Index of /php/manual/de/

feeds/                                             30-May-2024 18:01                   -
images/                                            30-May-2024 18:01                   -
styles/                                            30-May-2024 18:01                   -
toc/                                               30-May-2024 18:01                   -
about.formats.php                                  30-May-2024 18:01                4615
about.generate.php                                 30-May-2024 18:01                3012
about.howtohelp.php                                30-May-2024 18:01                3784
about.more.php                                     30-May-2024 18:01                1982
about.notes.php                                    30-May-2024 18:01                2560
about.php                                          30-May-2024 18:01                1947
about.phpversions.php                              30-May-2024 18:01                3661
about.prototypes.php                               30-May-2024 18:01                7538
about.translations.php                             30-May-2024 18:01                3303
aliases.php                                        30-May-2024 18:01               29486
allowdynamicproperties.construct.php               30-May-2024 18:01                2283
apache.configuration.php                           30-May-2024 18:01                5335
apache.constants.php                               30-May-2024 18:01                1205
apache.installation.php                            30-May-2024 18:01                1312
apache.requirements.php                            30-May-2024 18:01                1251
apache.resources.php                               30-May-2024 18:01                1234
apache.setup.php                                   30-May-2024 18:01                1644
apcu.configuration.php                             30-May-2024 18:01               15881
apcu.constants.php                                 30-May-2024 18:01                7454
apcu.installation.php                              30-May-2024 18:01                3232
apcu.requirements.php                              30-May-2024 18:01                1237
apcu.resources.php                                 30-May-2024 18:01                1220
apcu.setup.php                                     30-May-2024 18:01                1601
apcuiterator.construct.php                         30-May-2024 18:01                7041
apcuiterator.current.php                           30-May-2024 18:01                3016
apcuiterator.gettotalcount.php                     30-May-2024 18:01                3209
apcuiterator.gettotalhits.php                      30-May-2024 18:01                3345
apcuiterator.gettotalsize.php                      30-May-2024 18:01                3086
apcuiterator.key.php                               30-May-2024 18:01                2825                              30-May-2024 18:01                3118
apcuiterator.rewind.php                            30-May-2024 18:01                2766
apcuiterator.valid.php                             30-May-2024 18:01                2970
appendices.php                                     30-May-2024 18:01               12884
appenditerator.append.php                          30-May-2024 18:01                5481
appenditerator.construct.php                       30-May-2024 18:01               10174
appenditerator.current.php                         30-May-2024 18:01                3477
appenditerator.getarrayiterator.php                30-May-2024 18:01                3101
appenditerator.getiteratorindex.php                30-May-2024 18:01                6651
appenditerator.key.php                             30-May-2024 18:01                7917                            30-May-2024 18:01                3405
appenditerator.rewind.php                          30-May-2024 18:01                3387
appenditerator.valid.php                           30-May-2024 18:01                3362
array.configuration.php                            30-May-2024 18:01                1284
array.constants.php                                30-May-2024 18:01               12172
array.installation.php                             30-May-2024 18:01                1268
array.requirements.php                             30-May-2024 18:01                1244
array.resources.php                                30-May-2024 18:01                1227
array.setup.php                                    30-May-2024 18:01                1610
array.sorting.php                                  30-May-2024 18:01                7053
arrayaccess.offsetexists.php                       30-May-2024 18:01                9565
arrayaccess.offsetget.php                          30-May-2024 18:01                5015
arrayaccess.offsetset.php                          30-May-2024 18:01                5087
arrayaccess.offsetunset.php                        30-May-2024 18:01                2898
arrayiterator.append.php                           30-May-2024 18:01                3570
arrayiterator.asort.php                            30-May-2024 18:01                7370
arrayiterator.construct.php                        30-May-2024 18:01                3812
arrayiterator.count.php                            30-May-2024 18:01                3274
arrayiterator.current.php                          30-May-2024 18:01                5233
arrayiterator.getarraycopy.php                     30-May-2024 18:01                3121
arrayiterator.getflags.php                         30-May-2024 18:01                3097
arrayiterator.key.php                              30-May-2024 18:01                4026
arrayiterator.ksort.php                            30-May-2024 18:01                7343
arrayiterator.natcasesort.php                      30-May-2024 18:01                4777
arrayiterator.natsort.php                          30-May-2024 18:01                4672                             30-May-2024 18:01                4675
arrayiterator.offsetexists.php                     30-May-2024 18:01                3360
arrayiterator.offsetget.php                        30-May-2024 18:01                3388
arrayiterator.offsetset.php                        30-May-2024 18:01                3663
arrayiterator.offsetunset.php                      30-May-2024 18:01                3786
arrayiterator.rewind.php                           30-May-2024 18:01                4646                             30-May-2024 18:01                2658
arrayiterator.serialize.php                        30-May-2024 18:01                2916
arrayiterator.setflags.php                         30-May-2024 18:01                4151
arrayiterator.uasort.php                           30-May-2024 18:01                6450
arrayiterator.uksort.php                           30-May-2024 18:01                6353
arrayiterator.unserialize.php                      30-May-2024 18:01                3166
arrayiterator.valid.php                            30-May-2024 18:01                4706
arrayobject.append.php                             30-May-2024 18:01                5520
arrayobject.asort.php                              30-May-2024 18:01               10279
arrayobject.construct.php                          30-May-2024 18:01                6294
arrayobject.count.php                              30-May-2024 18:01                5432
arrayobject.exchangearray.php                      30-May-2024 18:01                6528
arrayobject.getarraycopy.php                       30-May-2024 18:01                5323
arrayobject.getflags.php                           30-May-2024 18:01                6148
arrayobject.getiterator.php                        30-May-2024 18:01                5317
arrayobject.getiteratorclass.php                   30-May-2024 18:01                6609
arrayobject.ksort.php                              30-May-2024 18:01                9958
arrayobject.natcasesort.php                        30-May-2024 18:01                8285
arrayobject.natsort.php                            30-May-2024 18:01                7983
arrayobject.offsetexists.php                       30-May-2024 18:01                4994
arrayobject.offsetget.php                          30-May-2024 18:01                5197
arrayobject.offsetset.php                          30-May-2024 18:01                6807
arrayobject.offsetunset.php                        30-May-2024 18:01                4307
arrayobject.serialize.php                          30-May-2024 18:01                5155
arrayobject.setflags.php                           30-May-2024 18:01                6748
arrayobject.setiteratorclass.php                   30-May-2024 18:01                5893
arrayobject.uasort.php                             30-May-2024 18:01               10972
arrayobject.uksort.php                             30-May-2024 18:01               10388
arrayobject.unserialize.php                        30-May-2024 18:01                3594
attribute.construct.php                            30-May-2024 18:01                2374
backedenum.from.php                                30-May-2024 18:01                6286
backedenum.tryfrom.php                             30-May-2024 18:01                6883
bc.configuration.php                               30-May-2024 18:01                2544
bc.constants.php                                   30-May-2024 18:01                1179
bc.installation.php                                30-May-2024 18:01                1453
bc.requirements.php                                30-May-2024 18:01                1223
bc.resources.php                                   30-May-2024 18:01                1206
bc.setup.php                                       30-May-2024 18:01                1602
book.apache.php                                    30-May-2024 18:01                3326
book.apcu.php                                      30-May-2024 18:01                4410
book.array.php                                     30-May-2024 18:01               12937
book.bc.php                                        30-May-2024 18:01                2995
book.bson.php                                      30-May-2024 18:01               25677
book.bzip2.php                                     30-May-2024 18:01                3071
book.calendar.php                                  30-May-2024 18:01                4342
book.classobj.php                                  30-May-2024 18:01                4635
book.cmark.php                                     30-May-2024 18:01                8800                                       30-May-2024 18:01                8083
book.componere.php                                 30-May-2024 18:01                6194
book.ctype.php                                     30-May-2024 18:01                3166
book.cubrid.php                                    30-May-2024 18:01               13875
book.curl.php                                      30-May-2024 18:01                7449
book.datetime.php                                  30-May-2024 18:01               17934
book.dba.php                                       30-May-2024 18:01                3753
book.dbase.php                                     30-May-2024 18:01                3440
book.dio.php                                       30-May-2024 18:01                2970
book.dir.php                                       30-May-2024 18:01                3266
book.dom.php                                       30-May-2024 18:01               20988
book.ds.php                                        30-May-2024 18:01               25155
book.eio.php                                       30-May-2024 18:01                7966
