr-2024 08:00                5120
gearmanclient.dohighbackground.php                 24-Apr-2024 08:00                4947
gearmanclient.dojobhandle.php                      24-Apr-2024 08:00                2974
gearmanclient.dolow.php                            24-Apr-2024 08:00                5106
gearmanclient.dolowbackground.php                  24-Apr-2024 08:00                4929
gearmanclient.donormal.php                         24-Apr-2024 08:00               22739
gearmanclient.dostatus.php                         24-Apr-2024 08:00                8151
gearmanclient.echo.php                             24-Apr-2024 08:00                3003
gearmanclient.error.php                            24-Apr-2024 08:00                2909
gearmanclient.geterrno.php                         24-Apr-2024 08:00                2684
gearmanclient.jobstatus.php                        24-Apr-2024 08:00                8339
gearmanclient.ping.php                             24-Apr-2024 08:00                2976
gearmanclient.removeoptions.php                    24-Apr-2024 08:00                2717
gearmanclient.returncode.php                       24-Apr-2024 08:00                2332
gearmanclient.runtasks.php                         24-Apr-2024 08:00                3722
gearmanclient.setclientcallback.php                24-Apr-2024 08:00                5374
gearmanclient.setcompletecallback.php              24-Apr-2024 08:00                5260
gearmanclient.setcontext.php                       24-Apr-2024 08:00                3257
gearmanclient.setcreatedcallback.php               24-Apr-2024 08:00                4799
gearmanclient.setdata.php                          24-Apr-2024 08:00                3455
gearmanclient.setdatacallback.php                  24-Apr-2024 08:00                4784
gearmanclient.setexceptioncallback.php             24-Apr-2024 08:00                4704
gearmanclient.setfailcallback.php                  24-Apr-2024 08:00                4790
gearmanclient.setoptions.php                       24-Apr-2024 08:00                2703
gearmanclient.setstatuscallback.php                24-Apr-2024 08:00                4790
gearmanclient.settimeout.php                       24-Apr-2024 08:00                2747
gearmanclient.setwarningcallback.php               24-Apr-2024 08:00                4793
gearmanclient.setworkloadcallback.php              24-Apr-2024 08:00                4947
gearmanclient.timeout.php                          24-Apr-2024 08:00                2779
gearmanclient.wait.php                             24-Apr-2024 08:00                2826
gearmanjob.complete.php                            24-Apr-2024 08:00                3597
gearmanjob.construct.php                           24-Apr-2024 08:00                2366
gearmanjob.data.php                                24-Apr-2024 08:00                3557
gearmanjob.exception.php                           24-Apr-2024 08:00                3764
gearmanjob.fail.php                                24-Apr-2024 08:00                3683
gearmanjob.functionname.php                        24-Apr-2024 08:00                2955
gearmanjob.handle.php                              24-Apr-2024 08:00                2842
gearmanjob.returncode.php                          24-Apr-2024 08:00                2639
gearmanjob.sendcomplete.php                        24-Apr-2024 08:00                3318
gearmanjob.senddata.php                            24-Apr-2024 08:00                3285
gearmanjob.sendexception.php                       24-Apr-2024 08:00                3498
gearmanjob.sendfail.php                            24-Apr-2024 08:00                3402
gearmanjob.sendstatus.php                          24-Apr-2024 08:00                4013
gearmanjob.sendwarning.php                         24-Apr-2024 08:00                3494
gearmanjob.setreturn.php                           24-Apr-2024 08:00                2589
gearmanjob.status.php                              24-Apr-2024 08:00                4294
gearmanjob.unique.php                              24-Apr-2024 08:00                3079
gearmanjob.warning.php                             24-Apr-2024 08:00                3775
gearmanjob.workload.php                            24-Apr-2024 08:00                2837
gearmanjob.workloadsize.php                        24-Apr-2024 08:00                2655
gearmantask.construct.php                          24-Apr-2024 08:00                2391
gearmantask.create.php                             24-Apr-2024 08:00                2815
gearmantask.data.php                               24-Apr-2024 08:00                2816
gearmantask.datasize.php                           24-Apr-2024 08:00                2839
gearmantask.function.php                           24-Apr-2024 08:00                2676
gearmantask.functionname.php                       24-Apr-2024 08:00                2613
gearmantask.isknown.php                            24-Apr-2024 08:00                2489
gearmantask.isrunning.php                          24-Apr-2024 08:00                2489
gearmantask.jobhandle.php                          24-Apr-2024 08:00                2988
gearmantask.recvdata.php                           24-Apr-2024 08:00                3520
gearmantask.returncode.php                         24-Apr-2024 08:00                2666
gearmantask.senddata.php                           24-Apr-2024 08:00                3333
gearmantask.sendworkload.php                       24-Apr-2024 08:00                3482
gearmantask.taskdenominator.php                    24-Apr-2024 08:00                3032
gearmantask.tasknumerator.php                      24-Apr-2024 08:00                3004
gearmantask.unique.php                             24-Apr-2024 08:00                3249
gearmantask.uuid.php                               24-Apr-2024 08:00                3422
gearmanworker.addfunction.php                      24-Apr-2024 08:00                7910
gearmanworker.addoptions.php                       24-Apr-2024 08:00                3415
gearmanworker.addserver.php                        24-Apr-2024 08:00                5199
gearmanworker.addservers.php                       24-Apr-2024 08:00                4646
gearmanworker.clone.php                            24-Apr-2024 08:00                2347
gearmanworker.construct.php                        24-Apr-2024 08:00                2822
gearmanworker.echo.php                             24-Apr-2024 08:00                3051
gearmanworker.error.php                            24-Apr-2024 08:00                2876
gearmanworker.geterrno.php                         24-Apr-2024 08:00                2651
gearmanworker.options.php                          24-Apr-2024 08:00                2658
gearmanworker.register.php                         24-Apr-2024 08:00                3808
gearmanworker.removeoptions.php                    24-Apr-2024 08:00                3437
gearmanworker.returncode.php                       24-Apr-2024 08:00                2846
gearmanworker.setid.php                            24-Apr-2024 08:00                4102
gearmanworker.setoptions.php                       24-Apr-2024 08:00                3570
gearmanworker.settimeout.php                       24-Apr-2024 08:00                7817
gearmanworker.timeout.php                          24-Apr-2024 08:00                2758
gearmanworker.unregister.php                       24-Apr-2024 08:00                3372
gearmanworker.unregisterall.php                    24-Apr-2024 08:00                3022
gearmanworker.wait.php                             24-Apr-2024 08:00                7881
gearmanworker.work.php                             24-Apr-2024 08:00                5583
gender-gender.connect.php                          24-Apr-2024 08:00                2587
gender-gender.construct.php                        24-Apr-2024 08:00                2442
gender-gender.country.php                          24-Apr-2024 08:00                3825
gender-gender.get.php                              24-Apr-2024 08:00                2903
gender-gender.isnick.php                           24-Apr-2024 08:00                3494
gender-gender.similarnames.php                     24-Apr-2024 08:00                3016
gender.example.admin.php                           24-Apr-2024 08:00                8101
gender.examples.php                                24-Apr-2024 08:00                1406
gender.installation.php                            24-Apr-2024 08:00                1992
gender.setup.php                                   24-Apr-2024 08:00                1420
generator.current.php                              24-Apr-2024 08:00                2132
generator.getreturn.php                            24-Apr-2024 08:00                3853
generator.key.php                                  24-Apr-2024 08:00                3919
generator.next.php                                 24-Apr-2024 08:00                2460
generator.rewind.php                               24-Apr-2024 08:00                2212
generator.send.php                                 24-Apr-2024 08:00                5554
generator.throw.php                                24-Apr-2024 08:00                5124
generator.valid.php                                24-Apr-2024 08:00                2338
generator.wakeup.php                               24-Apr-2024 08:00                2205
geoip.configuration.php                            24-Apr-2024 08:00                2486
geoip.constants.php                                24-Apr-2024 08:00                6320
geoip.installation.php                             24-Apr-2024 08:00                1736
geoip.requirements.php                             24-Apr-2024 08:00                1734
geoip.resources.php                                24-Apr-2024 08:00                1211
geoip.setup.php                                    24-Apr-2024 08:00                1597
gettext.configuration.php                          24-Apr-2024 08:00                1280
gettext.constants.php                              24-Apr-2024 08:00                1199
gettext.installation.php                           24-Apr-2024 08:00                1417
gettext.requirements.php                           24-Apr-2024 08:00                1408
gettext.resources.php                              24-Apr-2024 08:00                1225
gettext.setup.php                                  24-Apr-2024 08:00                1640
getting-started.php                                24-Apr-2024 08:00                1944
globiterator.construct.php                         24-Apr-2024 08:00                7706
globiterator.count.php                             24-Apr-2024 08:00                4448
gmagick.addimage.php                               24-Apr-2024 08:00                2881
gmagick.addnoiseimage.php                          24-Apr-2024 08:00                2936
gmagick.annotateimage.php                          24-Apr-2024 08:00                4471
gmagick.blurimage.php                              24-Apr-2024 08:00                3332
gmagick.borderimage.php                            24-Apr-2024 08:00                3781
gmagick.charcoalimage.php                          24-Apr-2024 08:00                3282
gmagick.chopimage.php                              24-Apr-2024 08:00                3934
gmagick.clear.php                                  24-Apr-2024 08:00                2623
gmagick.commentimage.php                           24-Apr-2024 08:00                2883
gmagick.compositeimage.php                         24-Apr-2024 08:00                4097
gmagick.configuration.php                          24-Apr-2024 08:00                1286
gmagick.constants.php                              24-Apr-2024 08:00              103180
gmagick.construct.php                              24-Apr-2024 08:00                2641
gmagick.cropimage.php                              24-Apr-2024 08:00                4069
gmagick.cropthumbnailimage.php                     24-Apr-2024 08:00                3319
gmagick.current.php                                24-Apr-2024 08:00                2524
gmagick.cyclecolormapimage.php                     24-Apr-2024 08:00                3009
gmagick.deconstructimages.php                      24-Apr-2024 08:00                2772
gmagick.despeckleimage.php                         24-Apr-2024 08:00                3464
gmagick.destroy.php                                24-Apr-2024 08:00                2742
gmagick.drawimage.php                              24-Apr-2024 08:00                3005
gmagick.edgeimage.php                              24-Apr-2024 08:00                2952
gmagick.embossimage.php                            24-Apr-2024 08:00                3460
gmagick.enhanceimage.php                           24-Apr-2024 08:00                2634
gmagick.equalizeimage.php                          24-Apr-2024 08:00                2593
gmagick.examples.php                               24-Apr-2024 08:00                3439
gmagick.flipimage.php                              24-Apr-2024 08:00                2927
gmagick.flopimage.php                              24-Apr-2024 08:00                2924
gmagick.frameimage.php                             24-Apr-2024 08:00                4606
gmagick.gammaimage.php                             24-Apr-2024 08:00                3163
gmagick.getcopyright.php                           24-Apr-2024 08:00                2615
gmagick.getfilename.php                            24-Apr-2024 08:00                2565
gmagick.getimagebackgroundcolor.php                24-Apr-2024 08:00                2702
gmagick.getimageblueprimary.php                    24-Apr-2024 08:00                3011
gmagick.getimagebordercolor.php                    24-Apr-2024 08:00                2746
gmagick.getimagechanneldepth.php                   24-Apr-2024 08:00                2807
gmagick.getimagecolors.php                         24-Apr-2024 08:00                2601
gmagick.getimagecolorspace.php                     24-Apr-2024 08:00                2559
gmagick.getimagecompose.php                        24-Apr-2024 08:00                2639
gmagick.getimagedelay.php                          24-Apr-2024 08:00                2536
gmagick.getimagedepth.php                          24-Apr-2024 08:00                2506
gmagick.getimagedispose.php                        24-Apr-2024 08:00                2560
gmagick.getimageextrema.php                        24-Apr-2024 08:00                2766
gmagick.getimagefilename.php                       24-Apr-2024 08:00                2644
gmagick.getimageformat.php                         24-Apr-2024 08:00                2627
gmagick.getimagegamma.php                          24-Apr-2024 08:00                2527
gmagick.getimagegreenprimary.php                   24-Apr-2024 08:00                2746
gmagick.getimageheight.php                         24-Apr-2024 08:00                2558
gmagick.getimagehistogram.php                      24-Apr-2024 08:00                2919
gmagick.getimageindex.php                          24-Apr-2024 08:00                2689
gmagick.getimageinterlacescheme.php                24-Apr-2024 08:00                2677
gmagick.getimageiterations.php                     24-Apr-2024 08:00                2604
gmagick.getimagematte.php                          24-Apr-2024 08:00                2944
gmagick.getimagemattecolor.php                     24-Apr-2024 08:00                2652
gmagick.getimageprofile.php                        24-Apr-2024 08:00                2759
gmagick.getimageredprimary.php                     24-Apr-2024 08:00                2767
gmagick.getimagerenderingintent.php                24-Apr-2024 08:00                2688
gmagick.getimageresolution.php                     24-Apr-2024 08:00                2620
gmagick.getimagescene.php                          24-Apr-2024 08:00                2523
gmagick.getimagesignature.php                      24-Apr-2024 08:00                2638
gmagick.getimagetype.php                           24-Apr-2024 08:00                2530
gmagick.getimageunits.php                          24-Apr-2024 08:00                2297
gmagick.getimagewhitepoint.php                     24-Apr-2024 08:00                2743
gmagick.getimagewidth.php                          24-Apr-2024 08:00                2537
gmagick.getpackagename.php                         24-Apr-2024 08:00                2591
gmagick.getquantumdepth.php                        24-Apr-2024 08:00                2768
gmagick.getreleasedate.php                         24-Apr-2024 08:00                2625
gmagick.getsamplingfactors.php                     24-Apr-2024 08:00                2678
gmagick.getsize.php                                24-Apr-2024 08:00                2827
gmagick.getversion.php                             24-Apr-2024 08:00                2568
gmagick.hasnextimage.php                           24-Apr-2024 08:00                2925
gmagick.haspreviousimage.php                       24-Apr-2024 08:00                2969
gmagick.implodeimage.php                           24-Apr-2024 08:00                2992
gmagick.installation.php                           24-Apr-2024 08:00                1963
gmagick.labelimage.php                             24-Apr-2024 08:00                2761
gmagick.levelimage.php                             24-Apr-2024 08:00                4712
gmagick.magnifyimage.php                           24-Apr-2024 08:00                2619
gmagick.mapimage.php                               24-Apr-2024 08:00                3297
gmagick.medianfilterimage.php                      24-Apr-2024 08:00                3081
gmagick.minifyimage.php                            24-Apr-2024 08:00                2653
gmagick.modulateimage.php                          24-Apr-2024 08:00                3910
gmagick.motionblurimage.php                        24-Apr-2024 08:00                3935
gmagick.newimage.php                               24-Apr-2024 08:00                3957
gmagick.nextimage.php                              24-Apr-2024 08:00                2763
gmagick.normalizeimage.php                         24-Apr-2024 08:00                3037
gmagick.oilpaintimage.php                          24-Apr-2024 08:00                3053
gmagick.previousimage.php                          24-Apr-2024 08:00                2758
gmagick.profileimage.php                           24-Apr-2024 08:00                3611
gmagick.quantizeimage.php                          24-Apr-2024 08:00                5380
gmagick.quantizeimages.php                         24-Apr-2024 08:00                5383
gmagick.queryfontmetrics.php                       24-Apr-2024 08:00                2946
gmagick.queryfonts.php                             24-Apr-2024 08:00                2722
gmagick.queryformats.php                           24-Apr-2024 08:00                3131
gmagick.radialblurimage.php                        24-Apr-2024 08:00                3257
gmagick.raiseimage.php                             24-Apr-2024 08:00                4448
gmagick.read.php                                   24-Apr-2024 08:00                2776
gmagick.readimage.php                              24-Apr-2024 08:00                2826
gmagick.readimageblob.php                          24-Apr-2024 08:00                3249
gmagick.readimagefile.php                          24-Apr-2024 08:00                3126
gmagick.reducenoiseimage.php                       24-Apr-2024 08:00                3231
gmagick.removeimage.php                            24-Apr-2024 08:00                2601
gmagick.removeimageprofile.php                     24-Apr-2024 08:00                2938
gmagick.requirements.php                           24-Apr-2024 08:00                1694
gmagick.resampleimage.php                          24-Apr-2024 08:00                3960
gmagick.resizeimage.php                            24-Apr-2024 08:00                4297
gmagick.rollimage.php                              24-Apr-2024 08:00                3036
gmagick.rotateimage.php                            24-Apr-2024 08:00                3211
gmagick.scaleimage.php                             24-Apr-2024 08:00                3579
gmagick.separateimagechannel.php                   24-Apr-2024 08:00                3223
gmagick.setcompressionquality.php                  24-Apr-2024 08:00                4230
gmagick.setfilename.php                            24-Apr-2024 08:00                2956
gmagick.setimagebackgroundcolor.php                24-Apr-2024 08:00                3025
gmagick.setimageblueprimary.php                    24-Apr-2024 08:00                3319
gmagick.setimagebordercolor.php                    24-Apr-2024 08:00                2987
gmagick.setimagechanneldepth.php                   24-Apr-2024 08:00                3466
gmagick.setimagecolorspace.php                     24-Apr-2024 08:00                3108
gmagick.setimagecompose.php                        24-Apr-2024 08:00                2874
gmagick.setimagedelay.php                          24-Apr-2024 08:00                2888
gmagick.setimagedepth.php                          24-Apr-2024 08:00                2886
gmagick.setimagedispose.php                        24-Apr-2024 08:00                2930
gmagick.setimagefilename.php                       24-Apr-2024 08:00                2980
gmagick.setimageformat.php                         24-Apr-2024 08:00                2943
gmagick.setimagegamma.php                          24-Apr-2024 08:00                2880
gmagick.setimagegreenprimary.php                   24-Apr-2024 08:00                3327
gmagick.setimageindex.php                          24-Apr-2024 08:00                3027
gmagick.setimageinterlacescheme.php                24-Apr-2024 08:00                3174
gmagick.setimageiterations.php                     24-Apr-2024 08:00                2983
gmagick.setimageprofile.php                        24-Apr-2024 08:00                3416
gmagick.setimageredprimary.php                     24-Apr-2024 08:00                3230
gmagick.setimagerenderingintent.php                24-Apr-2024 08:00                3205
gmagick.setimageresolution.php                     24-Apr-2024 08:00                3224
gmagick.setimagescene.php                          24-Apr-2024 08:00                2876
gmagick.setimagetype.php                           24-Apr-2024 08:00                3001
gmagick.setimageunits.php                          24-Apr-2024 08:00                3060
gmagick.setimagewhitepoint.php                     24-Apr-2024 08:00                3256
gmagick.setsamplingfactors.php                     24-Apr-2024 08:00                3102
gmagick.setsize.php                                24-Apr-2024 08:00                3572
gmagick.setup.php                                  24-Apr-2024 08:00                1564
gmagick.shearimage.php                             24-Apr-2024 08:00                3954
gmagick.solarizeimage.php                          24-Apr-2024 08:00                3134
gmagick.spreadimage.php                            24-Apr-2024 08:00                2978
gmagick.stripimage.php                             24-Apr-2024 08:00                2581
gmagick.swirlimage.php                             24-Apr-2024 08:00                3059
gmagick.thumbnailimage.php                         24-Apr-2024 08:00                3890
gmagick.trimimage.php                              24-Apr-2024 08:00                3123
gmagick.write.php                                  24-Apr-2024 08:00                1750
gmagick.writeimage.php                             24-Apr-2024 08:00                3535
gmagickdraw.annotate.php                           24-Apr-2024 08:00                3217
gmagickdraw.arc.php                                24-Apr-2024 08:00                4377
gmagickdraw.bezier.php                             24-Apr-2024 08:00                2656
gmagickdraw.ellipse.php                            24-Apr-2024 08:00                4298
gmagickdraw.getfillcolor.php                       24-Apr-2024 08:00                2467
gmagickdraw.getfillopacity.php                     24-Apr-2024 08:00                2418