book.enchant.php                                   30-May-2024 18:01                5394
book.errorfunc.php                                 30-May-2024 18:01                3616
book.ev.php                                        30-May-2024 18:01               13395
book.event.php                                     30-May-2024 18:01               23186
book.exec.php                                      30-May-2024 18:01                3460
book.exif.php                                      30-May-2024 18:01                2534
book.expect.php                                    30-May-2024 18:01                2510
book.fann.php                                      30-May-2024 18:01               23121
book.fdf.php                                       30-May-2024 18:01                5937
book.ffi.php                                       30-May-2024 18:01                5667
book.fileinfo.php                                  30-May-2024 18:01                3122
book.filesystem.php                                30-May-2024 18:01               10569
book.filter.php                                    30-May-2024 18:01                3526
book.fpm.php                                       30-May-2024 18:01                1992
book.ftp.php                                       30-May-2024 18:01                6279
book.funchand.php                                  30-May-2024 18:01                3755
book.gearman.php                                   30-May-2024 18:01               14823
book.gender.php                                    30-May-2024 18:01                2616
book.geoip.php                                     30-May-2024 18:01                4385
book.gettext.php                                   30-May-2024 18:01                3040
book.gmagick.php                                   30-May-2024 18:01               22619
book.gmp.php                                       30-May-2024 18:01                6569
book.gnupg.php                                     30-May-2024 18:01                5454
book.hash.php                                      30-May-2024 18:01                4260
book.hrtime.php                                    30-May-2024 18:01                3541
book.ibase.php                                     30-May-2024 18:01               12848                                   30-May-2024 18:01                8660
book.iconv.php                                     30-May-2024 18:01                3345
book.igbinary.php                                  30-May-2024 18:01                2157
book.image.php                                     30-May-2024 18:01               15975
book.imagick.php                                   30-May-2024 18:01               63784
book.imap.php                                      30-May-2024 18:01               10894                                      30-May-2024 18:01                8386
book.inotify.php                                   30-May-2024 18:01                2573
book.intl.php                                      30-May-2024 18:01               45071
book.json.php                                      30-May-2024 18:01                2980
book.ldap.php                                      30-May-2024 18:01                9603
book.libxml.php                                    30-May-2024 18:01                3241
book.lua.php                                       30-May-2024 18:01                2667
book.luasandbox.php                                30-May-2024 18:01                5585
book.lzf.php                                       30-May-2024 18:01                2225
book.mail.php                                      30-May-2024 18:01                2131
book.mailparse.php                                 30-May-2024 18:01                3935
book.math.php                                      30-May-2024 18:01                5554
book.mbstring.php                                  30-May-2024 18:01                9758
book.mcrypt.php                                    30-May-2024 18:01                6423
book.memcache.php                                  30-May-2024 18:01                4263
book.memcached.php                                 30-May-2024 18:01                8092
book.mhash.php                                     30-May-2024 18:01                2529
book.misc.php                                      30-May-2024 18:01                5595
book.mongodb.php                                   30-May-2024 18:01               26860
book.mqseries.php                                  30-May-2024 18:01                3197
book.mysql-xdevapi.php                             30-May-2024 18:01               32628
book.mysql.php                                     30-May-2024 18:01                8254
book.mysqli.php                                    30-May-2024 18:01               19712
book.mysqlnd.php                                   30-May-2024 18:01                2569                                   30-May-2024 18:01                6139
book.oauth.php                                     30-May-2024 18:01                7205
book.oci8.php                                      30-May-2024 18:01               16999
book.opcache.php                                   30-May-2024 18:01                2736
book.openal.php                                    30-May-2024 18:01                4454
book.openssl.php                                   30-May-2024 18:01               11632
book.outcontrol.php                                30-May-2024 18:01                5235
book.parallel.php                                  30-May-2024 18:01                5744
book.parle.php                                     30-May-2024 18:01                8816
book.password.php                                  30-May-2024 18:01                2681
book.pcntl.php                                     30-May-2024 18:01                5287
book.pcre.php                                      30-May-2024 18:01                3931
book.pdo.php                                       30-May-2024 18:01                8622
book.pgsql.php                                     30-May-2024 18:01               13805
book.phar.php                                      30-May-2024 18:01               15741
book.phpdbg.php                                    30-May-2024 18:01                2934
book.posix.php                                     30-May-2024 18:01                7322                                        30-May-2024 18:01                9195
book.pspell.php                                    30-May-2024 18:01                4789
book.pthreads.php                                  30-May-2024 18:01                5474
book.quickhash.php                                 30-May-2024 18:01                8923
book.radius.php                                    30-May-2024 18:01                5552
book.random.php                                    30-May-2024 18:01                9162
book.rar.php                                       30-May-2024 18:01                5289
book.readline.php                                  30-May-2024 18:01                3835
book.recode.php                                    30-May-2024 18:01                2334
book.reflection.php                                30-May-2024 18:01               37124
book.rnp.php                                       30-May-2024 18:01                6071
book.rpminfo.php                                   30-May-2024 18:01                2513
book.rrd.php                                       30-May-2024 18:01                5119
book.runkit7.php                                   30-May-2024 18:01                4245
book.scoutapm.php                                  30-May-2024 18:01                2211
book.seaslog.php                                   30-May-2024 18:01                5209
book.sem.php                                       30-May-2024 18:01                4490
book.session.php                                   30-May-2024 18:01                8322
book.shmop.php                                     30-May-2024 18:01                2965
book.simdjson.php                                  30-May-2024 18:01                2677
book.simplexml.php                                 30-May-2024 18:01                5666
book.snmp.php                                      30-May-2024 18:01                5871
book.soap.php                                      30-May-2024 18:01                6388
book.sockets.php                                   30-May-2024 18:01                7542
book.sodium.php                                    30-May-2024 18:01               17808
book.solr.php                                      30-May-2024 18:01               53140
book.spl.php                                       30-May-2024 18:01               10064
book.sqlite3.php                                   30-May-2024 18:01                7308
book.sqlsrv.php                                    30-May-2024 18:01                5351
book.ssdeep.php                                    30-May-2024 18:01                2335
book.ssh2.php                                      30-May-2024 18:01                5468
book.stats.php                                     30-May-2024 18:01               11829
book.stomp.php                                     30-May-2024 18:01                4153                                    30-May-2024 18:01               11728
book.strings.php                                   30-May-2024 18:01               14459
book.svm.php                                       30-May-2024 18:01                3687
book.svn.php                                       30-May-2024 18:01                7613
book.swoole.php                                    30-May-2024 18:01               37331
book.sync.php                                      30-May-2024 18:01                4786
book.taint.php                                     30-May-2024 18:01                2534
book.tcpwrap.php                                   30-May-2024 18:01                2060
book.tidy.php                                      30-May-2024 18:01                6597
book.tokenizer.php                                 30-May-2024 18:01                3147
book.trader.php                                    30-May-2024 18:01               17526
book.ui.php                                        30-May-2024 18:01               27936
book.uodbc.php                                     30-May-2024 18:01                7327
book.uopz.php                                      30-May-2024 18:01                5113
book.url.php                                       30-May-2024 18:01                3020
book.v8js.php                                      30-May-2024 18:01                3152
book.var.php                                       30-May-2024 18:01                5921
book.var_representation.php                        30-May-2024 18:01                2156
book.varnish.php                                   30-May-2024 18:01                5378
book.wddx.php                                      30-May-2024 18:01                2845
book.win32service.php                              30-May-2024 18:01                4027
book.wincache.php                                  30-May-2024 18:01                5617
book.wkhtmltox.php                                 30-May-2024 18:01                3310
book.xattr.php                                     30-May-2024 18:01                2452
book.xdiff.php                                     30-May-2024 18:01                4107
book.xhprof.php                                    30-May-2024 18:01                2463
book.xlswriter.php                                 30-May-2024 18:01                4426
book.xml.php                                       30-May-2024 18:01                5349
book.xmldiff.php                                   30-May-2024 18:01                3131
book.xmlreader.php                                 30-May-2024 18:01                5079
book.xmlrpc.php                                    30-May-2024 18:01                3758
book.xmlwriter.php                                 30-May-2024 18:01                6718
book.xsl.php                                       30-May-2024 18:01                3928
book.yac.php                                       30-May-2024 18:01                2604
book.yaconf.php                                    30-May-2024 18:01                2152
book.yaf.php                                       30-May-2024 18:01               34663
book.yaml.php                                      30-May-2024 18:01                2779
book.yar.php                                       30-May-2024 18:01                3691
book.yaz.php                                       30-May-2024 18:01                4363                                       30-May-2024 18:01               10895
book.zlib.php                                      30-May-2024 18:01                5318
book.zmq.php                                       30-May-2024 18:01                5509
book.zookeeper.php                                 30-May-2024 18:01                6662
bzip2.configuration.php                            30-May-2024 18:01                1284
bzip2.constants.php                                30-May-2024 18:01                1194
bzip2.examples.php                                 30-May-2024 18:01                4187
bzip2.installation.php                             30-May-2024 18:01                1387
bzip2.requirements.php                             30-May-2024 18:01                1407
bzip2.resources.php                                30-May-2024 18:01                1280
bzip2.setup.php                                    30-May-2024 18:01                1632
cachingiterator.construct.php                      30-May-2024 18:01                2857
cachingiterator.count.php                          30-May-2024 18:01                2543
cachingiterator.current.php                        30-May-2024 18:01                2851
cachingiterator.getcache.php                       30-May-2024 18:01                5909
cachingiterator.getflags.php                       30-May-2024 18:01                2537
cachingiterator.hasnext.php                        30-May-2024 18:01                2673
cachingiterator.key.php                            30-May-2024 18:01                2243                           30-May-2024 18:01                2469
cachingiterator.offsetexists.php                   30-May-2024 18:01                2999
cachingiterator.offsetget.php                      30-May-2024 18:01                2747
cachingiterator.offsetset.php                      30-May-2024 18:01                3125
cachingiterator.offsetunset.php                    30-May-2024 18:01                2798
cachingiterator.rewind.php                         30-May-2024 18:01                2485
cachingiterator.setflags.php                       30-May-2024 18:01                2830
cachingiterator.tostring.php                       30-May-2024 18:01                2675
cachingiterator.valid.php                          30-May-2024 18:01                2720
calendar.configuration.php                         30-May-2024 18:01                1305
calendar.constants.php                             30-May-2024 18:01               13194
calendar.installation.php                          30-May-2024 18:01                1499
calendar.requirements.php                          30-May-2024 18:01                1265
calendar.resources.php                             30-May-2024 18:01                1248
calendar.setup.php                                 30-May-2024 18:01                1669
callbackfilteriterator.accept.php                  30-May-2024 18:01                3607
callbackfilteriterator.construct.php               30-May-2024 18:01                3961
cc.license.php                                     30-May-2024 18:01               20788
changelog.misc.php                                 30-May-2024 18:01                1326
changelog.mysql.php                                30-May-2024 18:01                2544
changelog.mysql_xdevapi.php                        30-May-2024 18:01                2422
changelog.mysqli.php                               30-May-2024 18:01                1368
changelog.strings.php                              30-May-2024 18:01                1394
class.addressinfo.php                              30-May-2024 18:01                1773
class.allowdynamicproperties.php                   30-May-2024 18:01                5131
class.apcuiterator.php                             30-May-2024 18:01                7360
class.appenditerator.php                           30-May-2024 18:01                7899
class.argumentcounterror.php                       30-May-2024 18:01                8710
class.arithmeticerror.php                          30-May-2024 18:01                8847
class.arrayaccess.php                              30-May-2024 18:01               11848
class.arrayiterator.php                            30-May-2024 18:01               16991
class.arrayobject.php                              30-May-2024 18:01               16925
class.assertionerror.php                           30-May-2024 18:01                8530
class.attribute.php                                30-May-2024 18:01                8699
class.backedenum.php                               30-May-2024 18:01                4440
class.badfunctioncallexception.php                 30-May-2024 18:01                8616
class.badmethodcallexception.php                   30-May-2024 18:01                8635
class.cachingiterator.php                          30-May-2024 18:01               17257
class.callbackfilteriterator.php                   30-May-2024 18:01               11498
class.closedgeneratorexception.php                 30-May-2024 18:01                8778
class.closure.php                                  30-May-2024 18:01                7112
class.collator.php                                 30-May-2024 18:01               36478
class.collectable.php                              30-May-2024 18:01                2571                            30-May-2024 18:01                8424                      30-May-2024 18:01                1932                                      30-May-2024 18:01               12622
class.commonmark-cql.php                           30-May-2024 18:01                7367
class.commonmark-interfaces-ivisitable.php         30-May-2024 18:01                3014
class.commonmark-interfaces-ivisitor.php           30-May-2024 18:01                4609
class.commonmark-node-blockquote.php               30-May-2024 18:01                8463
class.commonmark-node-bulletlist.php               30-May-2024 18:01               10642
class.commonmark-node-code.php                     30-May-2024 18:01                9457
class.commonmark-node-codeblock.php                30-May-2024 18:01               10846
class.commonmark-node-customblock.php              30-May-2024 18:01                9214
class.commonmark-node-custominline.php             30-May-2024 18:01                9194
class.commonmark-node-document.php                 30-May-2024 18:01                8424
class.commonmark-node-heading.php                  30-May-2024 18:01                9823
class.commonmark-node-htmlblock.php                30-May-2024 18:01                9515
class.commonmark-node-htmlinline.php               30-May-2024 18:01                9491
class.commonmark-node-image.php                    30-May-2024 18:01               10731
class.commonmark-node-item.php                     30-May-2024 18:01                8430
class.commonmark-node-linebreak.php                30-May-2024 18:01                8444
class.commonmark-node-link.php                     30-May-2024 18:01               10724
class.commonmark-node-orderedlist.php              30-May-2024 18:01               11608
class.commonmark-node-paragraph.php                30-May-2024 18:01                8469
class.commonmark-node-softbreak.php                30-May-2024 18:01                8462
class.commonmark-node-text-emphasis.php            30-May-2024 18:01                8491
class.commonmark-node-text-strong.php              30-May-2024 18:01                8480
class.commonmark-node-text.php                     30-May-2024 18:01                9861
class.commonmark-node-thematicbreak.php            30-May-2024 18:01                8491
class.commonmark-node.php                          30-May-2024 18:01                9387
class.commonmark-parser.php                        30-May-2024 18:01                3867
class.compersisthelper.php                         30-May-2024 18:01                7500
class.compileerror.php                             30-May-2024 18:01                8452
class.componere-abstract-definition.php            30-May-2024 18:01                4767
class.componere-definition.php                     30-May-2024 18:01               10276
class.componere-method.php                         30-May-2024 18:01                4359
class.componere-patch.php                          30-May-2024 18:01                8371
class.componere-value.php                          30-May-2024 18:01                5462
class.countable.php                                30-May-2024 18:01                2600
class.curlfile.php                                 30-May-2024 18:01                8427
class.curlhandle.php                               30-May-2024 18:01                1795
class.curlmultihandle.php                          30-May-2024 18:01                1834
class.curlsharehandle.php                          30-May-2024 18:01                1830
class.curlstringfile.php                           30-May-2024 18:01                5667
class.dateerror.php                                30-May-2024 18:01                9129
class.dateexception.php                            30-May-2024 18:01                9775
class.dateinterval.php                             30-May-2024 18:01               14260
class.dateinvalidoperationexception.php            30-May-2024 18:01                9252
class.dateinvalidtimezoneexception.php             30-May-2024 18:01                8760
class.datemalformedintervalstringexception.php     30-May-2024 18:01                8862
class.datemalformedperiodstringexception.php       30-May-2024 18:01                8844
class.datemalformedstringexception.php             30-May-2024 18:01                9185
class.dateobjecterror.php                          30-May-2024 18:01                8961
class.dateperiod.php                               30-May-2024 18:01               22584
class.daterangeerror.php                           30-May-2024 18:01                9120
class.datetime.php                                 30-May-2024 18:01               23571
class.datetimeimmutable.php                        30-May-2024 18:01               23657
class.datetimeinterface.php                        30-May-2024 18:01               20400
class.datetimezone.php                             30-May-2024 18:01               15667
class.deflatecontext.php                           30-May-2024 18:01                1838                                30-May-2024 18:01                5669
class.directoryiterator.php                        30-May-2024 18:01               20034
class.divisionbyzeroerror.php                      30-May-2024 18:01                8490
class.domainexception.php                          30-May-2024 18:01                8548
class.domattr.php                                  30-May-2024 18:01               28302