gmagickdraw.getfont.php                            24-Apr-2024 08:00                2409
gmagickdraw.getfontsize.php                        24-Apr-2024 08:00                2460
gmagickdraw.getfontstyle.php                       24-Apr-2024 08:00                2536
gmagickdraw.getfontweight.php                      24-Apr-2024 08:00                2381
gmagickdraw.getstrokecolor.php                     24-Apr-2024 08:00                2522
gmagickdraw.getstrokeopacity.php                   24-Apr-2024 08:00                2495
gmagickdraw.getstrokewidth.php                     24-Apr-2024 08:00                2514
gmagickdraw.gettextdecoration.php                  24-Apr-2024 08:00                2448
gmagickdraw.gettextencoding.php                    24-Apr-2024 08:00                2537
gmagickdraw.line.php                               24-Apr-2024 08:00                3661
gmagickdraw.point.php                              24-Apr-2024 08:00                2948
gmagickdraw.polygon.php                            24-Apr-2024 08:00                2723
gmagickdraw.polyline.php                           24-Apr-2024 08:00                2758
gmagickdraw.rectangle.php                          24-Apr-2024 08:00                3765
gmagickdraw.rotate.php                             24-Apr-2024 08:00                2714
gmagickdraw.roundrectangle.php                     24-Apr-2024 08:00                4542
gmagickdraw.scale.php                              24-Apr-2024 08:00                3012
gmagickdraw.setfillcolor.php                       24-Apr-2024 08:00                2974
gmagickdraw.setfillopacity.php                     24-Apr-2024 08:00                2812
gmagickdraw.setfont.php                            24-Apr-2024 08:00                2712
gmagickdraw.setfontsize.php                        24-Apr-2024 08:00                2742
gmagickdraw.setfontstyle.php                       24-Apr-2024 08:00                2873
gmagickdraw.setfontweight.php                      24-Apr-2024 08:00                2744
gmagickdraw.setstrokecolor.php                     24-Apr-2024 08:00                2998
gmagickdraw.setstrokeopacity.php                   24-Apr-2024 08:00                2830
gmagickdraw.setstrokewidth.php                     24-Apr-2024 08:00                2790
gmagickdraw.settextdecoration.php                  24-Apr-2024 08:00                2876
gmagickdraw.settextencoding.php                    24-Apr-2024 08:00                3084
gmagickpixel.construct.php                         24-Apr-2024 08:00                2588
gmagickpixel.getcolor.php                          24-Apr-2024 08:00                4376
gmagickpixel.getcolorcount.php                     24-Apr-2024 08:00                2509
gmagickpixel.getcolorvalue.php                     24-Apr-2024 08:00                2920
gmagickpixel.setcolor.php                          24-Apr-2024 08:00                3051
gmagickpixel.setcolorvalue.php                     24-Apr-2024 08:00                3330
gmp.configuration.php                              24-Apr-2024 08:00                1258
gmp.constants.php                                  24-Apr-2024 08:00                4185
gmp.construct.php                                  24-Apr-2024 08:00                3767
gmp.examples.php                                   24-Apr-2024 08:00                3080
gmp.installation.php                               24-Apr-2024 08:00                1356
gmp.requirements.php                               24-Apr-2024 08:00                1739
gmp.serialize.php                                  24-Apr-2024 08:00                2274
gmp.setup.php                                      24-Apr-2024 08:00                1526
gmp.unserialize.php                                24-Apr-2024 08:00                2589
gnupg.configuration.php                            24-Apr-2024 08:00                1264
gnupg.constants.php                                24-Apr-2024 08:00                9426
gnupg.examples-clearsign.php                       24-Apr-2024 08:00                6356
gnupg.examples.php                                 24-Apr-2024 08:00                1411
gnupg.installation.php                             24-Apr-2024 08:00                1589
gnupg.requirements.php                             24-Apr-2024 08:00                1298
gnupg.resources.php                                24-Apr-2024 08:00                1211
gnupg.setup.php                                    24-Apr-2024 08:00                1615
hash.configuration.php                             24-Apr-2024 08:00                1259
hash.constants.php                                 24-Apr-2024 08:00                1841
hash.installation.php                              24-Apr-2024 08:00                1653
hash.requirements.php                              24-Apr-2024 08:00                1235
hash.resources.php                                 24-Apr-2024 08:00                1327
hash.setup.php                                     24-Apr-2024 08:00                1596
hashcontext.construct.php                          24-Apr-2024 08:00                1938
hashcontext.serialize.php                          24-Apr-2024 08:00                2403
hashcontext.unserialize.php                        24-Apr-2024 08:00                2715
history.php                                        24-Apr-2024 08:00                2199
history.php.books.php                              24-Apr-2024 08:00                2606
history.php.php                                    24-Apr-2024 08:00               10820
history.php.publications.php                       24-Apr-2024 08:00                1843
history.php.related.php                            24-Apr-2024 08:00                6005
hrtime-performancecounter.getfrequency.php         24-Apr-2024 08:00                2765
hrtime-performancecounter.getticks.php             24-Apr-2024 08:00                2638
hrtime-performancecounter.gettickssince.php        24-Apr-2024 08:00                2949
hrtime-stopwatch.getelapsedticks.php               24-Apr-2024 08:00                2540
hrtime-stopwatch.getelapsedtime.php                24-Apr-2024 08:00                2944
hrtime-stopwatch.getlastelapsedticks.php           24-Apr-2024 08:00                2608
hrtime-stopwatch.getlastelapsedtime.php            24-Apr-2024 08:00                2968
hrtime-stopwatch.isrunning.php                     24-Apr-2024 08:00                2501
hrtime-stopwatch.start.php                         24-Apr-2024 08:00                2402
hrtime-stopwatch.stop.php                          24-Apr-2024 08:00                2281
hrtime.example.basic.php                           24-Apr-2024 08:00                5479
hrtime.examples.php                                24-Apr-2024 08:00                1400
hrtime.installation.php                            24-Apr-2024 08:00                1992
hrtime.setup.php                                   24-Apr-2024 08:00                1417
ibase.configuration.php                            24-Apr-2024 08:00                7974
ibase.constants.php                                24-Apr-2024 08:00               21365
ibase.installation.php                             24-Apr-2024 08:00                3343
ibase.requirements.php                             24-Apr-2024 08:00                1213
ibase.resources.php                                24-Apr-2024 08:00                1211
ibase.setup.php                                    24-Apr-2024 08:00                1633
ibm-db2.configuration.php                          24-Apr-2024 08:00               20827
ibm-db2.constants.php                              24-Apr-2024 08:00                9108
ibm-db2.installation.php                           24-Apr-2024 08:00                3524
ibm-db2.requirements.php                           24-Apr-2024 08:00                3237
ibm-db2.resources.php                              24-Apr-2024 08:00                1288
ibm-db2.setup.php                                  24-Apr-2024 08:00                1645
iconv.configuration.php                            24-Apr-2024 08:00                4699
iconv.constants.php                                24-Apr-2024 08:00                3699
iconv.installation.php                             24-Apr-2024 08:00                1572
iconv.requirements.php                             24-Apr-2024 08:00                1514
iconv.resources.php                                24-Apr-2024 08:00                1211
iconv.setup.php                                    24-Apr-2024 08:00                1621
igbinary.configuration.php                         24-Apr-2024 08:00                3445
igbinary.installation.php                          24-Apr-2024 08:00                1986
igbinary.requirements.php                          24-Apr-2024 08:00                1234
igbinary.setup.php                                 24-Apr-2024 08:00                1571
image.configuration.php                            24-Apr-2024 08:00                3355
image.constants.php                                24-Apr-2024 08:00               52463
image.examples-png.php                             24-Apr-2024 08:00                4749
image.examples-watermark.php                       24-Apr-2024 08:00                5822
image.examples.merged-watermark.php                24-Apr-2024 08:00                8582
image.examples.php                                 24-Apr-2024 08:00                1627
image.installation.php                             24-Apr-2024 08:00                5985
image.requirements.php                             24-Apr-2024 08:00                4430
image.resources.php                                24-Apr-2024 08:00                2058
image.setup.php                                    24-Apr-2024 08:00                1618
imagick.adaptiveblurimage.php                      24-Apr-2024 08:00                6946
imagick.adaptiveresizeimage.php                    24-Apr-2024 08:00                9068
imagick.adaptivesharpenimage.php                   24-Apr-2024 08:00                6468
imagick.adaptivethresholdimage.php                 24-Apr-2024 08:00                6256
imagick.addimage.php                               24-Apr-2024 08:00                2932
imagick.addnoiseimage.php                          24-Apr-2024 08:00                5598
imagick.affinetransformimage.php                   24-Apr-2024 08:00                6652
imagick.animateimages.php                          24-Apr-2024 08:00                3189
imagick.annotateimage.php                          24-Apr-2024 08:00                8689
imagick.appendimages.php                           24-Apr-2024 08:00                6712
imagick.autolevelimage.php                         24-Apr-2024 08:00                4483
imagick.averageimages.php                          24-Apr-2024 08:00                2732
imagick.blackthresholdimage.php                    24-Apr-2024 08:00                5313
imagick.blueshiftimage.php                         24-Apr-2024 08:00                4528
imagick.blurimage.php                              24-Apr-2024 08:00                5768
imagick.borderimage.php                            24-Apr-2024 08:00                6063
imagick.brightnesscontrastimage.php                24-Apr-2024 08:00                5688
imagick.charcoalimage.php                          24-Apr-2024 08:00                5021
imagick.chopimage.php                              24-Apr-2024 08:00                7023
imagick.clampimage.php                             24-Apr-2024 08:00                2739
imagick.clear.php                                  24-Apr-2024 08:00                2290
imagick.clipimage.php                              24-Apr-2024 08:00                2525
imagick.clipimagepath.php                          24-Apr-2024 08:00                3167
imagick.clippathimage.php                          24-Apr-2024 08:00                3534
imagick.clone.php                                  24-Apr-2024 08:00                4152
imagick.clutimage.php                              24-Apr-2024 08:00                6049
imagick.coalesceimages.php                         24-Apr-2024 08:00                2825
imagick.colorfloodfillimage.php                    24-Apr-2024 08:00                5448
imagick.colorizeimage.php                          24-Apr-2024 08:00                6881
imagick.colormatriximage.php                       24-Apr-2024 08:00                7651
imagick.combineimages.php                          24-Apr-2024 08:00                3376
imagick.commentimage.php                           24-Apr-2024 08:00                4988
imagick.compareimagechannels.php                   24-Apr-2024 08:00                3971
imagick.compareimagelayers.php                     24-Apr-2024 08:00                5483
imagick.compareimages.php                          24-Apr-2024 08:00                5666
imagick.compositeimage.php                         24-Apr-2024 08:00                8027
imagick.configuration.php                          24-Apr-2024 08:00                4440
imagick.constants.php                              24-Apr-2024 08:00              160796
imagick.construct.php                              24-Apr-2024 08:00                2609
imagick.contrastimage.php                          24-Apr-2024 08:00                5049
imagick.contraststretchimage.php                   24-Apr-2024 08:00                3981
imagick.convolveimage.php                          24-Apr-2024 08:00                5965
imagick.count.php                                  24-Apr-2024 08:00                2741
imagick.cropimage.php                              24-Apr-2024 08:00                6166
imagick.cropthumbnailimage.php                     24-Apr-2024 08:00                3546
imagick.current.php                                24-Apr-2024 08:00                2486
imagick.cyclecolormapimage.php                     24-Apr-2024 08:00                3015
imagick.decipherimage.php                          24-Apr-2024 08:00                3281
imagick.deconstructimages.php                      24-Apr-2024 08:00                2641
imagick.deleteimageartifact.php                    24-Apr-2024 08:00                3677
imagick.deleteimageproperty.php                    24-Apr-2024 08:00                2675
imagick.deskewimage.php                            24-Apr-2024 08:00               11049
imagick.despeckleimage.php                         24-Apr-2024 08:00                4268
imagick.destroy.php                                24-Apr-2024 08:00                2428
imagick.displayimage.php                           24-Apr-2024 08:00                2816
imagick.displayimages.php                          24-Apr-2024 08:00                2860
imagick.distortimage.php                           24-Apr-2024 08:00               11862
imagick.drawimage.php                              24-Apr-2024 08:00                2663
imagick.edgeimage.php                              24-Apr-2024 08:00                4687
imagick.embossimage.php                            24-Apr-2024 08:00                5384
imagick.encipherimage.php                          24-Apr-2024 08:00                3277
imagick.enhanceimage.php                           24-Apr-2024 08:00                4235
imagick.equalizeimage.php                          24-Apr-2024 08:00                4202
imagick.evaluateimage.php                          24-Apr-2024 08:00                5941
imagick.examples-1.php                             24-Apr-2024 08:00               29921
imagick.examples.php                               24-Apr-2024 08:00                1413
imagick.exportimagepixels.php                      24-Apr-2024 08:00                7952
imagick.extentimage.php                            24-Apr-2024 08:00                5277
imagick.filter.php                                 24-Apr-2024 08:00                7613
imagick.flattenimages.php                          24-Apr-2024 08:00                2837
imagick.flipimage.php                              24-Apr-2024 08:00                4531
imagick.floodfillpaintimage.php                    24-Apr-2024 08:00               11600
imagick.flopimage.php                              24-Apr-2024 08:00                4563
imagick.forwardfouriertransformimage.php           24-Apr-2024 08:00               12115
imagick.frameimage.php                             24-Apr-2024 08:00                8333
imagick.functionimage.php                          24-Apr-2024 08:00               13743
imagick.fximage.php                                24-Apr-2024 08:00                6065
imagick.gammaimage.php                             24-Apr-2024 08:00                5726
imagick.gaussianblurimage.php                      24-Apr-2024 08:00                6262
imagick.getcolorspace.php                          24-Apr-2024 08:00                2474
imagick.getcompression.php                         24-Apr-2024 08:00                2303
imagick.getcompressionquality.php                  24-Apr-2024 08:00                2377
imagick.getcopyright.php                           24-Apr-2024 08:00                2406
imagick.getfilename.php                            24-Apr-2024 08:00                2463
imagick.getfont.php                                24-Apr-2024 08:00                3102
imagick.getformat.php                              24-Apr-2024 08:00                2425
imagick.getgravity.php                             24-Apr-2024 08:00                2453
imagick.gethomeurl.php                             24-Apr-2024 08:00                2283
imagick.getimage.php                               24-Apr-2024 08:00                2467
imagick.getimagealphachannel.php                   24-Apr-2024 08:00                3553
imagick.getimageartifact.php                       24-Apr-2024 08:00                3576
imagick.getimageattribute.php                      24-Apr-2024 08:00                2838
imagick.getimagebackgroundcolor.php                24-Apr-2024 08:00                2633
imagick.getimageblob.php                           24-Apr-2024 08:00                2719
imagick.getimageblueprimary.php                    24-Apr-2024 08:00                2917
imagick.getimagebordercolor.php                    24-Apr-2024 08:00                2641
imagick.getimagechanneldepth.php                   24-Apr-2024 08:00                3235
imagick.getimagechanneldistortion.php              24-Apr-2024 08:00                4106
imagick.getimagechanneldistortions.php             24-Apr-2024 08:00                4498
imagick.getimagechannelextrema.php                 24-Apr-2024 08:00                3653
imagick.getimagechannelkurtosis.php                24-Apr-2024 08:00                3633
imagick.getimagechannelmean.php                    24-Apr-2024 08:00                3283
imagick.getimagechannelrange.php                   24-Apr-2024 08:00                3486
imagick.getimagechannelstatistics.php              24-Apr-2024 08:00                2633
imagick.getimageclipmask.php                       24-Apr-2024 08:00                2981
imagick.getimagecolormapcolor.php                  24-Apr-2024 08:00                2983
imagick.getimagecolors.php                         24-Apr-2024 08:00                2447
imagick.getimagecolorspace.php                     24-Apr-2024 08:00                2430
imagick.getimagecompose.php                        24-Apr-2024 08:00                2439
imagick.getimagecompression.php                    24-Apr-2024 08:00                2391
imagick.getimagecompressionquality.php             24-Apr-2024 08:00                2485
imagick.getimagedelay.php                          24-Apr-2024 08:00                2456
imagick.getimagedepth.php                          24-Apr-2024 08:00                2236
imagick.getimagedispose.php                        24-Apr-2024 08:00                2496
imagick.getimagedistortion.php                     24-Apr-2024 08:00                3288
imagick.getimageextrema.php                        24-Apr-2024 08:00                2895
imagick.getimagefilename.php                       24-Apr-2024 08:00                2570
imagick.getimageformat.php                         24-Apr-2024 08:00                2552
imagick.getimagegamma.php                          24-Apr-2024 08:00                2451
imagick.getimagegeometry.php                       24-Apr-2024 08:00                4167
imagick.getimagegravity.php                        24-Apr-2024 08:00                2746
imagick.getimagegreenprimary.php                   24-Apr-2024 08:00                2721
imagick.getimageheight.php                         24-Apr-2024 08:00                2482
imagick.getimagehistogram.php                      24-Apr-2024 08:00               17213
imagick.getimageindex.php                          24-Apr-2024 08:00                3002
imagick.getimageinterlacescheme.php                24-Apr-2024 08:00                2528
imagick.getimageinterpolatemethod.php              24-Apr-2024 08:00                2755
imagick.getimageiterations.php                     24-Apr-2024 08:00                2544
imagick.getimagelength.php                         24-Apr-2024 08:00                3407
imagick.getimagematte.php                          24-Apr-2024 08:00                2845
imagick.getimagemattecolor.php                     24-Apr-2024 08:00                2810
imagick.getimagemimetype.php                       24-Apr-2024 08:00                2301
imagick.getimageorientation.php                    24-Apr-2024 08:00                2648
imagick.getimagepage.php                           24-Apr-2024 08:00                2713
imagick.getimagepixelcolor.php                     24-Apr-2024 08:00                3183
imagick.getimageprofile.php                        24-Apr-2024 08:00                2827
imagick.getimageprofiles.php                       24-Apr-2024 08:00                3581
imagick.getimageproperties.php                     24-Apr-2024 08:00                5825
imagick.getimageproperty.php                       24-Apr-2024 08:00                4969
imagick.getimageredprimary.php                     24-Apr-2024 08:00                2789
imagick.getimageregion.php                         24-Apr-2024 08:00                3983
imagick.getimagerenderingintent.php                24-Apr-2024 08:00                2672
imagick.getimageresolution.php                     24-Apr-2024 08:00                2548
imagick.getimagesblob.php                          24-Apr-2024 08:00                2561
imagick.getimagescene.php                          24-Apr-2024 08:00                2438
imagick.getimagesignature.php                      24-Apr-2024 08:00                2567
imagick.getimagesize.php                           24-Apr-2024 08:00                2680
imagick.getimagetickspersecond.php                 24-Apr-2024 08:00                2584
imagick.getimagetotalinkdensity.php                24-Apr-2024 08:00                2514
imagick.getimagetype.php                           24-Apr-2024 08:00                4891
imagick.getimageunits.php                          24-Apr-2024 08:00                2500
imagick.getimagevirtualpixelmethod.php             24-Apr-2024 08:00                2651
imagick.getimagewhitepoint.php                     24-Apr-2024 08:00                2701
imagick.getimagewidth.php                          24-Apr-2024 08:00                2456
imagick.getinterlacescheme.php                     24-Apr-2024 08:00                2602
imagick.getiteratorindex.php                       24-Apr-2024 08:00                6099
imagick.getnumberimages.php                        24-Apr-2024 08:00                2551
imagick.getoption.php                              24-Apr-2024 08:00                2801
imagick.getpackagename.php                         24-Apr-2024 08:00                2524
imagick.getpage.php                                24-Apr-2024 08:00                2537
imagick.getpixeliterator.php                       24-Apr-2024 08:00                5999
imagick.getpixelregioniterator.php                 24-Apr-2024 08:00                6753
imagick.getpointsize.php                           24-Apr-2024 08:00                2818