class.domcdatasection.php                          30-May-2024 18:01               32140
class.domcharacterdata.php                         30-May-2024 18:01               33406
class.domchildnode.php                             30-May-2024 18:01                4249
class.domcomment.php                               30-May-2024 18:01               30811
class.domdocument.php                              30-May-2024 18:01               68296
class.domdocumentfragment.php                      30-May-2024 18:01               29161
class.domdocumenttype.php                          30-May-2024 18:01               27279
class.domelement.php                               30-May-2024 18:01               53273
class.domentity.php                                30-May-2024 18:01               27919
class.domentityreference.php                       30-May-2024 18:01               23397
class.domexception.php                             30-May-2024 18:01                9395
class.domimplementation.php                        30-May-2024 18:01                6056
class.domnamednodemap.php                          30-May-2024 18:01                7404
class.domnamespacenode.php                         30-May-2024 18:01                9432
class.domnode.php                                  30-May-2024 18:01               32574
class.domnodelist.php                              30-May-2024 18:01                6024
class.domnotation.php                              30-May-2024 18:01               23672
class.domparentnode.php                            30-May-2024 18:01                3919
class.domprocessinginstruction.php                 30-May-2024 18:01               24931
class.domtext.php                                  30-May-2024 18:01               33746
class.domxpath.php                                 30-May-2024 18:01                8766
class.dotnet.php                                   30-May-2024 18:01                6952
class.ds-collection.php                            30-May-2024 18:01                6023
class.ds-deque.php                                 30-May-2024 18:01               22101
class.ds-hashable.php                              30-May-2024 18:01                4136
class.ds-map.php                                   30-May-2024 18:01               23009
class.ds-pair.php                                  30-May-2024 18:01                4611
class.ds-priorityqueue.php                         30-May-2024 18:01                8392
class.ds-queue.php                                 30-May-2024 18:01                7876
class.ds-sequence.php                              30-May-2024 18:01               23631
class.ds-set.php                                   30-May-2024 18:01               18604
class.ds-stack.php                                 30-May-2024 18:01                7203
class.ds-vector.php                                30-May-2024 18:01               21637
class.emptyiterator.php                            30-May-2024 18:01                4102
class.enchantbroker.php                            30-May-2024 18:01                1850
class.enchantdictionary.php                        30-May-2024 18:01                1840
class.error.php                                    30-May-2024 18:01               10963
class.errorexception.php                           30-May-2024 18:01               14596
class.ev.php                                       30-May-2024 18:01               42367
class.evcheck.php                                  30-May-2024 18:01               10862
class.evchild.php                                  30-May-2024 18:01               12539
class.evembed.php                                  30-May-2024 18:01               10036
class.event.php                                    30-May-2024 18:01               18464
class.eventbase.php                                30-May-2024 18:01               14928
class.eventbuffer.php                              30-May-2024 18:01               23436
class.eventbufferevent.php                         30-May-2024 18:01               37938
class.eventconfig.php                              30-May-2024 18:01                7862
class.eventdnsbase.php                             30-May-2024 18:01               14297
class.eventexception.php                           30-May-2024 18:01                8552
class.eventhttp.php                                30-May-2024 18:01                9725
class.eventhttpconnection.php                      30-May-2024 18:01               10541
class.eventhttprequest.php                         30-May-2024 18:01               22883
class.eventlistener.php                            30-May-2024 18:01               12820
class.eventsslcontext.php                          30-May-2024 18:01               19185
class.eventutil.php                                30-May-2024 18:01               25582
class.evfork.php                                   30-May-2024 18:01                9028
class.evidle.php                                   30-May-2024 18:01                9855
class.evio.php                                     30-May-2024 18:01               12646
class.evloop.php                                   30-May-2024 18:01               31551
class.evperiodic.php                               30-May-2024 18:01               14961
class.evprepare.php                                30-May-2024 18:01               11001
class.evsignal.php                                 30-May-2024 18:01               11950
class.evstat.php                                   30-May-2024 18:01               14426
class.evtimer.php                                  30-May-2024 18:01               14339
class.evwatcher.php                                30-May-2024 18:01               10012
class.exception.php                                30-May-2024 18:01               11180
class.fannconnection.php                           30-May-2024 18:01                6583
class.ffi-cdata.php                                30-May-2024 18:01                6177
class.ffi-ctype.php                                30-May-2024 18:01               31280
class.ffi-exception.php                            30-May-2024 18:01                8238
class.ffi-parserexception.php                      30-May-2024 18:01                8293
class.ffi.php                                      30-May-2024 18:01               18414
class.fiber.php                                    30-May-2024 18:01                7989
class.fibererror.php                               30-May-2024 18:01                8154
class.filesystemiterator.php                       30-May-2024 18:01               31797
class.filteriterator.php                           30-May-2024 18:01                7339
class.finfo.php                                    30-May-2024 18:01                6267
class.ftp-connection.php                           30-May-2024 18:01                1822
class.gdfont.php                                   30-May-2024 18:01                1737
class.gdimage.php                                  30-May-2024 18:01                1733
class.gearmanclient.php                            30-May-2024 18:01               37801
class.gearmanexception.php                         30-May-2024 18:01                7238
class.gearmanjob.php                               30-May-2024 18:01                9263
class.gearmantask.php                              30-May-2024 18:01                8906
class.gearmanworker.php                            30-May-2024 18:01               13477
class.gender.php                                   30-May-2024 18:01               42248
class.generator.php                                30-May-2024 18:01                6665
class.globiterator.php                             30-May-2024 18:01               26522
class.gmagick.php                                  30-May-2024 18:01               87083
class.gmagickdraw.php                              30-May-2024 18:01               24481
class.gmagickpixel.php                             30-May-2024 18:01                5978
class.gmp.php                                      30-May-2024 18:01                4243
class.hashcontext.php                              30-May-2024 18:01                3374
class.hrtime-performancecounter.php                30-May-2024 18:01                3861
class.hrtime-stopwatch.php                         30-May-2024 18:01                7075
class.hrtime-unit.php                              30-May-2024 18:01                4448
class.imagick.php                                  30-May-2024 18:01              286429
class.imagickdraw.php                              30-May-2024 18:01               82919
class.imagickkernel.php                            30-May-2024 18:01                6574
class.imagickpixel.php                             30-May-2024 18:01               13884
class.imagickpixeliterator.php                     30-May-2024 18:01                9659
class.imap-connection.php                          30-May-2024 18:01                1825
class.infiniteiterator.php                         30-May-2024 18:01                5324
class.inflatecontext.php                           30-May-2024 18:01                1829
class.internaliterator.php                         30-May-2024 18:01                4894
class.intlbreakiterator.php                        30-May-2024 18:01               30534
class.intlcalendar.php                             30-May-2024 18:01               72254
class.intlchar.php                                 30-May-2024 18:01              473391
class.intlcodepointbreakiterator.php               30-May-2024 18:01               21555
class.intldateformatter.php                        30-May-2024 18:01               32420
class.intldatepatterngenerator.php                 30-May-2024 18:01                4777
class.intlexception.php                            30-May-2024 18:01                8649
class.intlgregoriancalendar.php                    30-May-2024 18:01               53274
class.intliterator.php                             30-May-2024 18:01                5082
class.intlpartsiterator.php                        30-May-2024 18:01                7167
class.intlrulebasedbreakiterator.php               30-May-2024 18:01               24470
class.intltimezone.php                             30-May-2024 18:01               28371
class.invalidargumentexception.php                 30-May-2024 18:01                8564
class.iterator.php                                 30-May-2024 18:01               11559
class.iteratoraggregate.php                        30-May-2024 18:01                6383
class.iteratoriterator.php                         30-May-2024 18:01                6331
class.jsonexception.php                            30-May-2024 18:01                8933
class.jsonserializable.php                         30-May-2024 18:01                2846
class.ldap-connection.php                          30-May-2024 18:01                1845
class.ldap-result-entry.php                        30-May-2024 18:01                1860
class.ldap-result.php                              30-May-2024 18:01                1837
class.lengthexception.php                          30-May-2024 18:01                8493
class.libxmlerror.php                              30-May-2024 18:01                5668
class.limititerator.php                            30-May-2024 18:01               11293
class.locale.php                                   30-May-2024 18:01               28563
class.logicexception.php                           30-May-2024 18:01                8538
class.lua.php                                      30-May-2024 18:01                7792
class.luaclosure.php                               30-May-2024 18:01                2711
class.luasandbox.php                               30-May-2024 18:01               14189
class.luasandboxerror.php                          30-May-2024 18:01               10118
class.luasandboxerrorerror.php                     30-May-2024 18:01                7651
class.luasandboxfatalerror.php                     30-May-2024 18:01                7773
class.luasandboxfunction.php                       30-May-2024 18:01                3970
class.luasandboxmemoryerror.php                    30-May-2024 18:01                7962
class.luasandboxruntimeerror.php                   30-May-2024 18:01                7793
class.luasandboxsyntaxerror.php                    30-May-2024 18:01                7655
class.luasandboxtimeouterror.php                   30-May-2024 18:01                7946
class.memcache.php                                 30-May-2024 18:01               19203
class.memcached.php                                30-May-2024 18:01               47529
class.memcachedexception.php                       30-May-2024 18:01                7534
class.messageformatter.php                         30-May-2024 18:01               12167
class.mongodb-bson-binary.php                      30-May-2024 18:01               16933
class.mongodb-bson-binaryinterface.php             30-May-2024 18:01                4832
class.mongodb-bson-dbpointer.php                   30-May-2024 18:01                6077
class.mongodb-bson-decimal128.php                  30-May-2024 18:01                7870
class.mongodb-bson-decimal128interface.php         30-May-2024 18:01                3959
class.mongodb-bson-document.php                    30-May-2024 18:01               14121
class.mongodb-bson-int64.php                       30-May-2024 18:01                7547
class.mongodb-bson-iterator.php                    30-May-2024 18:01                5035
class.mongodb-bson-javascript.php                  30-May-2024 18:01                8807
class.mongodb-bson-javascriptinterface.php         30-May-2024 18:01                5062
class.mongodb-bson-maxkey.php                      30-May-2024 18:01                5906
class.mongodb-bson-maxkeyinterface.php             30-May-2024 18:01                2247
class.mongodb-bson-minkey.php                      30-May-2024 18:01                5897
class.mongodb-bson-minkeyinterface.php             30-May-2024 18:01                2228
class.mongodb-bson-objectid.php                    30-May-2024 18:01                9268
class.mongodb-bson-objectidinterface.php           30-May-2024 18:01                4449
class.mongodb-bson-packedarray.php                 30-May-2024 18:01               11942
class.mongodb-bson-persistable.php                 30-May-2024 18:01                6189
class.mongodb-bson-regex.php                       30-May-2024 18:01                8238
class.mongodb-bson-regexinterface.php              30-May-2024 18:01                4851
class.mongodb-bson-serializable.php                30-May-2024 18:01                4347
class.mongodb-bson-symbol.php                      30-May-2024 18:01                5965
class.mongodb-bson-timestamp.php                   30-May-2024 18:01                8485
class.mongodb-bson-timestampinterface.php          30-May-2024 18:01                5009
class.mongodb-bson-type.php                        30-May-2024 18:01                2074
class.mongodb-bson-undefined.php                   30-May-2024 18:01                6053
class.mongodb-bson-unserializable.php              30-May-2024 18:01                4090
class.mongodb-bson-utcdatetime.php                 30-May-2024 18:01                8087
class.mongodb-bson-utcdatetimeinterface.php        30-May-2024 18:01                4522
class.mongodb-driver-bulkwrite.php                 30-May-2024 18:01               24207
class.mongodb-driver-clientencryption.php          30-May-2024 18:01               23505
class.mongodb-driver-command.php                   30-May-2024 18:01               14298
class.mongodb-driver-cursor.php                    30-May-2024 18:01               25882
class.mongodb-driver-cursorid.php                  30-May-2024 18:01                5596
class.mongodb-driver-cursorinterface.php           30-May-2024 18:01                6310
class.mongodb-driver-exception-authenticationex..> 30-May-2024 18:01                9205
class.mongodb-driver-exception-bulkwriteexcepti..> 30-May-2024 18:01               10059
class.mongodb-driver-exception-commandexception..> 30-May-2024 18:01               10968
class.mongodb-driver-exception-connectionexcept..> 30-May-2024 18:01                9274
class.mongodb-driver-exception-connectiontimeou..> 30-May-2024 18:01                9662
class.mongodb-driver-exception-encryptionexcept..> 30-May-2024 18:01                9208
class.mongodb-driver-exception-exception.php       30-May-2024 18:01                2242
class.mongodb-driver-exception-executiontimeout..> 30-May-2024 18:01               10313
class.mongodb-driver-exception-invalidargumente..> 30-May-2024 18:01                8234
class.mongodb-driver-exception-logicexception.php  30-May-2024 18:01                8118
class.mongodb-driver-exception-runtimeexception..> 30-May-2024 18:01               11717
class.mongodb-driver-exception-serverexception.php 30-May-2024 18:01                9285
class.mongodb-driver-exception-sslconnectionexc..> 30-May-2024 18:01                9552
class.mongodb-driver-exception-unexpectedvaluee..> 30-May-2024 18:01                8251
class.mongodb-driver-exception-writeexception.php  30-May-2024 18:01               12235
class.mongodb-driver-manager.php                   30-May-2024 18:01               21875
class.mongodb-driver-monitoring-commandfailedev..> 30-May-2024 18:01                8689
class.mongodb-driver-monitoring-commandstartede..> 30-May-2024 18:01                7612
class.mongodb-driver-monitoring-commandsubscrib..> 30-May-2024 18:01                6396
class.mongodb-driver-monitoring-commandsucceede..> 30-May-2024 18:01                8280
class.mongodb-driver-monitoring-logsubscriber.php  30-May-2024 18:01               10173
class.mongodb-driver-monitoring-sdamsubscriber.php 30-May-2024 18:01               11746
class.mongodb-driver-monitoring-serverchangedev..> 30-May-2024 18:01                5802
class.mongodb-driver-monitoring-serverclosedeve..> 30-May-2024 18:01                4449
class.mongodb-driver-monitoring-serverheartbeat..> 30-May-2024 18:01                5800
class.mongodb-driver-monitoring-serverheartbeat..> 30-May-2024 18:01                4627
class.mongodb-driver-monitoring-serverheartbeat..> 30-May-2024 18:01                5872
class.mongodb-driver-monitoring-serveropeningev..> 30-May-2024 18:01                4469
class.mongodb-driver-monitoring-subscriber.php     30-May-2024 18:01                2689
class.mongodb-driver-monitoring-topologychanged..> 30-May-2024 18:01                4797
class.mongodb-driver-monitoring-topologyclosede..> 30-May-2024 18:01                3408
class.mongodb-driver-monitoring-topologyopening..> 30-May-2024 18:01                3422
class.mongodb-driver-query.php                     30-May-2024 18:01                3481
class.mongodb-driver-readconcern.php               30-May-2024 18:01               17753
class.mongodb-driver-readpreference.php            30-May-2024 18:01               21964
class.mongodb-driver-server.php                    30-May-2024 18:01               27234
class.mongodb-driver-serverapi.php                 30-May-2024 18:01               14184
class.mongodb-driver-serverdescription.php         30-May-2024 18:01               16938
class.mongodb-driver-session.php                   30-May-2024 18:01               15597
class.mongodb-driver-topologydescription.php       30-May-2024 18:01               11702
class.mongodb-driver-writeconcern.php              30-May-2024 18:01               10349
class.mongodb-driver-writeconcernerror.php         30-May-2024 18:01                4440
class.mongodb-driver-writeerror.php                30-May-2024 18:01                4764
class.mongodb-driver-writeresult.php               30-May-2024 18:01                8742
class.multipleiterator.php                         30-May-2024 18:01               11582
class.mysql-xdevapi-baseresult.php                 30-May-2024 18:01                3131
class.mysql-xdevapi-client.php                     30-May-2024 18:01                3248
class.mysql-xdevapi-collection.php                 30-May-2024 18:01               11067
class.mysql-xdevapi-collectionadd.php              30-May-2024 18:01                3027
class.mysql-xdevapi-collectionfind.php             30-May-2024 18:01                9104
class.mysql-xdevapi-collectionmodify.php           30-May-2024 18:01               10539
class.mysql-xdevapi-collectionremove.php           30-May-2024 18:01                5360
class.mysql-xdevapi-columnresult.php               30-May-2024 18:01                7177
class.mysql-xdevapi-crudoperationbindable.php      30-May-2024 18:01                3060
class.mysql-xdevapi-crudoperationlimitable.php     30-May-2024 18:01                3071
class.mysql-xdevapi-crudoperationskippable.php     30-May-2024 18:01                3095
class.mysql-xdevapi-crudoperationsortable.php      30-May-2024 18:01                3051
class.mysql-xdevapi-databaseobject.php             30-May-2024 18:01                3660
class.mysql-xdevapi-docresult.php                  30-May-2024 18:01                4216
class.mysql-xdevapi-exception.php                  30-May-2024 18:01                2253
class.mysql-xdevapi-executable.php                 30-May-2024 18:01                2701
class.mysql-xdevapi-executionstatus.php            30-May-2024 18:01                4943
class.mysql-xdevapi-expression.php                 30-May-2024 18:01                3336
class.mysql-xdevapi-result.php                     30-May-2024 18:01                4595
class.mysql-xdevapi-rowresult.php                  30-May-2024 18:01                5399
class.mysql-xdevapi-schema.php                     30-May-2024 18:01                8103
class.mysql-xdevapi-schemaobject.php               30-May-2024 18:01                2877
class.mysql-xdevapi-session.php                    30-May-2024 18:01               10054
class.mysql-xdevapi-sqlstatement.php               30-May-2024 18:01                6829
class.mysql-xdevapi-sqlstatementresult.php         30-May-2024 18:01                7619
class.mysql-xdevapi-statement.php                  30-May-2024 18:01                5162
class.mysql-xdevapi-table.php                      30-May-2024 18:01                7722
class.mysql-xdevapi-tabledelete.php                30-May-2024 18:01                5412
class.mysql-xdevapi-tableinsert.php                30-May-2024 18:01                3653
class.mysql-xdevapi-tableselect.php                30-May-2024 18:01                8706
class.mysql-xdevapi-tableupdate.php                30-May-2024 18:01                6350
class.mysql-xdevapi-warning.php                    30-May-2024 18:01                3833
class.mysqli-driver.php                            30-May-2024 18:01                8341
class.mysqli-result.php                            30-May-2024 18:01               16282
class.mysqli-sql-exception.php                     30-May-2024 18:01               10096
class.mysqli-stmt.php                              30-May-2024 18:01               19318
class.mysqli-warning.php                           30-May-2024 18:01                4502
class.mysqli.php                                   30-May-2024 18:01               46185
class.norewinditerator.php                         30-May-2024 18:01                6761
class.normalizer.php                               30-May-2024 18:01               13654
class.numberformatter.php                          30-May-2024 18:01               74570