imagick.getquantum.php                             24-Apr-2024 08:00                2329
imagick.getquantumdepth.php                        24-Apr-2024 08:00                2635
imagick.getquantumrange.php                        24-Apr-2024 08:00                2897
imagick.getregistry.php                            24-Apr-2024 08:00                2550
imagick.getreleasedate.php                         24-Apr-2024 08:00                2548
imagick.getresource.php                            24-Apr-2024 08:00                2958
imagick.getresourcelimit.php                       24-Apr-2024 08:00                3371
imagick.getsamplingfactors.php                     24-Apr-2024 08:00                2612
imagick.getsize.php                                24-Apr-2024 08:00                5861
imagick.getsizeoffset.php                          24-Apr-2024 08:00                2594
imagick.getversion.php                             24-Apr-2024 08:00                2534
imagick.haldclutimage.php                          24-Apr-2024 08:00                6113
imagick.hasnextimage.php                           24-Apr-2024 08:00                2679
imagick.haspreviousimage.php                       24-Apr-2024 08:00                2717
imagick.identifyformat.php                         24-Apr-2024 08:00                4491
imagick.identifyimage.php                          24-Apr-2024 08:00                4123
imagick.implodeimage.php                           24-Apr-2024 08:00                4677
imagick.importimagepixels.php                      24-Apr-2024 08:00               11413
imagick.installation.php                           24-Apr-2024 08:00                2991
imagick.inversefouriertransformimage.php           24-Apr-2024 08:00                3517
imagick.labelimage.php                             24-Apr-2024 08:00                2619
imagick.levelimage.php                             24-Apr-2024 08:00                7792
imagick.linearstretchimage.php                     24-Apr-2024 08:00                5704
imagick.liquidrescaleimage.php                     24-Apr-2024 08:00                4540
imagick.listregistry.php                           24-Apr-2024 08:00                2388
imagick.magnifyimage.php                           24-Apr-2024 08:00                4234
imagick.mapimage.php                               24-Apr-2024 08:00                3260
imagick.mattefloodfillimage.php                    24-Apr-2024 08:00                5785
imagick.medianfilterimage.php                      24-Apr-2024 08:00                5150
imagick.mergeimagelayers.php                       24-Apr-2024 08:00                6466
imagick.minifyimage.php                            24-Apr-2024 08:00                2408
imagick.modulateimage.php                          24-Apr-2024 08:00                5652
imagick.montageimage.php                           24-Apr-2024 08:00                4596
imagick.morphimages.php                            24-Apr-2024 08:00                2828
imagick.morphology.php                             24-Apr-2024 08:00               66583
imagick.mosaicimages.php                           24-Apr-2024 08:00                2742
imagick.motionblurimage.php                        24-Apr-2024 08:00                6823
imagick.negateimage.php                            24-Apr-2024 08:00                5576
imagick.newimage.php                               24-Apr-2024 08:00                6301
imagick.newpseudoimage.php                         24-Apr-2024 08:00                5834
imagick.nextimage.php                              24-Apr-2024 08:00                2340
imagick.normalizeimage.php                         24-Apr-2024 08:00                6425
imagick.oilpaintimage.php                          24-Apr-2024 08:00                4630
imagick.opaquepaintimage.php                       24-Apr-2024 08:00                5036
imagick.optimizeimagelayers.php                    24-Apr-2024 08:00                5323
imagick.orderedposterizeimage.php                  24-Apr-2024 08:00                6820
imagick.paintfloodfillimage.php                    24-Apr-2024 08:00                5781
imagick.paintopaqueimage.php                       24-Apr-2024 08:00                5396
imagick.painttransparentimage.php                  24-Apr-2024 08:00                4661
imagick.pingimage.php                              24-Apr-2024 08:00                2741
imagick.pingimageblob.php                          24-Apr-2024 08:00                5981
imagick.pingimagefile.php                          24-Apr-2024 08:00                5813
imagick.polaroidimage.php                          24-Apr-2024 08:00                4774
imagick.posterizeimage.php                         24-Apr-2024 08:00                5663
imagick.previewimages.php                          24-Apr-2024 08:00                3138
imagick.previousimage.php                          24-Apr-2024 08:00                2395
imagick.profileimage.php                           24-Apr-2024 08:00                3226
imagick.quantizeimage.php                          24-Apr-2024 08:00                6716
imagick.quantizeimages.php                         24-Apr-2024 08:00                4055
imagick.queryfontmetrics.php                       24-Apr-2024 08:00                5604
imagick.queryfonts.php                             24-Apr-2024 08:00                4750
imagick.queryformats.php                           24-Apr-2024 08:00                7125
imagick.radialblurimage.php                        24-Apr-2024 08:00                5557
imagick.raiseimage.php                             24-Apr-2024 08:00                6547
imagick.randomthresholdimage.php                   24-Apr-2024 08:00                6456
imagick.readimage.php                              24-Apr-2024 08:00                2583
imagick.readimageblob.php                          24-Apr-2024 08:00                5455
imagick.readimagefile.php                          24-Apr-2024 08:00                3224
imagick.readimages.php                             24-Apr-2024 08:00                2630
imagick.recolorimage.php                           24-Apr-2024 08:00                6352
imagick.reducenoiseimage.php                       24-Apr-2024 08:00                5200
imagick.remapimage.php                             24-Apr-2024 08:00                3467
imagick.removeimage.php                            24-Apr-2024 08:00                2531
imagick.removeimageprofile.php                     24-Apr-2024 08:00                2822
imagick.render.php                                 24-Apr-2024 08:00                2303
imagick.requirements.php                           24-Apr-2024 08:00                1577
imagick.resampleimage.php                          24-Apr-2024 08:00                5656
imagick.resetimagepage.php                         24-Apr-2024 08:00                2835
imagick.resizeimage.php                            24-Apr-2024 08:00               11299
imagick.resources.php                              24-Apr-2024 08:00                1225
imagick.rollimage.php                              24-Apr-2024 08:00                4828
imagick.rotateimage.php                            24-Apr-2024 08:00                5703
imagick.rotationalblurimage.php                    24-Apr-2024 08:00                5768
imagick.roundcorners.php                           24-Apr-2024 08:00                6731
imagick.sampleimage.php                            24-Apr-2024 08:00                3006
imagick.scaleimage.php                             24-Apr-2024 08:00                6967
imagick.segmentimage.php                           24-Apr-2024 08:00                6795
imagick.selectiveblurimage.php                     24-Apr-2024 08:00                6631
imagick.separateimagechannel.php                   24-Apr-2024 08:00                5412
imagick.sepiatoneimage.php                         24-Apr-2024 08:00                4908
imagick.setbackgroundcolor.php                     24-Apr-2024 08:00                3285
imagick.setcolorspace.php                          24-Apr-2024 08:00                3024
imagick.setcompression.php                         24-Apr-2024 08:00                2800
imagick.setcompressionquality.php                  24-Apr-2024 08:00                6949
imagick.setfilename.php                            24-Apr-2024 08:00                2670
imagick.setfirstiterator.php                       24-Apr-2024 08:00                2389
imagick.setfont.php                                24-Apr-2024 08:00                5542
imagick.setformat.php                              24-Apr-2024 08:00                2572
imagick.setgravity.php                             24-Apr-2024 08:00                2758
imagick.setimage.php                               24-Apr-2024 08:00                4719
imagick.setimagealphachannel.php                   24-Apr-2024 08:00                3684
imagick.setimageartifact.php                       24-Apr-2024 08:00                7335
imagick.setimageattribute.php                      24-Apr-2024 08:00                3184
imagick.setimagebackgroundcolor.php                24-Apr-2024 08:00                3514
imagick.setimagebias.php                           24-Apr-2024 08:00                6763
imagick.setimagebiasquantum.php                    24-Apr-2024 08:00                2913
imagick.setimageblueprimary.php                    24-Apr-2024 08:00                3185
imagick.setimagebordercolor.php                    24-Apr-2024 08:00                3492
imagick.setimagechanneldepth.php                   24-Apr-2024 08:00                3202
imagick.setimageclipmask.php                       24-Apr-2024 08:00                8719
imagick.setimagecolormapcolor.php                  24-Apr-2024 08:00                3225
imagick.setimagecolorspace.php                     24-Apr-2024 08:00                3246
imagick.setimagecompose.php                        24-Apr-2024 08:00                2965
imagick.setimagecompression.php                    24-Apr-2024 08:00                2937
imagick.setimagecompressionquality.php             24-Apr-2024 08:00                4900
imagick.setimagedelay.php                          24-Apr-2024 08:00                6181
imagick.setimagedepth.php                          24-Apr-2024 08:00                2783
imagick.setimagedispose.php                        24-Apr-2024 08:00                2827
imagick.setimageextent.php                         24-Apr-2024 08:00                3102
imagick.setimagefilename.php                       24-Apr-2024 08:00                2879
imagick.setimageformat.php                         24-Apr-2024 08:00                2771
imagick.setimagegamma.php                          24-Apr-2024 08:00                2787
imagick.setimagegravity.php                        24-Apr-2024 08:00                2923
imagick.setimagegreenprimary.php                   24-Apr-2024 08:00                3178
imagick.setimageindex.php                          24-Apr-2024 08:00                3380
imagick.setimageinterlacescheme.php                24-Apr-2024 08:00                2947
imagick.setimageinterpolatemethod.php              24-Apr-2024 08:00                2874
imagick.setimageiterations.php                     24-Apr-2024 08:00                5027
imagick.setimagematte.php                          24-Apr-2024 08:00                2793
imagick.setimagemattecolor.php                     24-Apr-2024 08:00                3700
imagick.setimageopacity.php                        24-Apr-2024 08:00                5047
imagick.setimageorientation.php                    24-Apr-2024 08:00                4739
imagick.setimagepage.php                           24-Apr-2024 08:00                3741
imagick.setimageprofile.php                        24-Apr-2024 08:00                3321
imagick.setimageproperty.php                       24-Apr-2024 08:00                5187
imagick.setimageredprimary.php                     24-Apr-2024 08:00                3174
imagick.setimagerenderingintent.php                24-Apr-2024 08:00                2953
imagick.setimageresolution.php                     24-Apr-2024 08:00                5021
imagick.setimagescene.php                          24-Apr-2024 08:00                2807
imagick.setimagetickspersecond.php                 24-Apr-2024 08:00                7762
imagick.setimagetype.php                           24-Apr-2024 08:00                2605
imagick.setimageunits.php                          24-Apr-2024 08:00                2641
imagick.setimagevirtualpixelmethod.php             24-Apr-2024 08:00                2761
imagick.setimagewhitepoint.php                     24-Apr-2024 08:00                3172
imagick.setinterlacescheme.php                     24-Apr-2024 08:00                2689
imagick.setiteratorindex.php                       24-Apr-2024 08:00                6264
imagick.setlastiterator.php                        24-Apr-2024 08:00                2403
imagick.setoption.php                              24-Apr-2024 08:00               11553
imagick.setpage.php                                24-Apr-2024 08:00                3494
imagick.setpointsize.php                           24-Apr-2024 08:00                5245
imagick.setprogressmonitor.php                     24-Apr-2024 08:00               10261
imagick.setregistry.php                            24-Apr-2024 08:00                3087
imagick.setresolution.php                          24-Apr-2024 08:00                3782
imagick.setresourcelimit.php                       24-Apr-2024 08:00                3702
imagick.setsamplingfactors.php                     24-Apr-2024 08:00                6793
imagick.setsize.php                                24-Apr-2024 08:00                2920
imagick.setsizeoffset.php                          24-Apr-2024 08:00                3429
imagick.settype.php                                24-Apr-2024 08:00                2551
imagick.setup.php                                  24-Apr-2024 08:00                1640
imagick.shadeimage.php                             24-Apr-2024 08:00                5669
imagick.shadowimage.php                            24-Apr-2024 08:00                5467
imagick.sharpenimage.php                           24-Apr-2024 08:00                5637
imagick.shaveimage.php                             24-Apr-2024 08:00                4770
imagick.shearimage.php                             24-Apr-2024 08:00                6483
imagick.sigmoidalcontrastimage.php                 24-Apr-2024 08:00                7998
imagick.sketchimage.php                            24-Apr-2024 08:00                5871
imagick.smushimages.php                            24-Apr-2024 08:00                5820
imagick.solarizeimage.php                          24-Apr-2024 08:00                4873
imagick.sparsecolorimage.php                       24-Apr-2024 08:00               26676
imagick.spliceimage.php                            24-Apr-2024 08:00                5835
imagick.spreadimage.php                            24-Apr-2024 08:00                4683
imagick.statisticimage.php                         24-Apr-2024 08:00                6757
imagick.steganoimage.php                           24-Apr-2024 08:00                3072
imagick.stereoimage.php                            24-Apr-2024 08:00                2858
imagick.stripimage.php                             24-Apr-2024 08:00                2528
imagick.subimagematch.php                          24-Apr-2024 08:00                7534
imagick.swirlimage.php                             24-Apr-2024 08:00                4735
imagick.textureimage.php                           24-Apr-2024 08:00                6149
imagick.thresholdimage.php                         24-Apr-2024 08:00                5289
imagick.thumbnailimage.php                         24-Apr-2024 08:00                7535
imagick.tintimage.php                              24-Apr-2024 08:00                7820
imagick.tostring.php                               24-Apr-2024 08:00                2957
imagick.transformimage.php                         24-Apr-2024 08:00                6037
imagick.transformimagecolorspace.php               24-Apr-2024 08:00                5743
imagick.transparentpaintimage.php                  24-Apr-2024 08:00                7257
imagick.transposeimage.php                         24-Apr-2024 08:00                4606
imagick.transverseimage.php                        24-Apr-2024 08:00                4594
imagick.trimimage.php                              24-Apr-2024 08:00                5731
imagick.uniqueimagecolors.php                      24-Apr-2024 08:00                5542
imagick.unsharpmaskimage.php                       24-Apr-2024 08:00                6725
imagick.valid.php                                  24-Apr-2024 08:00                2283
imagick.vignetteimage.php                          24-Apr-2024 08:00                6618
imagick.waveimage.php                              24-Apr-2024 08:00                6339
imagick.whitethresholdimage.php                    24-Apr-2024 08:00                5225
imagick.writeimage.php                             24-Apr-2024 08:00                3050
imagick.writeimagefile.php                         24-Apr-2024 08:00                3790
imagick.writeimages.php                            24-Apr-2024 08:00                2904
imagick.writeimagesfile.php                        24-Apr-2024 08:00                3840
imagickdraw.affine.php                             24-Apr-2024 08:00               16945
imagickdraw.annotation.php                         24-Apr-2024 08:00                3343
imagickdraw.arc.php                                24-Apr-2024 08:00                9662
imagickdraw.bezier.php                             24-Apr-2024 08:00               16835
imagickdraw.circle.php                             24-Apr-2024 08:00                9057
imagickdraw.clear.php                              24-Apr-2024 08:00                2373
imagickdraw.clone.php                              24-Apr-2024 08:00                2466
imagickdraw.color.php                              24-Apr-2024 08:00                3503
imagickdraw.comment.php                            24-Apr-2024 08:00                2729
imagickdraw.composite.php                          24-Apr-2024 08:00               11935
imagickdraw.construct.php                          24-Apr-2024 08:00                2244
imagickdraw.destroy.php                            24-Apr-2024 08:00                2345
imagickdraw.ellipse.php                            24-Apr-2024 08:00               12243
imagickdraw.getclippath.php                        24-Apr-2024 08:00                2341
imagickdraw.getcliprule.php                        24-Apr-2024 08:00                2462
imagickdraw.getclipunits.php                       24-Apr-2024 08:00                2406
imagickdraw.getfillcolor.php                       24-Apr-2024 08:00                2415
imagickdraw.getfillopacity.php                     24-Apr-2024 08:00                2375
imagickdraw.getfillrule.php                        24-Apr-2024 08:00                2424
imagickdraw.getfont.php                            24-Apr-2024 08:00                2308
imagickdraw.getfontfamily.php                      24-Apr-2024 08:00                2368
imagickdraw.getfontsize.php                        24-Apr-2024 08:00                2444
imagickdraw.getfontstretch.php                     24-Apr-2024 08:00                2396
imagickdraw.getfontstyle.php                       24-Apr-2024 08:00                2587
imagickdraw.getfontweight.php                      24-Apr-2024 08:00                2426
imagickdraw.getgravity.php                         24-Apr-2024 08:00                2492
imagickdraw.getstrokeantialias.php                 24-Apr-2024 08:00                2764
imagickdraw.getstrokecolor.php                     24-Apr-2024 08:00                2808
imagickdraw.getstrokedasharray.php                 24-Apr-2024 08:00                2502
imagickdraw.getstrokedashoffset.php                24-Apr-2024 08:00                2476
imagickdraw.getstrokelinecap.php                   24-Apr-2024 08:00                2617
imagickdraw.getstrokelinejoin.php                  24-Apr-2024 08:00                2646
imagickdraw.getstrokemiterlimit.php                24-Apr-2024 08:00                2738
imagickdraw.getstrokeopacity.php                   24-Apr-2024 08:00                2479
imagickdraw.getstrokewidth.php                     24-Apr-2024 08:00                2488
imagickdraw.gettextalignment.php                   24-Apr-2024 08:00                2508
imagickdraw.gettextantialias.php                   24-Apr-2024 08:00                2645
imagickdraw.gettextdecoration.php                  24-Apr-2024 08:00                2545
imagickdraw.gettextencoding.php                    24-Apr-2024 08:00                2470
imagickdraw.gettextinterlinespacing.php            24-Apr-2024 08:00                2433
imagickdraw.gettextinterwordspacing.php            24-Apr-2024 08:00                2457
imagickdraw.gettextkerning.php                     24-Apr-2024 08:00                2352
imagickdraw.gettextundercolor.php                  24-Apr-2024 08:00                2518
imagickdraw.getvectorgraphics.php                  24-Apr-2024 08:00                2568
imagickdraw.line.php                               24-Apr-2024 08:00                8356
imagickdraw.matte.php                              24-Apr-2024 08:00                8368
imagickdraw.pathclose.php                          24-Apr-2024 08:00                2468
imagickdraw.pathcurvetoabsolute.php                24-Apr-2024 08:00                4927
imagickdraw.pathcurvetoquadraticbezierabsolute.php 24-Apr-2024 08:00               11176
imagickdraw.pathcurvetoquadraticbezierrelative.php 24-Apr-2024 08:00                4308
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 24-Apr-2024 08:00               10335
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 24-Apr-2024 08:00               10467
imagickdraw.pathcurvetorelative.php                24-Apr-2024 08:00                4943
imagickdraw.pathcurvetosmoothabsolute.php          24-Apr-2024 08:00                4680
imagickdraw.pathcurvetosmoothrelative.php          24-Apr-2024 08:00                4687
imagickdraw.pathellipticarcabsolute.php            24-Apr-2024 08:00                5700
imagickdraw.pathellipticarcrelative.php            24-Apr-2024 08:00                5670
imagickdraw.pathfinish.php                         24-Apr-2024 08:00                2301
imagickdraw.pathlinetoabsolute.php                 24-Apr-2024 08:00                3233
imagickdraw.pathlinetohorizontalabsolute.php       24-Apr-2024 08:00                3083
imagickdraw.pathlinetohorizontalrelative.php       24-Apr-2024 08:00                3078
imagickdraw.pathlinetorelative.php                 24-Apr-2024 08:00                3283
imagickdraw.pathlinetoverticalabsolute.php         24-Apr-2024 08:00                3047
imagickdraw.pathlinetoverticalrelative.php         24-Apr-2024 08:00                3052
imagickdraw.pathmovetoabsolute.php                 24-Apr-2024 08:00                3280
imagickdraw.pathmovetorelative.php                 24-Apr-2024 08:00                3216
imagickdraw.pathstart.php                          24-Apr-2024 08:00               11801
imagickdraw.point.php                              24-Apr-2024 08:00                6890
imagickdraw.polygon.php                            24-Apr-2024 08:00                8971
imagickdraw.polyline.php                           24-Apr-2024 08:00                8975
imagickdraw.pop.php                                24-Apr-2024 08:00                2702
imagickdraw.popclippath.php                        24-Apr-2024 08:00                2260
imagickdraw.popdefs.php                            24-Apr-2024 08:00                7741
imagickdraw.poppattern.php                         24-Apr-2024 08:00                2435
imagickdraw.push.php                               24-Apr-2024 08:00                8451
imagickdraw.pushclippath.php                       24-Apr-2024 08:00                2956
imagickdraw.pushdefs.php                           24-Apr-2024 08:00                2559
imagickdraw.pushpattern.php                        24-Apr-2024 08:00               14621
imagickdraw.rectangle.php                          24-Apr-2024 08:00                8562
imagickdraw.render.php                             24-Apr-2024 08:00                2477
imagickdraw.resetvectorgraphics.php                24-Apr-2024 08:00                2441
imagickdraw.rotate.php                             24-Apr-2024 08:00                7757
imagickdraw.roundrectangle.php                     24-Apr-2024 08:00                9412
imagickdraw.scale.php                              24-Apr-2024 08:00                8103
imagickdraw.setclippath.php                        24-Apr-2024 08:00                8434
imagickdraw.setcliprule.php                        24-Apr-2024 08:00                9445
imagickdraw.setclipunits.php                       24-Apr-2024 08:00                8822
imagickdraw.setfillalpha.php                       24-Apr-2024 08:00                7778
imagickdraw.setfillcolor.php                       24-Apr-2024 08:00                7780
imagickdraw.setfillopacity.php                     24-Apr-2024 08:00                7836
imagickdraw.setfillpatternurl.php                  24-Apr-2024 08:00                3268
imagickdraw.setfillrule.php                        24-Apr-2024 08:00               12982
imagickdraw.setfont.php                            24-Apr-2024 08:00                9286
imagickdraw.setfontfamily.php                      24-Apr-2024 08:00                9898
imagickdraw.setfontsize.php                        24-Apr-2024 08:00                8284
imagickdraw.setfontstretch.php                     24-Apr-2024 08:00                9711
imagickdraw.setfontstyle.php                       24-Apr-2024 08:00                9001
imagickdraw.setfontweight.php                      24-Apr-2024 08:00                9149
imagickdraw.setgravity.php                         24-Apr-2024 08:00               10568
imagickdraw.setresolution.php                      24-Apr-2024 08:00                2929
imagickdraw.setstrokealpha.php                     24-Apr-2024 08:00                8438
imagickdraw.setstrokeantialias.php                 24-Apr-2024 08:00                8977
imagickdraw.setstrokecolor.php                     24-Apr-2024 08:00                8497
imagickdraw.setstrokedasharray.php                 24-Apr-2024 08:00               13416
imagickdraw.setstrokedashoffset.php                24-Apr-2024 08:00                9869
imagickdraw.setstrokelinecap.php                   24-Apr-2024 08:00                8585
imagickdraw.setstrokelinejoin.php                  24-Apr-2024 08:00               11471
imagickdraw.setstrokemiterlimit.php                24-Apr-2024 08:00               11288
imagickdraw.setstrokeopacity.php                   24-Apr-2024 08:00               10234
imagickdraw.setstrokepatternurl.php                24-Apr-2024 08:00                2978
imagickdraw.setstrokewidth.php                     24-Apr-2024 08:00                8469
imagickdraw.settextalignment.php                   24-Apr-2024 08:00                9450
imagickdraw.settextantialias.php                   24-Apr-2024 08:00                8864
imagickdraw.settextdecoration.php                  24-Apr-2024 08:00                7486
imagickdraw.settextencoding.php                    24-Apr-2024 08:00                3163
imagickdraw.settextinterlinespacing.php            24-Apr-2024 08:00                2953
imagickdraw.settextinterwordspacing.php            24-Apr-2024 08:00                2793
imagickdraw.settextkerning.php                     24-Apr-2024 08:00                2862
imagickdraw.settextundercolor.php                  24-Apr-2024 08:00                7802
imagickdraw.setvectorgraphics.php                  24-Apr-2024 08:00                8955
imagickdraw.setviewbox.php                         24-Apr-2024 08:00               10347
imagickdraw.skewx.php                              24-Apr-2024 08:00                8168
imagickdraw.skewy.php                              24-Apr-2024 08:00                8157
imagickdraw.translate.php                          24-Apr-2024 08:00                8495
imagickkernel.addkernel.php                        24-Apr-2024 08:00                7050
imagickkernel.addunitykernel.php                   24-Apr-2024 08:00               13695
imagickkernel.frombuiltin.php                      24-Apr-2024 08:00               26255
imagickkernel.frommatrix.php                       24-Apr-2024 08:00               23187
imagickkernel.getmatrix.php                        24-Apr-2024 08:00                7103
imagickkernel.scale.php                            24-Apr-2024 08:00               13217
imagickkernel.separate.php                         24-Apr-2024 08:00                9723
imagickpixel.clear.php                             24-Apr-2024 08:00                2404
imagickpixel.construct.php                         24-Apr-2024 08:00               11833
imagickpixel.destroy.php                           24-Apr-2024 08:00                2493
imagickpixel.getcolor.php                          24-Apr-2024 08:00                7893
imagickpixel.getcolorasstring.php                  24-Apr-2024 08:00                4867
imagickpixel.getcolorcount.php                     24-Apr-2024 08:00                4932
imagickpixel.getcolorquantum.php                   24-Apr-2024 08:00                2906
imagickpixel.getcolorvalue.php                     24-Apr-2024 08:00                8664
imagickpixel.getcolorvaluequantum.php              24-Apr-2024 08:00                6119
imagickpixel.gethsl.php                            24-Apr-2024 08:00                4370
imagickpixel.getindex.php                          24-Apr-2024 08:00                2299
imagickpixel.ispixelsimilar.php                    24-Apr-2024 08:00                3650
imagickpixel.ispixelsimilarquantum.php             24-Apr-2024 08:00                3255
imagickpixel.issimilar.php                         24-Apr-2024 08:00               16543
imagickpixel.setcolor.php                          24-Apr-2024 08:00                7511
imagickpixel.setcolorcount.php                     24-Apr-2024 08:00                2702
imagickpixel.setcolorvalue.php                     24-Apr-2024 08:00                5183
imagickpixel.setcolorvaluequantum.php              24-Apr-2024 08:00                8471
imagickpixel.sethsl.php                            24-Apr-2024 08:00                7536
imagickpixel.setindex.php                          24-Apr-2024 08:00                2631
imagickpixeliterator.clear.php                     24-Apr-2024 08:00                6318
imagickpixeliterator.construct.php                 24-Apr-2024 08:00                5991
imagickpixeliterator.destroy.php                   24-Apr-2024 08:00                2534
imagickpixeliterator.getcurrentiteratorrow.php     24-Apr-2024 08:00                2641
imagickpixeliterator.getiteratorrow.php            24-Apr-2024 08:00                2566
imagickpixeliterator.getnextiteratorrow.php        24-Apr-2024 08:00                6749
imagickpixeliterator.getpreviousiteratorrow.php    24-Apr-2024 08:00                2710
imagickpixeliterator.newpixeliterator.php          24-Apr-2024 08:00                2787
imagickpixeliterator.newpixelregioniterator.php    24-Apr-2024 08:00                4303
imagickpixeliterator.resetiterator.php             24-Apr-2024 08:00                8726
imagickpixeliterator.setiteratorfirstrow.php       24-Apr-2024 08:00                2628
imagickpixeliterator.setiteratorlastrow.php        24-Apr-2024 08:00                2621
imagickpixeliterator.setiteratorrow.php            24-Apr-2024 08:00                7133
imagickpixeliterator.synciterator.php              24-Apr-2024 08:00                2476
imap.configuration.php                             24-Apr-2024 08:00                3234
imap.constants.php                                 24-Apr-2024 08:00               24847
imap.installation.php                              24-Apr-2024 08:00                2659
imap.requirements.php                              24-Apr-2024 08:00                3050
imap.resources.php                                 24-Apr-2024 08:00                1411
imap.setup.php                                     24-Apr-2024 08:00                1609
index.php                                          24-Apr-2024 08:00               12313
indexes.examples.php                               24-Apr-2024 08:00              711831
indexes.functions.php                              24-Apr-2024 08:00             1149478
indexes.php                                        24-Apr-2024 08:00                1474
infiniteiterator.construct.php                     24-Apr-2024 08:00                5062
infiniteiterator.next.php                          24-Apr-2024 08:00                3306
info.configuration.php                             24-Apr-2024 08:00               13166
info.constants.php                                 24-Apr-2024 08:00               20389
info.installation.php                              24-Apr-2024 08:00                1242
info.requirements.php                              24-Apr-2024 08:00                1206
info.resources.php                                 24-Apr-2024 08:00                1204
info.setup.php                                     24-Apr-2024 08:00                1597
ini.core.php                                       24-Apr-2024 08:00               72250
ini.list.php                                       24-Apr-2024 08:00              106056
ini.php                                            24-Apr-2024 08:00                1592
ini.sections.php                                   24-Apr-2024 08:00                4051
inotify.configuration.php                          24-Apr-2024 08:00                1285
inotify.constants.php                              24-Apr-2024 08:00               10413
inotify.install.php                                24-Apr-2024 08:00                1764
inotify.requirements.php                           24-Apr-2024 08:00                1247
inotify.resources.php                              24-Apr-2024 08:00                1345
inotify.setup.php                                  24-Apr-2024 08:00                1640
install.cloud.azure.php                            24-Apr-2024 08:00                3979
install.cloud.digitalocean.php                     24-Apr-2024 08:00                3030
install.cloud.ec2.php                              24-Apr-2024 08:00                1442
install.cloud.php                                  24-Apr-2024 08:00                1724
install.fpm.configuration.php                      24-Apr-2024 08:00               36131
install.fpm.install.php                            24-Apr-2024 08:00                3335
install.fpm.php                                    24-Apr-2024 08:00                3646
install.general.php                                24-Apr-2024 08:00                4396
install.macosx.bundled.php                         24-Apr-2024 08:00               10077
install.macosx.compile.php                         24-Apr-2024 08:00                1350
install.macosx.packages.php                        24-Apr-2024 08:00                3011
install.macosx.php                                 24-Apr-2024 08:00                1941
install.pecl.downloads.php                         24-Apr-2024 08:00                3573
install.pecl.intro.php                             24-Apr-2024 08:00                3089
install.pecl.pear.php                              24-Apr-2024 08:00                2953
install.pecl.php                                   24-Apr-2024 08:00                2013
install.pecl.php-config.php                        24-Apr-2024 08:00                4152
install.pecl.phpize.php                            24-Apr-2024 08:00                3037
install.pecl.static.php                            24-Apr-2024 08:00                3431
install.pecl.windows.php                           24-Apr-2024 08:00                9062
install.php                                        24-Apr-2024 08:00                5523
install.problems.bugs.php                          24-Apr-2024 08:00                1892
install.problems.faq.php                           24-Apr-2024 08:00                1326
install.problems.php                               24-Apr-2024 08:00                1590
install.problems.support.php                       24-Apr-2024 08:00                2313
install.unix.apache2.php                           24-Apr-2024 08:00               12651
install.unix.commandline.php                       24-Apr-2024 08:00                3773
install.unix.debian.php                            24-Apr-2024 08:00                6651
install.unix.lighttpd-14.php                       24-Apr-2024 08:00                5966
install.unix.litespeed.php                         24-Apr-2024 08:00                8998
install.unix.nginx.php                             24-Apr-2024 08:00                8367
install.unix.openbsd.php                           24-Apr-2024 08:00                5683
install.unix.php                                   24-Apr-2024 08:00                7027
install.unix.solaris.php                           24-Apr-2024 08:00                3791
install.windows.apache2.php                        24-Apr-2024 08:00                6873
install.windows.building.php                       24-Apr-2024 08:00                1695
install.windows.commandline.php                    24-Apr-2024 08:00                8203
install.windows.manual.php                         24-Apr-2024 08:00                5250
install.windows.pecl.php                           24-Apr-2024 08:00                1592
install.windows.php                                24-Apr-2024 08:00                3134
install.windows.recommended.php                    24-Apr-2024 08:00                4624
install.windows.requirements.php                   24-Apr-2024 08:00                2238
install.windows.tools.php                          24-Apr-2024 08:00                1803
install.windows.troubleshooting.php                24-Apr-2024 08:00                1710
internaliterator.construct.php                     24-Apr-2024 08:00                1997
internaliterator.current.php                       24-Apr-2024 08:00                2302
internaliterator.key.php                           24-Apr-2024 08:00                2291
internaliterator.next.php                          24-Apr-2024 08:00                2275
internaliterator.rewind.php                        24-Apr-2024 08:00                2310
internaliterator.valid.php                         24-Apr-2024 08:00                2291
intl.configuration.php                             24-Apr-2024 08:00                5322
intl.constants.php                                 24-Apr-2024 08:00               11675
intl.examples.basic.php                            24-Apr-2024 08:00                4350
intl.examples.php                                  24-Apr-2024 08:00                1425
intl.installation.php                              24-Apr-2024 08:00                1769
intl.requirements.php                              24-Apr-2024 08:00                1381
intl.resources.php                                 24-Apr-2024 08:00                1204
intl.setup.php                                     24-Apr-2024 08:00                1608
intlbreakiterator.construct.php                    24-Apr-2024 08:00                4073
intlbreakiterator.createcharacterinstance.php      24-Apr-2024 08:00                3356
intlbreakiterator.createcodepointinstance.php      24-Apr-2024 08:00                2794
intlbreakiterator.createlineinstance.php           24-Apr-2024 08:00                3317
intlbreakiterator.createsentenceinstance.php       24-Apr-2024 08:00                3319
intlbreakiterator.createtitleinstance.php          24-Apr-2024 08:00                3299
intlbreakiterator.createwordinstance.php           24-Apr-2024 08:00                3253
intlbreakiterator.current.php                      24-Apr-2024 08:00                2483
intlbreakiterator.first.php                        24-Apr-2024 08:00                2467
intlbreakiterator.following.php                    24-Apr-2024 08:00                2774
intlbreakiterator.geterrorcode.php                 24-Apr-2024 08:00                3010
intlbreakiterator.geterrormessage.php              24-Apr-2024 08:00                3059
intlbreakiterator.getlocale.php                    24-Apr-2024 08:00                2884
intlbreakiterator.getpartsiterator.php             24-Apr-2024 08:00                3711
intlbreakiterator.gettext.php                      24-Apr-2024 08:00                2600
intlbreakiterator.isboundary.php                   24-Apr-2024 08:00                2744
intlbreakiterator.last.php                         24-Apr-2024 08:00                2466
intlbreakiterator.next.php                         24-Apr-2024 08:00                2908
intlbreakiterator.preceding.php                    24-Apr-2024 08:00                2752
intlbreakiterator.previous.php                     24-Apr-2024 08:00                2522
intlbreakiterator.settext.php                      24-Apr-2024 08:00                3593
intlcalendar.add.php                               24-Apr-2024 08:00                8834
intlcalendar.after.php                             24-Apr-2024 08:00                6845
intlcalendar.before.php                            24-Apr-2024 08:00                4230
intlcalendar.clear.php                             24-Apr-2024 08:00               19102
intlcalendar.construct.php                         24-Apr-2024 08:00                2355
intlcalendar.createinstance.php                    24-Apr-2024 08:00               13586
intlcalendar.equals.php                            24-Apr-2024 08:00               10940
intlcalendar.fielddifference.php                   24-Apr-2024 08:00               11360
intlcalendar.fromdatetime.php                      24-Apr-2024 08:00                8060
intlcalendar.get.php                               24-Apr-2024 08:00                8869
intlcalendar.getactualmaximum.php                  24-Apr-2024 08:00                8761
intlcalendar.getactualminimum.php                  24-Apr-2024 08:00                5948
intlcalendar.getavailablelocales.php               24-Apr-2024 08:00                4461
intlcalendar.getdayofweektype.php                  24-Apr-2024 08:00               10683
intlcalendar.geterrorcode.php                      24-Apr-2024 08:00                9104
intlcalendar.geterrormessage.php                   24-Apr-2024 08:00                6206
intlcalendar.getfirstdayofweek.php                 24-Apr-2024 08:00                8774
intlcalendar.getgreatestminimum.php                24-Apr-2024 08:00                4835
intlcalendar.getkeywordvaluesforlocale.php         24-Apr-2024 08:00                7531
intlcalendar.getleastmaximum.php                   24-Apr-2024 08:00                8408
intlcalendar.getlocale.php                         24-Apr-2024 08:00                6363
intlcalendar.getmaximum.php                        24-Apr-2024 08:00                5481
intlcalendar.getminimaldaysinfirstweek.php         24-Apr-2024 08:00                9071
intlcalendar.getminimum.php                        24-Apr-2024 08:00                4779
intlcalendar.getnow.php                            24-Apr-2024 08:00                5378
intlcalendar.getrepeatedwalltimeoption.php         24-Apr-2024 08:00               10358
intlcalendar.getskippedwalltimeoption.php          24-Apr-2024 08:00               12697
intlcalendar.gettime.php                           24-Apr-2024 08:00                6627
intlcalendar.gettimezone.php                       24-Apr-2024 08:00                7595
intlcalendar.gettype.php                           24-Apr-2024 08:00                5778
intlcalendar.getweekendtransition.php              24-Apr-2024 08:00                5443
intlcalendar.indaylighttime.php                    24-Apr-2024 08:00                8769
intlcalendar.isequivalentto.php                    24-Apr-2024 08:00                8519
intlcalendar.islenient.php                         24-Apr-2024 08:00                8424
intlcalendar.isset.php                             24-Apr-2024 08:00                4886
intlcalendar.isweekend.php                         24-Apr-2024 08:00                9013
intlcalendar.roll.php                              24-Apr-2024 08:00                9555
intlcalendar.set.php                               24-Apr-2024 08:00               16073
intlcalendar.setdate.php                           24-Apr-2024 08:00                4883
intlcalendar.setdatetime.php                       24-Apr-2024 08:00                6806
intlcalendar.setfirstdayofweek.php                 24-Apr-2024 08:00                8928
intlcalendar.setlenient.php                        24-Apr-2024 08:00                5121
intlcalendar.setminimaldaysinfirstweek.php         24-Apr-2024 08:00                5458
intlcalendar.setrepeatedwalltimeoption.php         24-Apr-2024 08:00                6585
intlcalendar.setskippedwalltimeoption.php          24-Apr-2024 08:00                7452
intlcalendar.settime.php                           24-Apr-2024 08:00                8756
intlcalendar.settimezone.php                       24-Apr-2024 08:00               11327
intlcalendar.todatetime.php                        24-Apr-2024 08:00                7203
intlchar.charage.php                               24-Apr-2024 08:00                5910
intlchar.chardigitvalue.php                        24-Apr-2024 08:00                5571
intlchar.chardirection.php                         24-Apr-2024 08:00               10728
intlchar.charfromname.php                          24-Apr-2024 08:00                7296
intlchar.charmirror.php                            24-Apr-2024 08:00                6612
intlchar.charname.php                              24-Apr-2024 08:00                7682
intlchar.chartype.php                              24-Apr-2024 08:00               11621
intlchar.chr.php                                   24-Apr-2024 08:00                5661
intlchar.digit.php                                 24-Apr-2024 08:00                8426
intlchar.enumcharnames.php                         24-Apr-2024 08:00                9093
intlchar.enumchartypes.php                         24-Apr-2024 08:00                5857
intlchar.foldcase.php                              24-Apr-2024 08:00                4114
intlchar.fordigit.php                              24-Apr-2024 08:00                7123
intlchar.getbidipairedbracket.php                  24-Apr-2024 08:00                6372
intlchar.getblockcode.php                          24-Apr-2024 08:00                5634
intlchar.getcombiningclass.php                     24-Apr-2024 08:00                4978
intlchar.getfc-nfkc-closure.php                    24-Apr-2024 08:00                4999
intlchar.getintpropertymaxvalue.php                24-Apr-2024 08:00                6400
intlchar.getintpropertyminvalue.php                24-Apr-2024 08:00                6393
intlchar.getintpropertyvalue.php                   24-Apr-2024 08:00                8104
intlchar.getnumericvalue.php                       24-Apr-2024 08:00                5684
intlchar.getpropertyenum.php                       24-Apr-2024 08:00                6747
intlchar.getpropertyname.php                       24-Apr-2024 08:00                9098
intlchar.getpropertyvalueenum.php                  24-Apr-2024 08:00                8000
intlchar.getpropertyvaluename.php                  24-Apr-2024 08:00               10915
intlchar.getunicodeversion.php                     24-Apr-2024 08:00                3983
intlchar.hasbinaryproperty.php                     24-Apr-2024 08:00                9065
intlchar.isalnum.php                               24-Apr-2024 08:00                6003
intlchar.isalpha.php                               24-Apr-2024 08:00                5889
intlchar.isbase.php                                24-Apr-2024 08:00                6198
intlchar.isblank.php                               24-Apr-2024 08:00                6866