class.oauth.php                                    30-May-2024 18:01               20063
class.oauthexception.php                           30-May-2024 18:01                8585
class.oauthprovider.php                            30-May-2024 18:01               12983
class.ocicollection.php                            30-May-2024 18:01                7208
class.ocilob.php                                   30-May-2024 18:01               15389
class.opensslasymmetrickey.php                     30-May-2024 18:01                1913
class.opensslcertificate.php                       30-May-2024 18:01                1917
class.opensslcertificatesigningrequest.php         30-May-2024 18:01                2004
class.outeriterator.php                            30-May-2024 18:01                4372
class.outofboundsexception.php                     30-May-2024 18:01                8587
class.outofrangeexception.php                      30-May-2024 18:01                8589
class.overflowexception.php                        30-May-2024 18:01                8508
class.override.php                                 30-May-2024 18:01                4091
class.parallel-channel.php                         30-May-2024 18:01                8261
class.parallel-events-event-type.php               30-May-2024 18:01                3419
class.parallel-events-event.php                    30-May-2024 18:01                3572
class.parallel-events-input.php                    30-May-2024 18:01                4810
class.parallel-events.php                          30-May-2024 18:01                7181
class.parallel-future.php                          30-May-2024 18:01                7872
class.parallel-runtime.php                         30-May-2024 18:01                6460
class.parallel-sync.php                            30-May-2024 18:01                5282
class.parentiterator.php                           30-May-2024 18:01                9649
class.parle-errorinfo.php                          30-May-2024 18:01                3910
class.parle-lexer.php                              30-May-2024 18:01               13249
class.parle-lexerexception.php                     30-May-2024 18:01                7788
class.parle-parser.php                             30-May-2024 18:01               18177
class.parle-parserexception.php                    30-May-2024 18:01                7770
class.parle-rlexer.php                             30-May-2024 18:01               15484
class.parle-rparser.php                            30-May-2024 18:01               18350
class.parle-stack.php                              30-May-2024 18:01                4879
class.parle-token.php                              30-May-2024 18:01                4978
class.parseerror.php                               30-May-2024 18:01                8981
class.pdo.php                                      30-May-2024 18:01               43126
class.pdoexception.php                             30-May-2024 18:01               10434
class.pdorow.php                                   30-May-2024 18:01                4397
class.pdostatement.php                             30-May-2024 18:01               23372
class.pgsql-connection.php                         30-May-2024 18:01                1858
class.pgsql-lob.php                                30-May-2024 18:01                1800
class.pgsql-result.php                             30-May-2024 18:01                1832
class.phar.php                                     30-May-2024 18:01               74244
class.phardata.php                                 30-May-2024 18:01               49643
class.pharexception.php                            30-May-2024 18:01                8478
class.pharfileinfo.php                             30-May-2024 18:01               21704
class.php-user-filter.php                          30-May-2024 18:01                6489
class.phptoken.php                                 30-May-2024 18:01                8801
class.pool.php                                     30-May-2024 18:01                7765
class.pspell-config.php                            30-May-2024 18:01                1834
class.pspell-dictionary.php                        30-May-2024 18:01                1871
class.quickhashinthash.php                         30-May-2024 18:01               15154
class.quickhashintset.php                          30-May-2024 18:01               12933
class.quickhashintstringhash.php                   30-May-2024 18:01               16050
class.quickhashstringinthash.php                   30-May-2024 18:01               13719
class.random-brokenrandomengineerror.php           30-May-2024 18:01                8576
class.random-cryptosafeengine.php                  30-May-2024 18:01                2514
class.random-engine-mt19937.php                    30-May-2024 18:01                5416
class.random-engine-pcgoneseq128xslrr64.php        30-May-2024 18:01                6230
class.random-engine-secure.php                     30-May-2024 18:01                3457
class.random-engine-xoshiro256starstar.php         30-May-2024 18:01                6415
class.random-engine.php                            30-May-2024 18:01                3811
class.random-randomerror.php                       30-May-2024 18:01                8500
class.random-randomexception.php                   30-May-2024 18:01                8614
class.random-randomizer.php                        30-May-2024 18:01               10624
class.rangeexception.php                           30-May-2024 18:01                8717
class.rararchive.php                               30-May-2024 18:01                7777
class.rarentry.php                                 30-May-2024 18:01               49841
class.rarexception.php                             30-May-2024 18:01                8338
class.recursivearrayiterator.php                   30-May-2024 18:01               15958
class.recursivecachingiterator.php                 30-May-2024 18:01               14161
class.recursivecallbackfilteriterator.php          30-May-2024 18:01               13240
class.recursivedirectoryiterator.php               30-May-2024 18:01               29873
class.recursivefilteriterator.php                  30-May-2024 18:01                8280
class.recursiveiterator.php                        30-May-2024 18:01                4910
class.recursiveiteratoriterator.php                30-May-2024 18:01               14684
class.recursiveregexiterator.php                   30-May-2024 18:01               14795
class.recursivetreeiterator.php                    30-May-2024 18:01               25694
class.reflection.php                               30-May-2024 18:01                3484
class.reflectionattribute.php                      30-May-2024 18:01                6439
class.reflectionclass.php                          30-May-2024 18:01               37540
class.reflectionclassconstant.php                  30-May-2024 18:01               16298
class.reflectionenum.php                           30-May-2024 18:01               31539
class.reflectionenumbackedcase.php                 30-May-2024 18:01               12983
class.reflectionenumunitcase.php                   30-May-2024 18:01               12604
class.reflectionexception.php                      30-May-2024 18:01                8452
class.reflectionextension.php                      30-May-2024 18:01               10624
class.reflectionfiber.php                          30-May-2024 18:01                5226
class.reflectionfunction.php                       30-May-2024 18:01               21276
class.reflectionfunctionabstract.php               30-May-2024 18:01               19904
class.reflectiongenerator.php                      30-May-2024 18:01                6382
class.reflectionintersectiontype.php               30-May-2024 18:01                3486
class.reflectionmethod.php                         30-May-2024 18:01               32871
class.reflectionnamedtype.php                      30-May-2024 18:01                3798
class.reflectionobject.php                         30-May-2024 18:01               29317
class.reflectionparameter.php                      30-May-2024 18:01               16549
class.reflectionproperty.php                       30-May-2024 18:01               22216
class.reflectionreference.php                      30-May-2024 18:01                4182
class.reflectiontype.php                           30-May-2024 18:01                4523
class.reflectionuniontype.php                      30-May-2024 18:01                3370
class.reflectionzendextension.php                  30-May-2024 18:01                7913
class.reflector.php                                30-May-2024 18:01                3929
class.regexiterator.php                            30-May-2024 18:01               17656
class.resourcebundle.php                           30-May-2024 18:01               10468
class.returntypewillchange.php                     30-May-2024 18:01                3402
class.rnpffi.php                                   30-May-2024 18:01                1691
class.rrdcreator.php                               30-May-2024 18:01                4538
class.rrdgraph.php                                 30-May-2024 18:01                3960
class.rrdupdater.php                               30-May-2024 18:01                3346
class.runtimeexception.php                         30-May-2024 18:01                8495
class.seaslog.php                                  30-May-2024 18:01               21996
class.seekableiterator.php                         30-May-2024 18:01               11378
class.sensitiveparameter.php                       30-May-2024 18:01                6434
class.sensitiveparametervalue.php                  30-May-2024 18:01                5044
class.serializable.php                             30-May-2024 18:01                8352
class.sessionhandler.php                           30-May-2024 18:01               26110
class.sessionhandlerinterface.php                  30-May-2024 18:01               16036
class.sessionidinterface.php                       30-May-2024 18:01                3344
class.sessionupdatetimestamphandlerinterface.php   30-May-2024 18:01                4609
class.shmop.php                                    30-May-2024 18:01                1732
class.simdjsonexception.php                        30-May-2024 18:01                5066
class.simdjsonvalueerror.php                       30-May-2024 18:01                8367
class.simplexmlelement.php                         30-May-2024 18:01               18821
class.simplexmliterator.php                        30-May-2024 18:01               16724
class.snmp.php                                     30-May-2024 18:01               28340
class.snmpexception.php                            30-May-2024 18:01                9084
class.soapclient.php                               30-May-2024 18:01               34478
class.soapfault.php                                30-May-2024 18:01               14369
class.soapheader.php                               30-May-2024 18:01                6091
class.soapparam.php                                30-May-2024 18:01                3779
class.soapserver.php                               30-May-2024 18:01               10068
class.soapvar.php                                  30-May-2024 18:01                7925
class.socket.php                                   30-May-2024 18:01                1796
class.sodiumexception.php                          30-May-2024 18:01                8443
class.solrclient.php                               30-May-2024 18:01               25117
class.solrclientexception.php                      30-May-2024 18:01                9749