intlchar.iscntrl.php                               24-Apr-2024 08:00                6958
intlchar.isdefined.php                             24-Apr-2024 08:00                6875
intlchar.isdigit.php                               24-Apr-2024 08:00                6209
intlchar.isgraph.php                               24-Apr-2024 08:00                6144
intlchar.isidignorable.php                         24-Apr-2024 08:00                6407
intlchar.isidpart.php                              24-Apr-2024 08:00                7048
intlchar.isidstart.php                             24-Apr-2024 08:00                6479
intlchar.isisocontrol.php                          24-Apr-2024 08:00                5686
intlchar.isjavaidpart.php                          24-Apr-2024 08:00                6971
intlchar.isjavaidstart.php                         24-Apr-2024 08:00                6701
intlchar.isjavaspacechar.php                       24-Apr-2024 08:00                6934
intlchar.islower.php                               24-Apr-2024 08:00                7362
intlchar.ismirrored.php                            24-Apr-2024 08:00                5810
intlchar.isprint.php                               24-Apr-2024 08:00                6282
intlchar.ispunct.php                               24-Apr-2024 08:00                5931
intlchar.isspace.php                               24-Apr-2024 08:00                6694
intlchar.istitle.php                               24-Apr-2024 08:00                7576
intlchar.isualphabetic.php                         24-Apr-2024 08:00                6023
intlchar.isulowercase.php                          24-Apr-2024 08:00                7053
intlchar.isupper.php                               24-Apr-2024 08:00                7360
intlchar.isuuppercase.php                          24-Apr-2024 08:00                7091
intlchar.isuwhitespace.php                         24-Apr-2024 08:00                7513
intlchar.iswhitespace.php                          24-Apr-2024 08:00                7408
intlchar.isxdigit.php                              24-Apr-2024 08:00                7274
intlchar.ord.php                                   24-Apr-2024 08:00                5505
intlchar.tolower.php                               24-Apr-2024 08:00                7783
intlchar.totitle.php                               24-Apr-2024 08:00                7928
intlchar.toupper.php                               24-Apr-2024 08:00                7675
intlcodepointbreakiterator.getlastcodepoint.php    24-Apr-2024 08:00                2725
intldateformatter.create.php                       24-Apr-2024 08:00               29291
intldateformatter.format.php                       24-Apr-2024 08:00               26607
intldateformatter.formatobject.php                 24-Apr-2024 08:00               14680
intldateformatter.getcalendar.php                  24-Apr-2024 08:00               11163
intldateformatter.getcalendarobject.php            24-Apr-2024 08:00                7664
intldateformatter.getdatetype.php                  24-Apr-2024 08:00               11609
intldateformatter.geterrorcode.php                 24-Apr-2024 08:00                8584
intldateformatter.geterrormessage.php              24-Apr-2024 08:00                8562
intldateformatter.getlocale.php                    24-Apr-2024 08:00               12159
intldateformatter.getpattern.php                   24-Apr-2024 08:00               10334
intldateformatter.gettimetype.php                  24-Apr-2024 08:00               11603
intldateformatter.gettimezone.php                  24-Apr-2024 08:00                8666
intldateformatter.gettimezoneid.php                24-Apr-2024 08:00                8891
intldateformatter.islenient.php                    24-Apr-2024 08:00               14707
intldateformatter.localtime.php                    24-Apr-2024 08:00               11555
intldateformatter.parse.php                        24-Apr-2024 08:00               12431
intldateformatter.setcalendar.php                  24-Apr-2024 08:00               14440
intldateformatter.setlenient.php                   24-Apr-2024 08:00               15535
intldateformatter.setpattern.php                   24-Apr-2024 08:00               11558
intldateformatter.settimezone.php                  24-Apr-2024 08:00               12529
intldatepatterngenerator.create.php                24-Apr-2024 08:00                4420
intldatepatterngenerator.getbestpattern.php        24-Apr-2024 08:00                6915
intlgregoriancalendar.construct.php                24-Apr-2024 08:00                5673
intlgregoriancalendar.createfromdate.php           24-Apr-2024 08:00                7427
intlgregoriancalendar.createfromdatetime.php       24-Apr-2024 08:00                9136
intlgregoriancalendar.getgregorianchange.php       24-Apr-2024 08:00                2705
intlgregoriancalendar.isleapyear.php               24-Apr-2024 08:00                3076
intlgregoriancalendar.setgregorianchange.php       24-Apr-2024 08:00                3085
intliterator.current.php                           24-Apr-2024 08:00                2357
intliterator.key.php                               24-Apr-2024 08:00                2326
intliterator.next.php                              24-Apr-2024 08:00                2342
intliterator.rewind.php                            24-Apr-2024 08:00                2370
intliterator.valid.php                             24-Apr-2024 08:00                2346
intlpartsiterator.getbreakiterator.php             24-Apr-2024 08:00                2568
intlrulebasedbreakiterator.construct.php           24-Apr-2024 08:00                3210
intlrulebasedbreakiterator.getbinaryrules.php      24-Apr-2024 08:00                2825
intlrulebasedbreakiterator.getrules.php            24-Apr-2024 08:00                2789
intlrulebasedbreakiterator.getrulestatus.php       24-Apr-2024 08:00                2761
intlrulebasedbreakiterator.getrulestatusvec.php    24-Apr-2024 08:00                2883
intltimezone.construct.php                         24-Apr-2024 08:00                1996
intltimezone.countequivalentids.php                24-Apr-2024 08:00                3696
intltimezone.createdefault.php                     24-Apr-2024 08:00                3017
intltimezone.createenumeration.php                 24-Apr-2024 08:00                4782
intltimezone.createtimezone.php                    24-Apr-2024 08:00                3672
intltimezone.createtimezoneidenumeration.php       24-Apr-2024 08:00                5846
intltimezone.fromdatetimezone.php                  24-Apr-2024 08:00                3793
intltimezone.getcanonicalid.php                    24-Apr-2024 08:00                4419
intltimezone.getdisplayname.php                    24-Apr-2024 08:00                5600
intltimezone.getdstsavings.php                     24-Apr-2024 08:00                3149
intltimezone.getequivalentid.php                   24-Apr-2024 08:00                4102
intltimezone.geterrorcode.php                      24-Apr-2024 08:00                3321
intltimezone.geterrormessage.php                   24-Apr-2024 08:00                3349
intltimezone.getgmt.php                            24-Apr-2024 08:00                2866
intltimezone.getid.php                             24-Apr-2024 08:00                3201
intltimezone.getidforwindowsid.php                 24-Apr-2024 08:00                5842
intltimezone.getoffset.php                         24-Apr-2024 08:00                5120
intltimezone.getrawoffset.php                      24-Apr-2024 08:00                3100
intltimezone.getregion.php                         24-Apr-2024 08:00                3687
intltimezone.gettzdataversion.php                  24-Apr-2024 08:00                3240
intltimezone.getunknown.php                        24-Apr-2024 08:00                3132
intltimezone.getwindowsid.php                      24-Apr-2024 08:00                4424
intltimezone.hassamerules.php                      24-Apr-2024 08:00                3534
intltimezone.todatetimezone.php                    24-Apr-2024 08:00                3450
intltimezone.usedaylighttime.php                   24-Apr-2024 08:00                3126
intro-whatcando.php                                24-Apr-2024 08:00                7538
intro-whatis.php                                   24-Apr-2024 08:00                4020
intro.apache.php                                   24-Apr-2024 08:00                1195
intro.apcu.php                                     24-Apr-2024 08:00                1844
intro.array.php                                    24-Apr-2024 08:00                1901
intro.bc.php                                       24-Apr-2024 08:00                4524
intro.bzip2.php                                    24-Apr-2024 08:00                1208
intro.calendar.php                                 24-Apr-2024 08:00                2059
intro.classobj.php                                 24-Apr-2024 08:00                1741
intro.cmark.php                                    24-Apr-2024 08:00                7357
intro.com.php                                      24-Apr-2024 08:00                3102
intro.componere.php                                24-Apr-2024 08:00                6683
intro.ctype.php                                    24-Apr-2024 08:00                3843
intro.cubrid.php                                   24-Apr-2024 08:00                1490
intro.curl.php                                     24-Apr-2024 08:00                1608
intro.datetime.php                                 24-Apr-2024 08:00                2689
intro.dba.php                                      24-Apr-2024 08:00                1510
intro.dbase.php                                    24-Apr-2024 08:00                6790
intro.dio.php                                      24-Apr-2024 08:00                1709
intro.dom.php                                      24-Apr-2024 08:00                1686
intro.ds.php                                       24-Apr-2024 08:00                1470
intro.eio.php                                      24-Apr-2024 08:00               14387
intro.enchant.php                                  24-Apr-2024 08:00                2623
intro.errorfunc.php                                24-Apr-2024 08:00                1905
intro.ev.php                                       24-Apr-2024 08:00                2283
intro.event.php                                    24-Apr-2024 08:00                1973
intro.exec.php                                     24-Apr-2024 08:00                1742
intro.exif.php                                     24-Apr-2024 08:00                1485
intro.expect.php                                   24-Apr-2024 08:00                1444
intro.fann.php                                     24-Apr-2024 08:00                1423
intro.fdf.php                                      24-Apr-2024 08:00                3839
intro.ffi.php                                      24-Apr-2024 08:00                2859
intro.fileinfo.php                                 24-Apr-2024 08:00                1409
intro.filesystem.php                               24-Apr-2024 08:00                1454
intro.filter.php                                   24-Apr-2024 08:00                2833
intro.fpm.php                                      24-Apr-2024 08:00                1324
intro.ftp.php                                      24-Apr-2024 08:00                1788
intro.funchand.php                                 24-Apr-2024 08:00                1243
intro.gearman.php                                  24-Apr-2024 08:00                1674
intro.gender.php                                   24-Apr-2024 08:00                1342
intro.geoip.php                                    24-Apr-2024 08:00                1582
intro.gettext.php                                  24-Apr-2024 08:00                1557
intro.gmagick.php                                  24-Apr-2024 08:00                1704
intro.gmp.php                                      24-Apr-2024 08:00                3010
intro.gnupg.php                                    24-Apr-2024 08:00                1231
intro.hash.php                                     24-Apr-2024 08:00                1246
intro.hrtime.php                                   24-Apr-2024 08:00                1674
intro.ibase.php                                    24-Apr-2024 08:00                3223
intro.ibm-db2.php                                  24-Apr-2024 08:00                1291
intro.iconv.php                                    24-Apr-2024 08:00                1967
intro.igbinary.php                                 24-Apr-2024 08:00                1686
intro.image.php                                    24-Apr-2024 08:00                6982
intro.imagick.php                                  24-Apr-2024 08:00                1767
intro.imap.php                                     24-Apr-2024 08:00                1700
intro.info.php                                     24-Apr-2024 08:00                1506
intro.inotify.php                                  24-Apr-2024 08:00                2353
intro.intl.php                                     24-Apr-2024 08:00                5025
intro.json.php                                     24-Apr-2024 08:00                1646
intro.ldap.php                                     24-Apr-2024 08:00                4091
intro.libxml.php                                   24-Apr-2024 08:00                1782
intro.lua.php                                      24-Apr-2024 08:00                1279
intro.luasandbox.php                               24-Apr-2024 08:00                2376
intro.lzf.php                                      24-Apr-2024 08:00                1432
intro.mail.php                                     24-Apr-2024 08:00                1228
intro.mailparse.php                                24-Apr-2024 08:00                1948
intro.math.php                                     24-Apr-2024 08:00                2015
intro.mbstring.php                                 24-Apr-2024 08:00                2871
intro.mcrypt.php                                   24-Apr-2024 08:00                2248
intro.memcache.php                                 24-Apr-2024 08:00                1695
intro.memcached.php                                24-Apr-2024 08:00                1888
intro.mhash.php                                    24-Apr-2024 08:00                2849
intro.misc.php                                     24-Apr-2024 08:00                1194
intro.mqseries.php                                 24-Apr-2024 08:00                1755
intro.mysql-xdevapi.php                            24-Apr-2024 08:00                1891
intro.mysql.php                                    24-Apr-2024 08:00                1922
intro.mysqli.php                                   24-Apr-2024 08:00                2179
intro.mysqlnd.php                                  24-Apr-2024 08:00                1957
intro.network.php                                  24-Apr-2024 08:00                1170
intro.oauth.php                                    24-Apr-2024 08:00                1345
intro.oci8.php                                     24-Apr-2024 08:00                1487
intro.opcache.php                                  24-Apr-2024 08:00                1541
intro.openal.php                                   24-Apr-2024 08:00                1264
intro.openssl.php                                  24-Apr-2024 08:00                1591
intro.outcontrol.php                               24-Apr-2024 08:00                1821
intro.parallel.php                                 24-Apr-2024 08:00                6902
intro.parle.php                                    24-Apr-2024 08:00                3450
intro.password.php                                 24-Apr-2024 08:00                1428
intro.pcntl.php                                    24-Apr-2024 08:00                2625
intro.pcre.php                                     24-Apr-2024 08:00                2674
intro.pdo.php                                      24-Apr-2024 08:00                2065
intro.pgsql.php                                    24-Apr-2024 08:00                1589
intro.phar.php                                     24-Apr-2024 08:00               10032
intro.phpdbg.php                                   24-Apr-2024 08:00                6052
intro.posix.php                                    24-Apr-2024 08:00                1732
intro.ps.php                                       24-Apr-2024 08:00                1773
intro.pspell.php                                   24-Apr-2024 08:00                1206
intro.pthreads.php                                 24-Apr-2024 08:00                9142
intro.quickhash.php                                24-Apr-2024 08:00                1278
intro.radius.php                                   24-Apr-2024 08:00                2176
intro.random.php                                   24-Apr-2024 08:00                1120
intro.rar.php                                      24-Apr-2024 08:00                1552
intro.readline.php                                 24-Apr-2024 08:00                1974
intro.recode.php                                   24-Apr-2024 08:00                2273
intro.reflection.php                               24-Apr-2024 08:00                1786
intro.rnp.php                                      24-Apr-2024 08:00                1291
intro.rpminfo.php                                  24-Apr-2024 08:00                1408
intro.rrd.php                                      24-Apr-2024 08:00                1447
intro.runkit7.php                                  24-Apr-2024 08:00                1490
intro.scoutapm.php                                 24-Apr-2024 08:00                1476
intro.seaslog.php                                  24-Apr-2024 08:00                3944
intro.sem.php                                      24-Apr-2024 08:00                3234
intro.session.php                                  24-Apr-2024 08:00                4754
intro.shmop.php                                    24-Apr-2024 08:00                1252
intro.simdjson.php                                 24-Apr-2024 08:00                1240
intro.simplexml.php                                24-Apr-2024 08:00                1330
intro.snmp.php                                     24-Apr-2024 08:00                1670
intro.soap.php                                     24-Apr-2024 08:00                1475
intro.sockets.php                                  24-Apr-2024 08:00                2599
intro.sodium.php                                   24-Apr-2024 08:00                1341
intro.solr.php                                     24-Apr-2024 08:00                1796
intro.spl.php                                      24-Apr-2024 08:00                1586
intro.sqlite3.php                                  24-Apr-2024 08:00                1171
intro.sqlsrv.php                                   24-Apr-2024 08:00                2177
intro.ssdeep.php                                   24-Apr-2024 08:00                1770
intro.ssh2.php                                     24-Apr-2024 08:00                1352
intro.stats.php                                    24-Apr-2024 08:00                1522
intro.stomp.php                                    24-Apr-2024 08:00                1355
intro.stream.php                                   24-Apr-2024 08:00                3947
intro.strings.php                                  24-Apr-2024 08:00                1654
intro.svm.php                                      24-Apr-2024 08:00                1253
intro.svn.php                                      24-Apr-2024 08:00                1797
intro.swoole.php                                   24-Apr-2024 08:00                1649
intro.sync.php                                     24-Apr-2024 08:00                2363
intro.taint.php                                    24-Apr-2024 08:00                4306
intro.tcpwrap.php                                  24-Apr-2024 08:00                1284
intro.tidy.php                                     24-Apr-2024 08:00                1420
intro.tokenizer.php                                24-Apr-2024 08:00                1524
intro.trader.php                                   24-Apr-2024 08:00                2399
intro.ui.php                                       24-Apr-2024 08:00                1212
intro.uodbc.php                                    24-Apr-2024 08:00                2767
intro.uopz.php                                     24-Apr-2024 08:00                2293
intro.url.php                                      24-Apr-2024 08:00                1155
intro.v8js.php                                     24-Apr-2024 08:00                1239
intro.var.php                                      24-Apr-2024 08:00                1333
intro.var_representation.php                       24-Apr-2024 08:00                1440
intro.varnish.php                                  24-Apr-2024 08:00                1329
intro.wddx.php                                     24-Apr-2024 08:00                2158
intro.win32service.php                             24-Apr-2024 08:00                1412
intro.wincache.php                                 24-Apr-2024 08:00                4901
intro.wkhtmltox.php                                24-Apr-2024 08:00                1288
intro.xattr.php                                    24-Apr-2024 08:00                1201
intro.xdiff.php                                    24-Apr-2024 08:00                2623
intro.xhprof.php                                   24-Apr-2024 08:00                2805
intro.xlswriter.php                                24-Apr-2024 08:00                1201
intro.xml.php                                      24-Apr-2024 08:00                2265
intro.xmldiff.php                                  24-Apr-2024 08:00                1422
intro.xmlreader.php                                24-Apr-2024 08:00                1598
intro.xmlrpc.php                                   24-Apr-2024 08:00                1879
intro.xmlwriter.php                                24-Apr-2024 08:00                1560
intro.xsl.php                                      24-Apr-2024 08:00                1349
intro.yac.php                                      24-Apr-2024 08:00                1213
intro.yaconf.php                                   24-Apr-2024 08:00                2560
intro.yaf.php                                      24-Apr-2024 08:00                1561
intro.yaml.php                                     24-Apr-2024 08:00                1417
intro.yar.php                                      24-Apr-2024 08:00                1282
intro.yaz.php                                      24-Apr-2024 08:00                2539
intro.zip.php                                      24-Apr-2024 08:00                1207
intro.zlib.php                                     24-Apr-2024 08:00                1705
intro.zmq.php                                      24-Apr-2024 08:00                1398
intro.zookeeper.php                                24-Apr-2024 08:00                1459
introduction.php                                   24-Apr-2024 08:00                1482
iterator.current.php                               24-Apr-2024 08:00                2160
iterator.key.php                                   24-Apr-2024 08:00                2545
iterator.next.php                                  24-Apr-2024 08:00                2404
iterator.rewind.php                                24-Apr-2024 08:00                2579
iterator.valid.php                                 24-Apr-2024 08:00                2764
iteratoraggregate.getiterator.php                  24-Apr-2024 08:00                2851
iteratoriterator.construct.php                     24-Apr-2024 08:00                3464
iteratoriterator.current.php                       24-Apr-2024 08:00                2730
iteratoriterator.getinneriterator.php              24-Apr-2024 08:00                3177
iteratoriterator.key.php                           24-Apr-2024 08:00                2678
iteratoriterator.next.php                          24-Apr-2024 08:00                2835
iteratoriterator.rewind.php                        24-Apr-2024 08:00                2854
iteratoriterator.valid.php                         24-Apr-2024 08:00                3049
json.configuration.php                             24-Apr-2024 08:00                1259
json.constants.php                                 24-Apr-2024 08:00               16439
json.installation.php                              24-Apr-2024 08:00                1794
json.requirements.php                              24-Apr-2024 08:00                1235
json.resources.php                                 24-Apr-2024 08:00                1204
json.setup.php                                     24-Apr-2024 08:00                1580
jsonserializable.jsonserialize.php                 24-Apr-2024 08:00               12546
langref.php                                        24-Apr-2024 08:00               20213
language.attributes.classes.php                    24-Apr-2024 08:00                6574
language.attributes.overview.php                   24-Apr-2024 08:00               10212
language.attributes.php                            24-Apr-2024 08:00                1755
language.attributes.reflection.php                 24-Apr-2024 08:00                8209
language.attributes.syntax.php                     24-Apr-2024 08:00                6091
language.basic-syntax.comments.php                 24-Apr-2024 08:00                3865
language.basic-syntax.instruction-separation.php   24-Apr-2024 08:00                4163
language.basic-syntax.php                          24-Apr-2024 08:00                1681
language.basic-syntax.phpmode.php                  24-Apr-2024 08:00                4508
language.basic-syntax.phptags.php                  24-Apr-2024 08:00                4739
language.constants.magic.php                       24-Apr-2024 08:00                5482
language.constants.php                             24-Apr-2024 08:00                6052
language.constants.predefined.php                  24-Apr-2024 08:00                1556
language.constants.syntax.php                      24-Apr-2024 08:00               10211
language.control-structures.php                    24-Apr-2024 08:00                2761
language.enumerations.backed.php                   24-Apr-2024 08:00                9882
language.enumerations.basics.php                   24-Apr-2024 08:00                8057
language.enumerations.constants.php                24-Apr-2024 08:00                2386
language.enumerations.examples.php                 24-Apr-2024 08:00                7330
language.enumerations.expressions.php              24-Apr-2024 08:00                6590
language.enumerations.listing.php                  24-Apr-2024 08:00                2222
language.enumerations.methods.php                  24-Apr-2024 08:00               13501
language.enumerations.object-differences.inheri..> 24-Apr-2024 08:00                6027
language.enumerations.object-differences.php       24-Apr-2024 08:00                4764
language.enumerations.overview.php                 24-Apr-2024 08:00                2339
language.enumerations.php                          24-Apr-2024 08:00                2465
language.enumerations.serialization.php            24-Apr-2024 08:00                4891
language.enumerations.static-methods.php           24-Apr-2024 08:00                3239
language.enumerations.traits.php                   24-Apr-2024 08:00                4339
language.errors.basics.php                         24-Apr-2024 08:00                4822
language.errors.php                                24-Apr-2024 08:00                1865
language.errors.php7.php                           24-Apr-2024 08:00                5754
language.exceptions.extending.php                  24-Apr-2024 08:00               19360
language.exceptions.php                            24-Apr-2024 08:00               27354
language.expressions.php                           24-Apr-2024 08:00               15549
language.fibers.php                                24-Apr-2024 08:00                6211
language.functions.php                             24-Apr-2024 08:00                1968
language.generators.comparison.php                 24-Apr-2024 08:00                8874
language.generators.overview.php                   24-Apr-2024 08:00                9096
language.generators.php                            24-Apr-2024 08:00                1613
language.generators.syntax.php                     24-Apr-2024 08:00               23687
language.namespaces.basics.php                     24-Apr-2024 08:00               10747
language.namespaces.definition.php                 24-Apr-2024 08:00                4200
language.namespaces.definitionmultiple.php         24-Apr-2024 08:00                8941
language.namespaces.dynamic.php                    24-Apr-2024 08:00                8105
language.namespaces.fallback.php                   24-Apr-2024 08:00                5920
language.namespaces.faq.php                        24-Apr-2024 08:00               31144
language.namespaces.global.php                     24-Apr-2024 08:00                2708
language.namespaces.importing.php                  24-Apr-2024 08:00               14781
language.namespaces.nested.php                     24-Apr-2024 08:00                2779
language.namespaces.nsconstants.php                24-Apr-2024 08:00                8634
language.namespaces.php                            24-Apr-2024 08:00                2306
language.namespaces.rationale.php                  24-Apr-2024 08:00                6168
language.namespaces.rules.php                      24-Apr-2024 08:00               11757
language.oop5.abstract.php                         24-Apr-2024 08:00               10793
language.oop5.anonymous.php                        24-Apr-2024 08:00               10397
language.oop5.autoload.php                         24-Apr-2024 08:00                6535
language.oop5.basic.php                            24-Apr-2024 08:00               48256
language.oop5.changelog.php                        24-Apr-2024 08:00               13247
language.oop5.cloning.php                          24-Apr-2024 08:00                8745
language.oop5.constants.php                        24-Apr-2024 08:00                8905
language.oop5.decon.php                            24-Apr-2024 08:00               27857
language.oop5.final.php                            24-Apr-2024 08:00                5955
language.oop5.inheritance.php                      24-Apr-2024 08:00               12887
language.oop5.interfaces.php                       24-Apr-2024 08:00               22643
language.oop5.iterations.php                       24-Apr-2024 08:00                5825
language.oop5.late-static-bindings.php             24-Apr-2024 08:00               14237
language.oop5.magic.php                            24-Apr-2024 08:00               43249
language.oop5.object-comparison.php                24-Apr-2024 08:00                8730
language.oop5.overloading.php                      24-Apr-2024 08:00               23743
language.oop5.paamayim-nekudotayim.php             24-Apr-2024 08:00                8378
language.oop5.php                                  24-Apr-2024 08:00                3268
language.oop5.properties.php                       24-Apr-2024 08:00               27023
language.oop5.references.php                       24-Apr-2024 08:00                5715
language.oop5.serialization.php                    24-Apr-2024 08:00                7008
language.oop5.static.php                           24-Apr-2024 08:00                9123
language.oop5.traits.php                           24-Apr-2024 08:00               34669
language.oop5.variance.php                         24-Apr-2024 08:00               15703
language.oop5.visibility.php                       24-Apr-2024 08:00               24282
language.operators.arithmetic.php                  24-Apr-2024 08:00                5721
language.operators.array.php                       24-Apr-2024 08:00                8835
language.operators.assignment.php                  24-Apr-2024 08:00               10955
language.operators.bitwise.php                     24-Apr-2024 08:00               43015
language.operators.comparison.php                  24-Apr-2024 08:00               41541
language.operators.errorcontrol.php                24-Apr-2024 08:00                5738
language.operators.execution.php                   24-Apr-2024 08:00                3203
language.operators.increment.php                   24-Apr-2024 08:00               13810
language.operators.logical.php                     24-Apr-2024 08:00                7597
language.operators.php                             24-Apr-2024 08:00                3771
language.operators.precedence.php                  24-Apr-2024 08:00               19101
language.operators.string.php                      24-Apr-2024 08:00                3122
language.operators.type.php                        24-Apr-2024 08:00               18055
language.references.arent.php                      24-Apr-2024 08:00                3166
language.references.pass.php                       24-Apr-2024 08:00                6610
language.references.php                            24-Apr-2024 08:00                1956
language.references.return.php                     24-Apr-2024 08:00                6881
language.references.spot.php                       24-Apr-2024 08:00                2463
language.references.unset.php                      24-Apr-2024 08:00                2295
language.references.whatare.php                    24-Apr-2024 08:00                1960
language.references.whatdo.php                     24-Apr-2024 08:00               18202
language.types.array.php                           24-Apr-2024 08:00              100002
language.types.boolean.php                         24-Apr-2024 08:00                9576
language.types.callable.php                        24-Apr-2024 08:00               12042
language.types.declarations.php                    24-Apr-2024 08:00               42637
language.types.enumerations.php                    24-Apr-2024 08:00                3655
language.types.float.php                           24-Apr-2024 08:00                9327
language.types.integer.php                         24-Apr-2024 08:00               20668
language.types.intro.php                           24-Apr-2024 08:00                8363
language.types.iterable.php                        24-Apr-2024 08:00                2958
language.types.mixed.php                           24-Apr-2024 08:00                1717
language.types.never.php                           24-Apr-2024 08:00                1936
language.types.null.php                            24-Apr-2024 08:00                3544
language.types.numeric-strings.php                 24-Apr-2024 08:00               10938
language.types.object.php                          24-Apr-2024 08:00                5640
language.types.php                                 24-Apr-2024 08:00                2760
language.types.relative-class-types.php            24-Apr-2024 08:00                2377
language.types.resource.php                        24-Apr-2024 08:00                3150
language.types.string.php                          24-Apr-2024 08:00               79739
language.types.type-juggling.php                   24-Apr-2024 08:00               26558
language.types.type-system.php                     24-Apr-2024 08:00                8412
language.types.value.php                           24-Apr-2024 08:00                2165
language.types.void.php                            24-Apr-2024 08:00                1963
language.variables.basics.php                      24-Apr-2024 08:00               13409
language.variables.external.php                    24-Apr-2024 08:00               17133
language.variables.php                             24-Apr-2024 08:00                1744
language.variables.predefined.php                  24-Apr-2024 08:00                2838
language.variables.scope.php                       24-Apr-2024 08:00               27718
language.variables.superglobals.php                24-Apr-2024 08:00                4243
language.variables.variable.php                    24-Apr-2024 08:00               10067
ldap.configuration.php                             24-Apr-2024 08:00                2407
ldap.constants.php                                 24-Apr-2024 08:00               32810
ldap.controls.php                                  24-Apr-2024 08:00                9924
ldap.examples-basic.php                            24-Apr-2024 08:00                8121
ldap.examples-controls.php                         24-Apr-2024 08:00               15995
ldap.examples.php                                  24-Apr-2024 08:00                1444
ldap.installation.php                              24-Apr-2024 08:00                2833
ldap.requirements.php                              24-Apr-2024 08:00                1536
ldap.resources.php                                 24-Apr-2024 08:00                1424
ldap.setup.php                                     24-Apr-2024 08:00                1607
ldap.using.php                                     24-Apr-2024 08:00                2249
libxml.configuration.php                           24-Apr-2024 08:00                1303
libxml.constants.php                               24-Apr-2024 08:00               13216
libxml.installation.php                            24-Apr-2024 08:00                1933
libxml.installation_old.php                        24-Apr-2024 08:00                2618
libxml.requirements.php                            24-Apr-2024 08:00                1367
libxml.resources.php                               24-Apr-2024 08:00                1218
libxml.setup.php                                   24-Apr-2024 08:00                1745
limititerator.construct.php                        24-Apr-2024 08:00                7315
limititerator.current.php                          24-Apr-2024 08:00                3563
limititerator.getposition.php                      24-Apr-2024 08:00                5741
limititerator.key.php                              24-Apr-2024 08:00                3613
limititerator.next.php                             24-Apr-2024 08:00                3293
limititerator.rewind.php                           24-Apr-2024 08:00                3461
limititerator.seek.php                             24-Apr-2024 08:00                4131
limititerator.valid.php                            24-Apr-2024 08:00                3507
locale.acceptfromhttp.php                          24-Apr-2024 08:00                6223
locale.canonicalize.php                            24-Apr-2024 08:00                3185
locale.composelocale.php                           24-Apr-2024 08:00               13438
locale.filtermatches.php                           24-Apr-2024 08:00                9281
locale.getallvariants.php                          24-Apr-2024 08:00                6679
locale.getdefault.php                              24-Apr-2024 08:00                5856
locale.getdisplaylanguage.php                      24-Apr-2024 08:00                9871
locale.getdisplayname.php                          24-Apr-2024 08:00                9853
locale.getdisplayregion.php                        24-Apr-2024 08:00                9819
locale.getdisplayscript.php                        24-Apr-2024 08:00                9826
locale.getdisplayvariant.php                       24-Apr-2024 08:00                9865
locale.getkeywords.php                             24-Apr-2024 08:00                7291
locale.getprimarylanguage.php                      24-Apr-2024 08:00                6080
locale.getregion.php                               24-Apr-2024 08:00                6021
locale.getscript.php                               24-Apr-2024 08:00                5699
locale.lookup.php                                  24-Apr-2024 08:00               10167
locale.parselocale.php                             24-Apr-2024 08:00                7402
locale.setdefault.php                              24-Apr-2024 08:00                5366
lua.assign.php                                     24-Apr-2024 08:00                4623
lua.call.php                                       24-Apr-2024 08:00                7508
lua.configuration.php                              24-Apr-2024 08:00                1252
lua.construct.php                                  24-Apr-2024 08:00                2417
lua.eval.php                                       24-Apr-2024 08:00                3774
lua.getversion.php                                 24-Apr-2024 08:00                2288
lua.include.php                                    24-Apr-2024 08:00                2721
lua.installation.php                               24-Apr-2024 08:00                2009
lua.registercallback.php                           24-Apr-2024 08:00                4588
lua.requirements.php                               24-Apr-2024 08:00                1299
lua.resources.php                                  24-Apr-2024 08:00                1202
lua.setup.php                                      24-Apr-2024 08:00                1567
luaclosure.invoke.php                              24-Apr-2024 08:00                4131
luasandbox.callfunction.php                        24-Apr-2024 08:00                5069
luasandbox.configuration.php                       24-Apr-2024 08:00                1301
luasandbox.disableprofiler.php                     24-Apr-2024 08:00                2879
luasandbox.enableprofiler.php                      24-Apr-2024 08:00                3524
luasandbox.examples-basic.php                      24-Apr-2024 08:00                6650
luasandbox.examples.php                            24-Apr-2024 08:00                1504
luasandbox.getcpuusage.php                         24-Apr-2024 08:00                3632
luasandbox.getmemoryusage.php                      24-Apr-2024 08:00                3212
luasandbox.getpeakmemoryusage.php                  24-Apr-2024 08:00                3262
luasandbox.getprofilerfunctionreport.php           24-Apr-2024 08:00                6023
luasandbox.getversioninfo.php                      24-Apr-2024 08:00                3127
luasandbox.installation.php                        24-Apr-2024 08:00                2126
luasandbox.loadbinary.php                          24-Apr-2024 08:00                3653
luasandbox.loadstring.php                          24-Apr-2024 08:00                5640
luasandbox.pauseusagetimer.php                     24-Apr-2024 08:00                9431
luasandbox.registerlibrary.php                     24-Apr-2024 08:00                6649
luasandbox.requirements.php                        24-Apr-2024 08:00                1785
luasandbox.resources.php                           24-Apr-2024 08:00                1267
luasandbox.setcpulimit.php                         24-Apr-2024 08:00                6157
luasandbox.setmemorylimit.php                      24-Apr-2024 08:00                5562
luasandbox.setup.php                               24-Apr-2024 08:00                1658
luasandbox.unpauseusagetimer.php                   24-Apr-2024 08:00                3175
luasandbox.wrapphpfunction.php                     24-Apr-2024 08:00                4391
luasandboxfunction.call.php                        24-Apr-2024 08:00                8046
luasandboxfunction.construct.php                   24-Apr-2024 08:00                2708
luasandboxfunction.dump.php                        24-Apr-2024 08:00                2468
lzf.configuration.php                              24-Apr-2024 08:00                1252
lzf.constants.php                                  24-Apr-2024 08:00                1163
lzf.installation.php                               24-Apr-2024 08:00                2457
lzf.requirements.php                               24-Apr-2024 08:00                1199
lzf.resources.php                                  24-Apr-2024 08:00                1197
lzf.setup.php                                      24-Apr-2024 08:00                1588
mail.configuration.php                             24-Apr-2024 08:00                7854
mail.constants.php                                 24-Apr-2024 08:00                1172
mail.installation.php                              24-Apr-2024 08:00                1242
mail.requirements.php                              24-Apr-2024 08:00                1896
mail.resources.php                                 24-Apr-2024 08:00                1204
mail.setup.php                                     24-Apr-2024 08:00                1601
mailparse.configuration.php                        24-Apr-2024 08:00                2526
mailparse.constants.php                            24-Apr-2024 08:00                2391
mailparse.installation.php                         24-Apr-2024 08:00                2486
mailparse.requirements.php                         24-Apr-2024 08:00                1241
mailparse.resources.php                            24-Apr-2024 08:00                1567
mailparse.setup.php                                24-Apr-2024 08:00                1666
manual.php                                         24-Apr-2024 08:00                1282
math.configuration.php                             24-Apr-2024 08:00                1259
math.constants.php                                 24-Apr-2024 08:00                7207
math.installation.php                              24-Apr-2024 08:00                1242
math.requirements.php                              24-Apr-2024 08:00                1206
math.resources.php                                 24-Apr-2024 08:00                1204
math.setup.php                                     24-Apr-2024 08:00                1596
mbstring.configuration.php                         24-Apr-2024 08:00               16254
mbstring.constants.php                             24-Apr-2024 08:00                6838
mbstring.encodings.php                             24-Apr-2024 08:00               15449
mbstring.http.php                                  24-Apr-2024 08:00                5106
mbstring.installation.php                          24-Apr-2024 08:00                3346
mbstring.ja-basic.php                              24-Apr-2024 08:00                3730
mbstring.overload.php                              24-Apr-2024 08:00                7225
mbstring.php4.req.php                              24-Apr-2024 08:00                4032
mbstring.requirements.php                          24-Apr-2024 08:00                1234
mbstring.resources.php                             24-Apr-2024 08:00                1232
mbstring.setup.php                                 24-Apr-2024 08:00                1666
mbstring.supported-encodings.php                   24-Apr-2024 08:00                8221
mcrypt.ciphers.php                                 24-Apr-2024 08:00                6264
mcrypt.configuration.php                           24-Apr-2024 08:00                3672
mcrypt.constants.php                               24-Apr-2024 08:00                6465
mcrypt.installation.php                            24-Apr-2024 08:00                1798
mcrypt.requirements.php                            24-Apr-2024 08:00                2146
mcrypt.resources.php                               24-Apr-2024 08:00                1327
mcrypt.setup.php                                   24-Apr-2024 08:00                1633
memcache.add.php                                   24-Apr-2024 08:00                7241
memcache.addserver.php                             24-Apr-2024 08:00               13783
memcache.close.php                                 24-Apr-2024 08:00                5174
memcache.connect.php                               24-Apr-2024 08:00                7443
memcache.constants.php                             24-Apr-2024 08:00                5204
memcache.decrement.php                             24-Apr-2024 08:00                7267
memcache.delete.php                                24-Apr-2024 08:00                6538
memcache.examples-overview.php                     24-Apr-2024 08:00                6456