class.solrcollapsefunction.php                     30-May-2024 18:01               11831
class.solrdismaxquery.php                          30-May-2024 18:01              112189
class.solrdocument.php                             30-May-2024 18:01               23649
class.solrdocumentfield.php                        30-May-2024 18:01                4765
class.solrexception.php                            30-May-2024 18:01               10218
class.solrgenericresponse.php                      30-May-2024 18:01               12739
class.solrillegalargumentexception.php             30-May-2024 18:01                9889
class.solrillegaloperationexception.php            30-May-2024 18:01                9929
class.solrinputdocument.php                        30-May-2024 18:01               19693
class.solrmissingmandatoryparameterexception.php   30-May-2024 18:01                9022
class.solrmodifiableparams.php                     30-May-2024 18:01                9030
class.solrobject.php                               30-May-2024 18:01                5913
class.solrparams.php                               30-May-2024 18:01                9189
class.solrpingresponse.php                         30-May-2024 18:01               11428
class.solrquery.php                                30-May-2024 18:01              119285
class.solrqueryresponse.php                        30-May-2024 18:01               12659
class.solrresponse.php                             30-May-2024 18:01               14613
class.solrserverexception.php                      30-May-2024 18:01                9761
class.solrupdateresponse.php                       30-May-2024 18:01               12720
class.solrutils.php                                30-May-2024 18:01                5024
class.spldoublylinkedlist.php                      30-May-2024 18:01               17489
class.splfileinfo.php                              30-May-2024 18:01               18059
class.splfileobject.php                            30-May-2024 18:01               37279
class.splfixedarray.php                            30-May-2024 18:01               19914
class.splheap.php                                  30-May-2024 18:01                7789
class.splmaxheap.php                               30-May-2024 18:01                7225
class.splminheap.php                               30-May-2024 18:01                7235
class.splobjectstorage.php                         30-May-2024 18:01               21159
class.splobserver.php                              30-May-2024 18:01                2857
class.splpriorityqueue.php                         30-May-2024 18:01               11829
class.splqueue.php                                 30-May-2024 18:01               17208
class.splstack.php                                 30-May-2024 18:01               14421
class.splsubject.php                               30-May-2024 18:01                3726
class.spltempfileobject.php                        30-May-2024 18:01               31836
class.spoofchecker.php                             30-May-2024 18:01               17625
class.sqlite3.php                                  30-May-2024 18:01               39980
class.sqlite3exception.php                         30-May-2024 18:01                8419
class.sqlite3result.php                            30-May-2024 18:01                5851
class.sqlite3stmt.php                              30-May-2024 18:01                8341
class.stdclass.php                                 30-May-2024 18:01                6841
class.stomp.php                                    30-May-2024 18:01               21702
class.stompexception.php                           30-May-2024 18:01                5894
class.stompframe.php                               30-May-2024 18:01                4357
class.streamwrapper.php                            30-May-2024 18:01               20280
class.stringable.php                               30-May-2024 18:01                8417
class.svm.php                                      30-May-2024 18:01               18494
class.svmmodel.php                                 30-May-2024 18:01                6958
class.swoole-async.php                             30-May-2024 18:01                8050
class.swoole-atomic.php                            30-May-2024 18:01                5079
class.swoole-buffer.php                            30-May-2024 18:01                7534
class.swoole-channel.php                           30-May-2024 18:01                3977
class.swoole-client.php                            30-May-2024 18:01               16552
class.swoole-connection-iterator.php               30-May-2024 18:01                7530
class.swoole-coroutine.php                         30-May-2024 18:01               18666
class.swoole-event.php                             30-May-2024 18:01                7473
class.swoole-exception.php                         30-May-2024 18:01                4581
class.swoole-http-client.php                       30-May-2024 18:01               14798
class.swoole-http-request.php                      30-May-2024 18:01                3042
class.swoole-http-response.php                     30-May-2024 18:01               10918
class.swoole-http-server.php                       30-May-2024 18:01               26444
class.swoole-lock.php                              30-May-2024 18:01                4687
class.swoole-mmap.php                              30-May-2024 18:01                3088
class.swoole-mysql-exception.php                   30-May-2024 18:01                4622
class.swoole-mysql.php                             30-May-2024 18:01                5426
class.swoole-process.php                           30-May-2024 18:01               13680
class.swoole-redis-server.php                      30-May-2024 18:01               32081
class.swoole-serialize.php                         30-May-2024 18:01                3620
class.swoole-server.php                            30-May-2024 18:01               29585
class.swoole-table.php                             30-May-2024 18:01               12730
class.swoole-timer.php                             30-May-2024 18:01                5008
class.swoole-websocket-frame.php                   30-May-2024 18:01                1956
class.swoole-websocket-server.php                  30-May-2024 18:01                7837
class.syncevent.php                                30-May-2024 18:01                4906
class.syncmutex.php                                30-May-2024 18:01                4231
class.syncreaderwriter.php                         30-May-2024 18:01                5215
class.syncsemaphore.php                            30-May-2024 18:01                4663
class.syncsharedmemory.php                         30-May-2024 18:01                5513
class.sysvmessagequeue.php                         30-May-2024 18:01                1842
class.sysvsemaphore.php                            30-May-2024 18:01                1827
class.sysvsharedmemory.php                         30-May-2024 18:01                1830
class.thread.php                                   30-May-2024 18:01               11429
class.threaded.php                                 30-May-2024 18:01                8853
class.throwable.php                                30-May-2024 18:01                7319
class.tidy.php                                     30-May-2024 18:01               18885
class.tidynode.php                                 30-May-2024 18:01               11611
class.transliterator.php                           30-May-2024 18:01               10194
class.traversable.php                              30-May-2024 18:01                4499
class.typeerror.php                                30-May-2024 18:01                9551
class.uconverter.php                               30-May-2024 18:01               41038
class.ui-area.php                                  30-May-2024 18:01               12262
class.ui-control.php                               30-May-2024 18:01                5485
class.ui-controls-box.php                          30-May-2024 18:01               10133
class.ui-controls-button.php                       30-May-2024 18:01                6685
class.ui-controls-check.php                        30-May-2024 18:01                7529
class.ui-controls-colorbutton.php                  30-May-2024 18:01                6564
class.ui-controls-combo.php                        30-May-2024 18:01                6653
class.ui-controls-editablecombo.php                30-May-2024 18:01                6765
class.ui-controls-entry.php                        30-May-2024 18:01                9652
class.ui-controls-form.php                         30-May-2024 18:01                8057
class.ui-controls-grid.php                         30-May-2024 18:01               13164
class.ui-controls-group.php                        30-May-2024 18:01                8365
class.ui-controls-label.php                        30-May-2024 18:01                6436
class.ui-controls-multilineentry.php               30-May-2024 18:01                9895
class.ui-controls-picker.php                       30-May-2024 18:01                7582
class.ui-controls-progress.php                     30-May-2024 18:01                5937
class.ui-controls-radio.php                        30-May-2024 18:01                6632
class.ui-controls-separator.php                    30-May-2024 18:01                7086
class.ui-controls-slider.php                       30-May-2024 18:01                7020
class.ui-controls-spin.php                         30-May-2024 18:01                6890
class.ui-controls-tab.php                          30-May-2024 18:01                9163
class.ui-draw-brush-gradient.php                   30-May-2024 18:01                7345
class.ui-draw-brush-lineargradient.php             30-May-2024 18:01                6597
class.ui-draw-brush-radialgradient.php             30-May-2024 18:01                6783
class.ui-draw-brush.php                            30-May-2024 18:01                4445
class.ui-draw-color.php                            30-May-2024 18:01                8602
class.ui-draw-line-cap.php                         30-May-2024 18:01                3751
class.ui-draw-line-join.php                        30-May-2024 18:01                3735
class.ui-draw-matrix.php                           30-May-2024 18:01                5635
class.ui-draw-path.php                             30-May-2024 18:01               10776
class.ui-draw-pen.php                              30-May-2024 18:01                8142
class.ui-draw-stroke.php                           30-May-2024 18:01                6893
class.ui-draw-text-font-descriptor.php             30-May-2024 18:01                6055
class.ui-draw-text-font-italic.php                 30-May-2024 18:01                4110
class.ui-draw-text-font-stretch.php                30-May-2024 18:01                8306
class.ui-draw-text-font-weight.php                 30-May-2024 18:01                8908
class.ui-draw-text-font.php                        30-May-2024 18:01                4884
class.ui-draw-text-layout.php                      30-May-2024 18:01                5294
class.ui-exception-invalidargumentexception.php    30-May-2024 18:01                7804
class.ui-exception-runtimeexception.php            30-May-2024 18:01                7727
class.ui-executor.php                              30-May-2024 18:01                5445
class.ui-key.php                                   30-May-2024 18:01               21350
class.ui-menu.php                                  30-May-2024 18:01                6303
class.ui-menuitem.php                              30-May-2024 18:01                3773
class.ui-point.php                                 30-May-2024 18:01                6322