memcache.examples.php                              24-Apr-2024 08:00                1433
memcache.flush.php                                 24-Apr-2024 08:00                4594
memcache.get.php                                   24-Apr-2024 08:00                8868
memcache.getextendedstats.php                      24-Apr-2024 08:00                8224
memcache.getserverstatus.php                       24-Apr-2024 08:00                6201
memcache.getstats.php                              24-Apr-2024 08:00                4841
memcache.getversion.php                            24-Apr-2024 08:00                5051
memcache.increment.php                             24-Apr-2024 08:00                7065
memcache.ini.php                                   24-Apr-2024 08:00               10673
memcache.installation.php                          24-Apr-2024 08:00                2132
memcache.pconnect.php                              24-Apr-2024 08:00                6295
memcache.replace.php                               24-Apr-2024 08:00                7344
memcache.requirements.php                          24-Apr-2024 08:00                1375
memcache.resources.php                             24-Apr-2024 08:00                1305
memcache.set.php                                   24-Apr-2024 08:00                9702
memcache.setcompressthreshold.php                  24-Apr-2024 08:00                6035
memcache.setserverparams.php                       24-Apr-2024 08:00               11203
memcache.setup.php                                 24-Apr-2024 08:00                1648
memcached.add.php                                  24-Apr-2024 08:00                4655
memcached.addbykey.php                             24-Apr-2024 08:00                5581
memcached.addserver.php                            24-Apr-2024 08:00                7683
memcached.addservers.php                           24-Apr-2024 08:00                5443
memcached.append.php                               24-Apr-2024 08:00                7491
memcached.appendbykey.php                          24-Apr-2024 08:00                5159
memcached.callbacks.php                            24-Apr-2024 08:00                1547
memcached.callbacks.read-through.php               24-Apr-2024 08:00                4380
memcached.callbacks.result.php                     24-Apr-2024 08:00                4877
memcached.cas.php                                  24-Apr-2024 08:00                9430
memcached.casbykey.php                             24-Apr-2024 08:00                5907
memcached.configuration.php                        24-Apr-2024 08:00               28321
memcached.constants.php                            24-Apr-2024 08:00               29439
memcached.construct.php                            24-Apr-2024 08:00                5718
memcached.decrement.php                            24-Apr-2024 08:00                9147
memcached.decrementbykey.php                       24-Apr-2024 08:00                5971
memcached.delete.php                               24-Apr-2024 08:00                5662
memcached.deletebykey.php                          24-Apr-2024 08:00                5574
memcached.deletemulti.php                          24-Apr-2024 08:00                4839
memcached.deletemultibykey.php                     24-Apr-2024 08:00                5776
memcached.expiration.php                           24-Apr-2024 08:00                1949
memcached.fetch.php                                24-Apr-2024 08:00                6763
memcached.fetchall.php                             24-Apr-2024 08:00                6547
memcached.flush.php                                24-Apr-2024 08:00                4723
memcached.get.php                                  24-Apr-2024 08:00               10466
memcached.getallkeys.php                           24-Apr-2024 08:00                3066
memcached.getbykey.php                             24-Apr-2024 08:00                6618
memcached.getdelayed.php                           24-Apr-2024 08:00                8852
memcached.getdelayedbykey.php                      24-Apr-2024 08:00                5789
memcached.getmulti.php                             24-Apr-2024 08:00               20837
memcached.getmultibykey.php                        24-Apr-2024 08:00                5646
memcached.getoption.php                            24-Apr-2024 08:00                5186
memcached.getresultcode.php                        24-Apr-2024 08:00                4277
memcached.getresultmessage.php                     24-Apr-2024 08:00                4711
memcached.getserverbykey.php                       24-Apr-2024 08:00                7393
memcached.getserverlist.php                        24-Apr-2024 08:00                4625
memcached.getstats.php                             24-Apr-2024 08:00                5762
memcached.getversion.php                           24-Apr-2024 08:00                4015
memcached.increment.php                            24-Apr-2024 08:00                8477
memcached.incrementbykey.php                       24-Apr-2024 08:00                5904
memcached.installation.php                         24-Apr-2024 08:00                2630
memcached.ispersistent.php                         24-Apr-2024 08:00                3027
memcached.ispristine.php                           24-Apr-2024 08:00                2954
memcached.prepend.php                              24-Apr-2024 08:00                7518
memcached.prependbykey.php                         24-Apr-2024 08:00                5184
memcached.quit.php                                 24-Apr-2024 08:00                2463
memcached.replace.php                              24-Apr-2024 08:00                4727
memcached.replacebykey.php                         24-Apr-2024 08:00                5668
memcached.requirements.php                         24-Apr-2024 08:00                1549
memcached.resetserverlist.php                      24-Apr-2024 08:00                3172
memcached.resources.php                            24-Apr-2024 08:00                1239
memcached.sessions.php                             24-Apr-2024 08:00                2452
memcached.set.php                                  24-Apr-2024 08:00                9172
memcached.setbykey.php                             24-Apr-2024 08:00                6990
memcached.setmulti.php                             24-Apr-2024 08:00                6240
memcached.setmultibykey.php                        24-Apr-2024 08:00                4928
memcached.setoption.php                            24-Apr-2024 08:00                7332
memcached.setoptions.php                           24-Apr-2024 08:00                6951
memcached.setsaslauthdata.php                      24-Apr-2024 08:00                3531
memcached.setup.php                                24-Apr-2024 08:00                1666
memcached.touch.php                                24-Apr-2024 08:00                3762
memcached.touchbykey.php                           24-Apr-2024 08:00                4643
messageformatter.create.php                        24-Apr-2024 08:00               11033
messageformatter.format.php                        24-Apr-2024 08:00                9710
messageformatter.formatmessage.php                 24-Apr-2024 08:00               14451
messageformatter.geterrorcode.php                  24-Apr-2024 08:00                3997
messageformatter.geterrormessage.php               24-Apr-2024 08:00                7629
messageformatter.getlocale.php                     24-Apr-2024 08:00                5486
messageformatter.getpattern.php                    24-Apr-2024 08:00               10073
messageformatter.parse.php                         24-Apr-2024 08:00                9823
messageformatter.parsemessage.php                  24-Apr-2024 08:00               10020
messageformatter.setpattern.php                    24-Apr-2024 08:00               10605
mhash.configuration.php                            24-Apr-2024 08:00                1266
mhash.constants.php                                24-Apr-2024 08:00                7214
mhash.examples.php                                 24-Apr-2024 08:00                3327
mhash.installation.php                             24-Apr-2024 08:00                1627
mhash.requirements.php                             24-Apr-2024 08:00                1356
mhash.resources.php                                24-Apr-2024 08:00                1211
mhash.setup.php                                    24-Apr-2024 08:00                1614
migration56.changed-functions.php                  24-Apr-2024 08:00                6927
migration56.constants.php                          24-Apr-2024 08:00                6165
migration56.deprecated.php                         24-Apr-2024 08:00                6278
migration56.extensions.php                         24-Apr-2024 08:00                4373
migration56.incompatible.php                       24-Apr-2024 08:00                8515
migration56.new-features.php                       24-Apr-2024 08:00               28911
migration56.new-functions.php                      24-Apr-2024 08:00                7555
migration56.openssl.php                            24-Apr-2024 08:00               25860
migration56.php                                    24-Apr-2024 08:00                2441
migration70.changed-functions.php                  24-Apr-2024 08:00                5249
migration70.classes.php                            24-Apr-2024 08:00                3935
migration70.constants.php                          24-Apr-2024 08:00                9523
migration70.deprecated.php                         24-Apr-2024 08:00                5701
migration70.incompatible.php                       24-Apr-2024 08:00               62224
migration70.new-features.php                       24-Apr-2024 08:00               41104
migration70.new-functions.php                      24-Apr-2024 08:00                7393
migration70.other-changes.php                      24-Apr-2024 08:00                3458
migration70.php                                    24-Apr-2024 08:00                2818
migration70.removed-exts-sapis.php                 24-Apr-2024 08:00                3189
migration70.sapi-changes.php                       24-Apr-2024 08:00                2034
migration71.changed-functions.php                  24-Apr-2024 08:00                7628
migration71.constants.php                          24-Apr-2024 08:00                8806
migration71.deprecated.php                         24-Apr-2024 08:00                2306
migration71.incompatible.php                       24-Apr-2024 08:00               32287
migration71.new-features.php                       24-Apr-2024 08:00               27293
migration71.new-functions.php                      24-Apr-2024 08:00                5090
migration71.other-changes.php                      24-Apr-2024 08:00                8615
migration71.php                                    24-Apr-2024 08:00                2484
migration71.windows-support.php                    24-Apr-2024 08:00                7185
migration72.constants.php                          24-Apr-2024 08:00               31998
migration72.deprecated.php                         24-Apr-2024 08:00               10523
migration72.incompatible.php                       24-Apr-2024 08:00               19714
migration72.new-features.php                       24-Apr-2024 08:00               19006
migration72.new-functions.php                      24-Apr-2024 08:00               24434
migration72.other-changes.php                      24-Apr-2024 08:00                5900
migration72.php                                    24-Apr-2024 08:00                2383
migration73.constants.php                          24-Apr-2024 08:00               25892
migration73.deprecated.php                         24-Apr-2024 08:00                8769
migration73.incompatible.php                       24-Apr-2024 08:00               18136
migration73.new-features.php                       24-Apr-2024 08:00               16804
migration73.new-functions.php                      24-Apr-2024 08:00                7464
migration73.other-changes.php                      24-Apr-2024 08:00               16576
migration73.php                                    24-Apr-2024 08:00                2500
migration73.windows-support.php                    24-Apr-2024 08:00                1861
migration74.constants.php                          24-Apr-2024 08:00                7802
migration74.deprecated.php                         24-Apr-2024 08:00               15301
migration74.incompatible.php                       24-Apr-2024 08:00               18510
migration74.new-classes.php                        24-Apr-2024 08:00                1541
migration74.new-features.php                       24-Apr-2024 08:00               21994
migration74.new-functions.php                      24-Apr-2024 08:00                3757
migration74.other-changes.php                      24-Apr-2024 08:00               21284
migration74.php                                    24-Apr-2024 08:00                2715
migration74.removed-extensions.php                 24-Apr-2024 08:00                1949
migration74.windows-support.php                    24-Apr-2024 08:00                3814
migration80.deprecated.php                         24-Apr-2024 08:00               18810
migration80.incompatible.php                       24-Apr-2024 08:00               99088
migration80.new-features.php                       24-Apr-2024 08:00               32558
migration80.other-changes.php                      24-Apr-2024 08:00               15142
migration80.php                                    24-Apr-2024 08:00                2367
migration81.constants.php                          24-Apr-2024 08:00                8309
migration81.deprecated.php                         24-Apr-2024 08:00               19489
migration81.incompatible.php                       24-Apr-2024 08:00               23305
migration81.new-classes.php                        24-Apr-2024 08:00                2177
migration81.new-features.php                       24-Apr-2024 08:00               23962
migration81.new-functions.php                      24-Apr-2024 08:00                8517
migration81.other-changes.php                      24-Apr-2024 08:00                9916
migration81.php                                    24-Apr-2024 08:00                2587
migration82.constants.php                          24-Apr-2024 08:00               22202
migration82.deprecated.php                         24-Apr-2024 08:00                5911
migration82.incompatible.php                       24-Apr-2024 08:00                9681
migration82.new-features.php                       24-Apr-2024 08:00                7237
migration82.new-functions.php                      24-Apr-2024 08:00                4328
migration82.other-changes.php                      24-Apr-2024 08:00               25831
migration82.php                                    24-Apr-2024 08:00                2633
migration82.windows-support.php                    24-Apr-2024 08:00                2351
migration83.constants.php                          24-Apr-2024 08:00               15547
migration83.deprecated.php                         24-Apr-2024 08:00                7752
migration83.incompatible.php                       24-Apr-2024 08:00               14742
migration83.new-classes.php                        24-Apr-2024 08:00                3429
migration83.new-features.php                       24-Apr-2024 08:00                7284
migration83.new-functions.php                      24-Apr-2024 08:00                7347
migration83.other-changes.php                      24-Apr-2024 08:00               32041
migration83.php                                    24-Apr-2024 08:00                2774
migration83.windows-support.php                    24-Apr-2024 08:00                1427
misc.configuration.php                             24-Apr-2024 08:00                6045
misc.constants.php                                 24-Apr-2024 08:00                2607
misc.installation.php                              24-Apr-2024 08:00                1242
misc.requirements.php                              24-Apr-2024 08:00                1206
misc.resources.php                                 24-Apr-2024 08:00                1204
misc.setup.php                                     24-Apr-2024 08:00                1586
mongodb-bson-binary.construct.php                  24-Apr-2024 08:00                7967
mongodb-bson-binary.getdata.php                    24-Apr-2024 08:00                4438
mongodb-bson-binary.gettype.php                    24-Apr-2024 08:00                4420
mongodb-bson-binary.jsonserialize.php              24-Apr-2024 08:00                5413
mongodb-bson-binary.serialize.php                  24-Apr-2024 08:00                3508
mongodb-bson-binary.tostring.php                   24-Apr-2024 08:00                4221
mongodb-bson-binary.unserialize.php                24-Apr-2024 08:00                4336
mongodb-bson-binaryinterface.getdata.php           24-Apr-2024 08:00                2865
mongodb-bson-binaryinterface.gettype.php           24-Apr-2024 08:00                2875
mongodb-bson-binaryinterface.tostring.php          24-Apr-2024 08:00                3328
mongodb-bson-dbpointer.construct.php               24-Apr-2024 08:00                2692
mongodb-bson-dbpointer.jsonserialize.php           24-Apr-2024 08:00                5482
mongodb-bson-dbpointer.serialize.php               24-Apr-2024 08:00                3583
mongodb-bson-dbpointer.tostring.php                24-Apr-2024 08:00                2707
mongodb-bson-dbpointer.unserialize.php             24-Apr-2024 08:00                3835
mongodb-bson-decimal128.construct.php              24-Apr-2024 08:00                5814
mongodb-bson-decimal128.jsonserialize.php          24-Apr-2024 08:00                5503
mongodb-bson-decimal128.serialize.php              24-Apr-2024 08:00                3608
mongodb-bson-decimal128.tostring.php               24-Apr-2024 08:00                4576
mongodb-bson-decimal128.unserialize.php            24-Apr-2024 08:00                4428
mongodb-bson-decimal128interface.tostring.php      24-Apr-2024 08:00                3028
mongodb-bson-document.construct.php                24-Apr-2024 08:00                3306
mongodb-bson-document.frombson.php                 24-Apr-2024 08:00                4081
mongodb-bson-document.fromjson.php                 24-Apr-2024 08:00                4594
mongodb-bson-document.fromphp.php                  24-Apr-2024 08:00                4316
mongodb-bson-document.get.php                      24-Apr-2024 08:00                4284
mongodb-bson-document.getiterator.php              24-Apr-2024 08:00                3546
mongodb-bson-document.has.php                      24-Apr-2024 08:00                3810
mongodb-bson-document.serialize.php                24-Apr-2024 08:00                3572
mongodb-bson-document.tocanonicalextendedjson.php  24-Apr-2024 08:00               12749
mongodb-bson-document.tophp.php                    24-Apr-2024 08:00                5463
mongodb-bson-document.torelaxedextendedjson.php    24-Apr-2024 08:00               12466
mongodb-bson-document.tostring.php                 24-Apr-2024 08:00                2781
mongodb-bson-document.unserialize.php              24-Apr-2024 08:00                4384
mongodb-bson-int64.construct.php                   24-Apr-2024 08:00                4791
mongodb-bson-int64.jsonserialize.php               24-Apr-2024 08:00                5157
mongodb-bson-int64.serialize.php                   24-Apr-2024 08:00                3485
mongodb-bson-int64.tostring.php                    24-Apr-2024 08:00                3894
mongodb-bson-int64.unserialize.php                 24-Apr-2024 08:00                4307
mongodb-bson-iterator.construct.php                24-Apr-2024 08:00                3394
mongodb-bson-iterator.current.php                  24-Apr-2024 08:00                3639
mongodb-bson-iterator.key.php                      24-Apr-2024 08:00                3636
mongodb-bson-iterator.next.php                     24-Apr-2024 08:00                2425
mongodb-bson-iterator.rewind.php                   24-Apr-2024 08:00                2465
mongodb-bson-iterator.valid.php                    24-Apr-2024 08:00                2844
mongodb-bson-javascript.construct.php              24-Apr-2024 08:00                7278
mongodb-bson-javascript.getcode.php                24-Apr-2024 08:00                4410
mongodb-bson-javascript.getscope.php               24-Apr-2024 08:00                5386
mongodb-bson-javascript.jsonserialize.php          24-Apr-2024 08:00                5499
mongodb-bson-javascript.serialize.php              24-Apr-2024 08:00                3608
mongodb-bson-javascript.tostring.php               24-Apr-2024 08:00                4215
mongodb-bson-javascript.unserialize.php            24-Apr-2024 08:00                4420
mongodb-bson-javascriptinterface.getcode.php       24-Apr-2024 08:00                2959
mongodb-bson-javascriptinterface.getscope.php      24-Apr-2024 08:00                3124
mongodb-bson-javascriptinterface.tostring.php      24-Apr-2024 08:00                3426
mongodb-bson-maxkey.construct.php                  24-Apr-2024 08:00                3667
mongodb-bson-maxkey.jsonserialize.php              24-Apr-2024 08:00                5419
mongodb-bson-maxkey.serialize.php                  24-Apr-2024 08:00                3512
mongodb-bson-maxkey.unserialize.php                24-Apr-2024 08:00                3768
mongodb-bson-minkey.construct.php                  24-Apr-2024 08:00                3667
mongodb-bson-minkey.jsonserialize.php              24-Apr-2024 08:00                5419
mongodb-bson-minkey.serialize.php                  24-Apr-2024 08:00                3512
mongodb-bson-minkey.unserialize.php                24-Apr-2024 08:00                3772
mongodb-bson-objectid.construct.php                24-Apr-2024 08:00                5304
mongodb-bson-objectid.gettimestamp.php             24-Apr-2024 08:00                5517
mongodb-bson-objectid.jsonserialize.php            24-Apr-2024 08:00                5465
mongodb-bson-objectid.serialize.php                24-Apr-2024 08:00                3560
mongodb-bson-objectid.tostring.php                 24-Apr-2024 08:00                4222
mongodb-bson-objectid.unserialize.php              24-Apr-2024 08:00                4374
mongodb-bson-objectidinterface.gettimestamp.php    24-Apr-2024 08:00                3028
mongodb-bson-objectidinterface.tostring.php        24-Apr-2024 08:00                3012
mongodb-bson-packedarray.construct.php             24-Apr-2024 08:00                2926
mongodb-bson-packedarray.fromphp.php               24-Apr-2024 08:00                3997
mongodb-bson-packedarray.get.php                   24-Apr-2024 08:00                4335
mongodb-bson-packedarray.getiterator.php           24-Apr-2024 08:00                3600
mongodb-bson-packedarray.has.php                   24-Apr-2024 08:00                3864
mongodb-bson-packedarray.serialize.php             24-Apr-2024 08:00                3604
mongodb-bson-packedarray.tophp.php                 24-Apr-2024 08:00                4681
mongodb-bson-packedarray.tostring.php              24-Apr-2024 08:00                2797
mongodb-bson-packedarray.unserialize.php           24-Apr-2024 08:00                4440
mongodb-bson-persistable.bsonserialize.php         24-Apr-2024 08:00                6164
mongodb-bson-regex.construct.php                   24-Apr-2024 08:00                7039
mongodb-bson-regex.getflags.php                    24-Apr-2024 08:00                4532
mongodb-bson-regex.getpattern.php                  24-Apr-2024 08:00                4394
mongodb-bson-regex.jsonserialize.php               24-Apr-2024 08:00                5398
mongodb-bson-regex.serialize.php                   24-Apr-2024 08:00                3483
mongodb-bson-regex.tostring.php                    24-Apr-2024 08:00                3918
mongodb-bson-regex.unserialize.php                 24-Apr-2024 08:00                4311
mongodb-bson-regexinterface.getflags.php           24-Apr-2024 08:00                2864
mongodb-bson-regexinterface.getpattern.php         24-Apr-2024 08:00                2907
mongodb-bson-regexinterface.tostring.php           24-Apr-2024 08:00                2938
mongodb-bson-serializable.bsonserialize.php        24-Apr-2024 08:00               16604
mongodb-bson-symbol.construct.php                  24-Apr-2024 08:00                2632
mongodb-bson-symbol.jsonserialize.php              24-Apr-2024 08:00                5419
mongodb-bson-symbol.serialize.php                  24-Apr-2024 08:00                3508
mongodb-bson-symbol.tostring.php                   24-Apr-2024 08:00                2685
mongodb-bson-symbol.unserialize.php                24-Apr-2024 08:00                3774
mongodb-bson-timestamp.construct.php               24-Apr-2024 08:00                4851
mongodb-bson-timestamp.getincrement.php            24-Apr-2024 08:00                4329
mongodb-bson-timestamp.gettimestamp.php            24-Apr-2024 08:00                4314
mongodb-bson-timestamp.jsonserialize.php           24-Apr-2024 08:00                5486
mongodb-bson-timestamp.serialize.php               24-Apr-2024 08:00                3583
mongodb-bson-timestamp.tostring.php                24-Apr-2024 08:00                4064
mongodb-bson-timestamp.unserialize.php             24-Apr-2024 08:00                4407
mongodb-bson-timestampinterface.getincrement.php   24-Apr-2024 08:00                3392
mongodb-bson-timestampinterface.gettimestamp.php   24-Apr-2024 08:00                3407
mongodb-bson-timestampinterface.tostring.php       24-Apr-2024 08:00                3030
mongodb-bson-undefined.construct.php               24-Apr-2024 08:00                2692
mongodb-bson-undefined.jsonserialize.php           24-Apr-2024 08:00                5482
mongodb-bson-undefined.serialize.php               24-Apr-2024 08:00                3583
mongodb-bson-undefined.tostring.php                24-Apr-2024 08:00                2707
mongodb-bson-undefined.unserialize.php             24-Apr-2024 08:00                3836
mongodb-bson-unserializable.bsonunserialize.php    24-Apr-2024 08:00                7097
mongodb-bson-utcdatetime.construct.php             24-Apr-2024 08:00                8193
mongodb-bson-utcdatetime.jsonserialize.php         24-Apr-2024 08:00                5524
mongodb-bson-utcdatetime.serialize.php             24-Apr-2024 08:00                3635
mongodb-bson-utcdatetime.todatetime.php            24-Apr-2024 08:00                5863
mongodb-bson-utcdatetime.tostring.php              24-Apr-2024 08:00                4016
mongodb-bson-utcdatetime.unserialize.php           24-Apr-2024 08:00                4439
mongodb-bson-utcdatetimeinterface.todatetime.php   24-Apr-2024 08:00                3307
mongodb-bson-utcdatetimeinterface.tostring.php     24-Apr-2024 08:00                3046
mongodb-driver-bulkwrite.construct.php             24-Apr-2024 08:00               18681
mongodb-driver-bulkwrite.count.php                 24-Apr-2024 08:00                6958
mongodb-driver-bulkwrite.delete.php                24-Apr-2024 08:00               12059
mongodb-driver-bulkwrite.insert.php                24-Apr-2024 08:00                9638
mongodb-driver-bulkwrite.update.php                24-Apr-2024 08:00               15669
mongodb-driver-clientencryption.addkeyaltname.php  24-Apr-2024 08:00                5588
mongodb-driver-clientencryption.construct.php      24-Apr-2024 08:00               11330
mongodb-driver-clientencryption.createdatakey.php  24-Apr-2024 08:00               11020
mongodb-driver-clientencryption.decrypt.php        24-Apr-2024 08:00                4229
mongodb-driver-clientencryption.deletekey.php      24-Apr-2024 08:00                4334
mongodb-driver-clientencryption.encrypt.php        24-Apr-2024 08:00               12843
mongodb-driver-clientencryption.encryptexpressi..> 24-Apr-2024 08:00               14554
mongodb-driver-clientencryption.getkey.php         24-Apr-2024 08:00                4467
mongodb-driver-clientencryption.getkeybyaltname..> 24-Apr-2024 08:00                5058
mongodb-driver-clientencryption.getkeys.php        24-Apr-2024 08:00                3883
mongodb-driver-clientencryption.removekeyaltnam..> 24-Apr-2024 08:00                5653
mongodb-driver-clientencryption.rewrapmanydatak..> 24-Apr-2024 08:00               12200
mongodb-driver-command.construct.php               24-Apr-2024 08:00               14266
mongodb-driver-commandexception.getresultdocume..> 24-Apr-2024 08:00                3280
mongodb-driver-cursor.construct.php                24-Apr-2024 08:00                3366
mongodb-driver-cursor.current.php                  24-Apr-2024 08:00                3126
mongodb-driver-cursor.getid.php                    24-Apr-2024 08:00                7634
mongodb-driver-cursor.getserver.php                24-Apr-2024 08:00                7527
mongodb-driver-cursor.isdead.php                   24-Apr-2024 08:00               10647
mongodb-driver-cursor.key.php                      24-Apr-2024 08:00                2681
mongodb-driver-cursor.next.php                     24-Apr-2024 08:00                3530
mongodb-driver-cursor.rewind.php                   24-Apr-2024 08:00                3986
mongodb-driver-cursor.settypemap.php               24-Apr-2024 08:00                7998
mongodb-driver-cursor.toarray.php                  24-Apr-2024 08:00                7720
mongodb-driver-cursor.valid.php                    24-Apr-2024 08:00                2869
mongodb-driver-cursorid.construct.php              24-Apr-2024 08:00                2854
mongodb-driver-cursorid.serialize.php              24-Apr-2024 08:00                3606
mongodb-driver-cursorid.tostring.php               24-Apr-2024 08:00                7018
mongodb-driver-cursorid.unserialize.php            24-Apr-2024 08:00                4446
mongodb-driver-cursorinterface.getid.php           24-Apr-2024 08:00                4040
mongodb-driver-cursorinterface.getserver.php       24-Apr-2024 08:00                4141
mongodb-driver-cursorinterface.isdead.php          24-Apr-2024 08:00                4104
mongodb-driver-cursorinterface.settypemap.php      24-Apr-2024 08:00                4138
mongodb-driver-cursorinterface.toarray.php         24-Apr-2024 08:00                4003
mongodb-driver-manager.addsubscriber.php           24-Apr-2024 08:00                5565
mongodb-driver-manager.construct.php               24-Apr-2024 08:00               80157
mongodb-driver-manager.createclientencryption.php  24-Apr-2024 08:00               12660
mongodb-driver-manager.executebulkwrite.php        24-Apr-2024 08:00               22861
mongodb-driver-manager.executecommand.php          24-Apr-2024 08:00               24907
mongodb-driver-manager.executequery.php            24-Apr-2024 08:00               16279
mongodb-driver-manager.executereadcommand.php      24-Apr-2024 08:00               10274
mongodb-driver-manager.executereadwritecommand.php 24-Apr-2024 08:00               11243
mongodb-driver-manager.executewritecommand.php     24-Apr-2024 08:00               11318
mongodb-driver-manager.getencryptedfieldsmap.php   24-Apr-2024 08:00                3938
mongodb-driver-manager.getreadconcern.php          24-Apr-2024 08:00                5931
mongodb-driver-manager.getreadpreference.php       24-Apr-2024 08:00                6526
mongodb-driver-manager.getservers.php              24-Apr-2024 08:00                7967
mongodb-driver-manager.getwriteconcern.php         24-Apr-2024 08:00                5984
mongodb-driver-manager.removesubscriber.php        24-Apr-2024 08:00                4957
mongodb-driver-manager.selectserver.php            24-Apr-2024 08:00                7229
mongodb-driver-manager.startsession.php            24-Apr-2024 08:00               12626
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                3742
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                3835
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                3666
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                4864
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                4057
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                4293
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                4219
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                4064
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Apr-2024 08:00                3848
mongodb-driver-monitoring-commandstartedevent.g..> 24-Apr-2024 08:00                4064
mongodb-driver-monitoring-commandstartedevent.g..> 24-Apr-2024 08:00                3774
mongodb-driver-monitoring-commandstartedevent.g..> 24-Apr-2024 08:00                3676
mongodb-driver-monitoring-commandstartedevent.g..> 24-Apr-2024 08:00                5173
mongodb-driver-monitoring-commandstartedevent.g..> 24-Apr-2024 08:00                4754
mongodb-driver-monitoring-commandstartedevent.g..> 24-Apr-2024 08:00                4510
mongodb-driver-monitoring-commandstartedevent.g..> 24-Apr-2024 08:00                4084
mongodb-driver-monitoring-commandstartedevent.g..> 24-Apr-2024 08:00                3868
mongodb-driver-monitoring-commandsubscriber.com..> 24-Apr-2024 08:00                4939
mongodb-driver-monitoring-commandsubscriber.com..> 24-Apr-2024 08:00                4989
mongodb-driver-monitoring-commandsubscriber.com..> 24-Apr-2024 08:00                5002
mongodb-driver-monitoring-commandsucceededevent..> 24-Apr-2024 08:00                3799
mongodb-driver-monitoring-commandsucceededevent..> 24-Apr-2024 08:00                3904
mongodb-driver-monitoring-commandsucceededevent..> 24-Apr-2024 08:00                4951
mongodb-driver-monitoring-commandsucceededevent..> 24-Apr-2024 08:00                4114
mongodb-driver-monitoring-commandsucceededevent..> 24-Apr-2024 08:00                4356
mongodb-driver-monitoring-commandsucceededevent..> 24-Apr-2024 08:00                4724
mongodb-driver-monitoring-commandsucceededevent..> 24-Apr-2024 08:00                4124
mongodb-driver-monitoring-commandsucceededevent..> 24-Apr-2024 08:00                3894
mongodb-driver-monitoring-logsubscriber.log.php    24-Apr-2024 08:00                4669
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Apr-2024 08:00                4822
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Apr-2024 08:00                4792
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Apr-2024 08:00                5359
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Apr-2024 08:00                5404
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Apr-2024 08:00                5435
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Apr-2024 08:00                4822
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-Apr-2024 08:00                4897
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-Apr-2024 08:00                4834
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-Apr-2024 08:00                4817
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Apr-2024 08:00                3213
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Apr-2024 08:00                3529
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Apr-2024 08:00                3281
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Apr-2024 08:00                3606
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Apr-2024 08:00                3329
mongodb-driver-monitoring-serverclosedevent.get..> 24-Apr-2024 08:00                3175
mongodb-driver-monitoring-serverclosedevent.get..> 24-Apr-2024 08:00                3225
mongodb-driver-monitoring-serverclosedevent.get..> 24-Apr-2024 08:00                3285
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Apr-2024 08:00                3661
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Apr-2024 08:00                3513
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Apr-2024 08:00                3350
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Apr-2024 08:00                3379
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Apr-2024 08:00                3735
mongodb-driver-monitoring-serverheartbeatstarte..> 24-Apr-2024 08:00                3355
mongodb-driver-monitoring-serverheartbeatstarte..> 24-Apr-2024 08:00                3397
mongodb-driver-monitoring-serverheartbeatstarte..> 24-Apr-2024 08:00                3755
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Apr-2024 08:00                3713
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Apr-2024 08:00                3422
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Apr-2024 08:00                3431
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Apr-2024 08:00                4251
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Apr-2024 08:00                3771
mongodb-driver-monitoring-serveropeningevent.ge..> 24-Apr-2024 08:00                3193
mongodb-driver-monitoring-serveropeningevent.ge..> 24-Apr-2024 08:00                3243
mongodb-driver-monitoring-serveropeningevent.ge..> 24-Apr-2024 08:00                3317
mongodb-driver-monitoring-topologychangedevent...> 24-Apr-2024 08:00                3598
mongodb-driver-monitoring-topologychangedevent...> 24-Apr-2024 08:00                3676
mongodb-driver-monitoring-topologychangedevent...> 24-Apr-2024 08:00                3337
mongodb-driver-monitoring-topologyclosedevent.g..> 24-Apr-2024 08:00                3282
mongodb-driver-monitoring-topologyopeningevent...> 24-Apr-2024 08:00                3292
mongodb-driver-query.construct.php                 24-Apr-2024 08:00               32866
mongodb-driver-readconcern.bsonserialize.php       24-Apr-2024 08:00                6809
mongodb-driver-readconcern.construct.php           24-Apr-2024 08:00                5753
mongodb-driver-readconcern.getlevel.php            24-Apr-2024 08:00                5815
mongodb-driver-readconcern.isdefault.php           24-Apr-2024 08:00                8089
mongodb-driver-readconcern.serialize.php           24-Apr-2024 08:00                3683
mongodb-driver-readconcern.unserialize.php         24-Apr-2024 08:00                4497
mongodb-driver-readpreference.bsonserialize.php    24-Apr-2024 08:00               10448
mongodb-driver-readpreference.construct.php        24-Apr-2024 08:00               18464
mongodb-driver-readpreference.gethedge.php         24-Apr-2024 08:00                3450
mongodb-driver-readpreference.getmaxstalenessse..> 24-Apr-2024 08:00                8187
mongodb-driver-readpreference.getmode.php          24-Apr-2024 08:00                7511
mongodb-driver-readpreference.getmodestring.php    24-Apr-2024 08:00                7717
mongodb-driver-readpreference.gettagsets.php       24-Apr-2024 08:00                8072
mongodb-driver-readpreference.serialize.php        24-Apr-2024 08:00                3760
mongodb-driver-readpreference.unserialize.php      24-Apr-2024 08:00                4576
mongodb-driver-runtimeexception.haserrorlabel.php  24-Apr-2024 08:00                4306
mongodb-driver-server.construct.php                24-Apr-2024 08:00                3398
mongodb-driver-server.executebulkwrite.php         24-Apr-2024 08:00               11146
mongodb-driver-server.executecommand.php           24-Apr-2024 08:00               13184
mongodb-driver-server.executequery.php             24-Apr-2024 08:00                8503
mongodb-driver-server.executereadcommand.php       24-Apr-2024 08:00               10596
mongodb-driver-server.executereadwritecommand.php  24-Apr-2024 08:00               11754
mongodb-driver-server.executewritecommand.php      24-Apr-2024 08:00               11795
mongodb-driver-server.gethost.php                  24-Apr-2024 08:00                5478
mongodb-driver-server.getinfo.php                  24-Apr-2024 08:00               10631
mongodb-driver-server.getlatency.php               24-Apr-2024 08:00                7146
mongodb-driver-server.getport.php                  24-Apr-2024 08:00                5520
mongodb-driver-server.getserverdescription.php     24-Apr-2024 08:00                3453
mongodb-driver-server.gettags.php                  24-Apr-2024 08:00                3811
mongodb-driver-server.gettype.php                  24-Apr-2024 08:00                3847
mongodb-driver-server.isarbiter.php                24-Apr-2024 08:00                3664
mongodb-driver-server.ishidden.php                 24-Apr-2024 08:00                3658
mongodb-driver-server.ispassive.php                24-Apr-2024 08:00                3726
mongodb-driver-server.isprimary.php                24-Apr-2024 08:00                3671
mongodb-driver-server.issecondary.php              24-Apr-2024 08:00                3706
mongodb-driver-serverapi.bsonserialize.php         24-Apr-2024 08:00                3333
mongodb-driver-serverapi.construct.php             24-Apr-2024 08:00                5248
mongodb-driver-serverapi.serialize.php             24-Apr-2024 08:00                3636
mongodb-driver-serverapi.unserialize.php           24-Apr-2024 08:00                4464
mongodb-driver-serverdescription.gethellorespon..> 24-Apr-2024 08:00                5222
mongodb-driver-serverdescription.gethost.php       24-Apr-2024 08:00                3473
mongodb-driver-serverdescription.getlastupdatet..> 24-Apr-2024 08:00                3628
mongodb-driver-serverdescription.getport.php       24-Apr-2024 08:00                3528
mongodb-driver-serverdescription.getroundtripti..> 24-Apr-2024 08:00                3927
mongodb-driver-serverdescription.gettype.php       24-Apr-2024 08:00                3863
mongodb-driver-session.aborttransaction.php        24-Apr-2024 08:00                4225
mongodb-driver-session.advanceclustertime.php      24-Apr-2024 08:00                4906
mongodb-driver-session.advanceoperationtime.php    24-Apr-2024 08:00                4846
mongodb-driver-session.committransaction.php       24-Apr-2024 08:00                5581
mongodb-driver-session.construct.php               24-Apr-2024 08:00                2921
mongodb-driver-session.endsession.php              24-Apr-2024 08:00                4357
mongodb-driver-session.getclustertime.php          24-Apr-2024 08:00                4001
mongodb-driver-session.getlogicalsessionid.php     24-Apr-2024 08:00                3163
mongodb-driver-session.getoperationtime.php        24-Apr-2024 08:00                4081
mongodb-driver-session.getserver.php               24-Apr-2024 08:00                3978
mongodb-driver-session.gettransactionoptions.php   24-Apr-2024 08:00                3856
mongodb-driver-session.gettransactionstate.php     24-Apr-2024 08:00                3760
mongodb-driver-session.isdirty.php                 24-Apr-2024 08:00                3048
mongodb-driver-session.isintransaction.php         24-Apr-2024 08:00                3822
mongodb-driver-session.starttransaction.php        24-Apr-2024 08:00                9105
mongodb-driver-topologydescription.getservers.php  24-Apr-2024 08:00                3490
mongodb-driver-topologydescription.gettype.php     24-Apr-2024 08:00                3538
mongodb-driver-topologydescription.hasreadables..> 24-Apr-2024 08:00                3977
mongodb-driver-topologydescription.haswritables..> 24-Apr-2024 08:00                3258
mongodb-driver-writeconcern.bsonserialize.php      24-Apr-2024 08:00                7254
mongodb-driver-writeconcern.construct.php          24-Apr-2024 08:00               10549
mongodb-driver-writeconcern.getjournal.php         24-Apr-2024 08:00                6001
mongodb-driver-writeconcern.getw.php               24-Apr-2024 08:00                5291
mongodb-driver-writeconcern.getwtimeout.php        24-Apr-2024 08:00                5912
mongodb-driver-writeconcern.isdefault.php          24-Apr-2024 08:00                7876
mongodb-driver-writeconcern.serialize.php          24-Apr-2024 08:00                3708
mongodb-driver-writeconcern.unserialize.php        24-Apr-2024 08:00                4536
mongodb-driver-writeconcernerror.getcode.php       24-Apr-2024 08:00                6341
mongodb-driver-writeconcernerror.getinfo.php       24-Apr-2024 08:00                6667
mongodb-driver-writeconcernerror.getmessage.php    24-Apr-2024 08:00                6432
mongodb-driver-writeerror.getcode.php              24-Apr-2024 08:00                5688
mongodb-driver-writeerror.getindex.php             24-Apr-2024 08:00                6212
mongodb-driver-writeerror.getinfo.php              24-Apr-2024 08:00                3160
mongodb-driver-writeerror.getmessage.php           24-Apr-2024 08:00                5824
mongodb-driver-writeexception.getwriteresult.php   24-Apr-2024 08:00                7943
mongodb-driver-writeresult.getdeletedcount.php     24-Apr-2024 08:00                8170
mongodb-driver-writeresult.getinsertedcount.php    24-Apr-2024 08:00                8252
mongodb-driver-writeresult.getmatchedcount.php     24-Apr-2024 08:00                8815
mongodb-driver-writeresult.getmodifiedcount.php    24-Apr-2024 08:00                9113
mongodb-driver-writeresult.getserver.php           24-Apr-2024 08:00                6545
mongodb-driver-writeresult.getupsertedcount.php    24-Apr-2024 08:00                8341
mongodb-driver-writeresult.getupsertedids.php      24-Apr-2024 08:00                8829
mongodb-driver-writeresult.getwriteconcernerror..> 24-Apr-2024 08:00                7219
mongodb-driver-writeresult.getwriteerrors.php      24-Apr-2024 08:00               13037
mongodb-driver-writeresult.isacknowledged.php      24-Apr-2024 08:00                8189
mongodb.architecture.php                           24-Apr-2024 08:00                1982
mongodb.configuration.php                          24-Apr-2024 08:00                3992
mongodb.connection-handling.php                    24-Apr-2024 08:00                8736
mongodb.constants.php                              24-Apr-2024 08:00                2150
mongodb.exceptions.php                             24-Apr-2024 08:00                5209
mongodb.exceptions.tree.php                        24-Apr-2024 08:00                5633
mongodb.installation.homebrew.php                  24-Apr-2024 08:00                2035
mongodb.installation.manual.php                    24-Apr-2024 08:00                6162
mongodb.installation.pecl.php                      24-Apr-2024 08:00                4975
mongodb.installation.php                           24-Apr-2024 08:00                1842
mongodb.installation.windows.php                   24-Apr-2024 08:00                4376
mongodb.monitoring.php                             24-Apr-2024 08:00               19024
mongodb.overview.php                               24-Apr-2024 08:00                4673
mongodb.persistence.deserialization.php            24-Apr-2024 08:00               21839
mongodb.persistence.php                            24-Apr-2024 08:00                1882
mongodb.persistence.serialization.php              24-Apr-2024 08:00               20134
mongodb.requirements.php                           24-Apr-2024 08:00                3180
mongodb.security.php                               24-Apr-2024 08:00                1544
mongodb.security.request_injection.php             24-Apr-2024 08:00                3044
mongodb.security.script_injection.php              24-Apr-2024 08:00                9233
mongodb.setup.php                                  24-Apr-2024 08:00                2068
mongodb.tutorial.apm.php                           24-Apr-2024 08:00               18801
mongodb.tutorial.library.php                       24-Apr-2024 08:00               10740
mongodb.tutorial.php                               24-Apr-2024 08:00                1754
mqseries.configure.php                             24-Apr-2024 08:00                2814
mqseries.constants.php                             24-Apr-2024 08:00                2709
mqseries.ini.php                                   24-Apr-2024 08:00                1332
mqseries.requirements.php                          24-Apr-2024 08:00