class.ui-size.php                                  30-May-2024 18:01                6418
class.ui-window.php                                30-May-2024 18:01               13107
class.underflowexception.php                       30-May-2024 18:01                8579
class.unexpectedvalueexception.php                 30-May-2024 18:01                8740
class.unhandledmatcherror.php                      30-May-2024 18:01                8635
class.unitenum.php                                 30-May-2024 18:01                2894
class.v8js.php                                     30-May-2024 18:01                9186
class.v8jsexception.php                            30-May-2024 18:01               11370
class.valueerror.php                               30-May-2024 18:01                8614
class.variant.php                                  30-May-2024 18:01                5870
class.varnishadmin.php                             30-May-2024 18:01               11545
class.varnishlog.php                               30-May-2024 18:01               34810
class.varnishstat.php                              30-May-2024 18:01                3022
class.volatile.php                                 30-May-2024 18:01               11768
class.vtiful-kernel-excel.php                      30-May-2024 18:01               12054
class.vtiful-kernel-format.php                     30-May-2024 18:01               16093
class.weakmap.php                                  30-May-2024 18:01                9668
class.weakreference.php                            30-May-2024 18:01                5744
class.win32serviceexception.php                    30-May-2024 18:01                7838
class.wkhtmltox-image-converter.php                30-May-2024 18:01                4172
class.wkhtmltox-pdf-converter.php                  30-May-2024 18:01                4497
class.wkhtmltox-pdf-object.php                     30-May-2024 18:01                3010
class.worker.php                                   30-May-2024 18:01                8559
class.xmldiff-base.php                             30-May-2024 18:01                4134
class.xmldiff-dom.php                              30-May-2024 18:01                5088
class.xmldiff-file.php                             30-May-2024 18:01                5064
class.xmldiff-memory.php                           30-May-2024 18:01                5096
class.xmlparser.php                                30-May-2024 18:01                1813
class.xmlreader.php                                30-May-2024 18:01               41300
class.xmlwriter.php                                30-May-2024 18:01               32173
class.xsltprocessor.php                            30-May-2024 18:01               11711
class.yac.php                                      30-May-2024 18:01                9578
class.yaconf.php                                   30-May-2024 18:01                3503
class.yaf-action-abstract.php                      30-May-2024 18:01               12749
class.yaf-application.php                          30-May-2024 18:01               12688
class.yaf-bootstrap-abstract.php                   30-May-2024 18:01                5581
class.yaf-config-abstract.php                      30-May-2024 18:01                5243
class.yaf-config-ini.php                           30-May-2024 18:01               17835
class.yaf-config-simple.php                        30-May-2024 18:01               13251
class.yaf-controller-abstract.php                  30-May-2024 18:01               19225
class.yaf-dispatcher.php                           30-May-2024 18:01               20279
class.yaf-exception-dispatchfailed.php             30-May-2024 18:01                2667
class.yaf-exception-loadfailed-action.php          30-May-2024 18:01                2738
class.yaf-exception-loadfailed-controller.php      30-May-2024 18:01                2763
class.yaf-exception-loadfailed-module.php          30-May-2024 18:01                2727
class.yaf-exception-loadfailed-view.php            30-May-2024 18:01                2667
class.yaf-exception-loadfailed.php                 30-May-2024 18:01                2641
class.yaf-exception-routerfailed.php               30-May-2024 18:01                2652
class.yaf-exception-startuperror.php               30-May-2024 18:01                2650
class.yaf-exception-typeerror.php                  30-May-2024 18:01                2621
class.yaf-exception.php                            30-May-2024 18:01                8508
class.yaf-loader.php                               30-May-2024 18:01               18791
class.yaf-plugin-abstract.php                      30-May-2024 18:01               16078
class.yaf-registry.php                             30-May-2024 18:01                6055
class.yaf-request-abstract.php                     30-May-2024 18:01               23772
class.yaf-request-http.php                         30-May-2024 18:01               23239
class.yaf-request-simple.php                       30-May-2024 18:01               22722
class.yaf-response-abstract.php                    30-May-2024 18:01               11839
class.yaf-route-interface.php                      30-May-2024 18:01                3756
class.yaf-route-map.php                            30-May-2024 18:01                6531
class.yaf-route-regex.php                          30-May-2024 18:01                8423
class.yaf-route-rewrite.php                        30-May-2024 18:01                7527
class.yaf-route-simple.php                         30-May-2024 18:01                6604
class.yaf-route-static.php                         30-May-2024 18:01                5076
class.yaf-route-supervar.php                       30-May-2024 18:01                4769
class.yaf-router.php                               30-May-2024 18:01               12022
class.yaf-session.php                              30-May-2024 18:01               12670
class.yaf-view-interface.php                       30-May-2024 18:01                6085
class.yaf-view-simple.php                          30-May-2024 18:01               11305
class.yar-client-exception.php                     30-May-2024 18:01                6653
class.yar-client.php                               30-May-2024 18:01                5858
class.yar-concurrent-client.php                    30-May-2024 18:01                6658
class.yar-server-exception.php                     30-May-2024 18:01                7110
class.yar-server.php                               30-May-2024 18:01                3509
class.ziparchive.php                               30-May-2024 18:01               90746
class.zmq.php                                      30-May-2024 18:01               40201
class.zmqcontext.php                               30-May-2024 18:01                5632
class.zmqdevice.php                                30-May-2024 18:01                7081
class.zmqpoll.php                                  30-May-2024 18:01                5217
class.zmqsocket.php                                30-May-2024 18:01               11494
class.zookeeper.php                                30-May-2024 18:01               56131
class.zookeeperauthenticationexception.php         30-May-2024 18:01                7734
class.zookeeperconfig.php                          30-May-2024 18:01                6465
class.zookeeperconnectionexception.php             30-May-2024 18:01                7729
class.zookeeperexception.php                       30-May-2024 18:01                7595
class.zookeepermarshallingexception.php            30-May-2024 18:01                7750
class.zookeepernonodeexception.php                 30-May-2024 18:01                7717
class.zookeeperoperationtimeoutexception.php       30-May-2024 18:01                7760
class.zookeepersessionexception.php                30-May-2024 18:01                7679
classobj.configuration.php                         30-May-2024 18:01                1305
classobj.constants.php                             30-May-2024 18:01                1225
classobj.examples.php                              30-May-2024 18:01               13558
classobj.installation.php                          30-May-2024 18:01                1289
classobj.requirements.php                          30-May-2024 18:01                1265
classobj.resources.php                             30-May-2024 18:01                1248
classobj.setup.php                                 30-May-2024 18:01                1655
closure.bind.php                                   30-May-2024 18:01                8190
closure.bindto.php                                 30-May-2024 18:01               10013                                   30-May-2024 18:01                6381
closure.construct.php                              30-May-2024 18:01                2480
closure.fromcallable.php                           30-May-2024 18:01                3963
cmark.constants.php                                30-May-2024 18:01                4274
cmark.installation.php                             30-May-2024 18:01                1985
cmark.requirements.php                             30-May-2024 18:01                1333
cmark.setup.php                                    30-May-2024 18:01                1481
collator.asort.php                                 30-May-2024 18:01                9560                               30-May-2024 18:01               10638
collator.construct.php                             30-May-2024 18:01                5633
collator.create.php                                30-May-2024 18:01                5564
collator.getattribute.php                          30-May-2024 18:01                6108
collator.geterrorcode.php                          30-May-2024 18:01                5302
collator.geterrormessage.php                       30-May-2024 18:01                5373
collator.getlocale.php                             30-May-2024 18:01                6893
collator.getsortkey.php                            30-May-2024 18:01                7064
collator.getstrength.php                           30-May-2024 18:01                4914
collator.setattribute.php                          30-May-2024 18:01                6713
collator.setstrength.php                           30-May-2024 18:01               13308
collator.sort.php                                  30-May-2024 18:01                8370
collator.sortwithsortkeys.php                      30-May-2024 18:01                6585
collectable.isgarbage.php                          30-May-2024 18:01                3452
com.configuration.php                              30-May-2024 18:01                7974
com.constants.php                                  30-May-2024 18:01               26308
com.construct.php                                  30-May-2024 18:01               10179
com.error-handling.php                             30-May-2024 18:01                1631
com.examples.arrays.php                            30-May-2024 18:01                2114
com.examples.foreach.php                           30-May-2024 18:01                2900
com.examples.php                                   30-May-2024 18:01                1477
com.installation.php                               30-May-2024 18:01                1535
com.requirements.php                               30-May-2024 18:01                1293
com.resources.php                                  30-May-2024 18:01                1213
com.setup.php                                      30-May-2024 18:01                1605
commonmark-cql.construct.php                       30-May-2024 18:01                2242
commonmark-cql.invoke.php                          30-May-2024 18:01                3922
commonmark-interfaces-ivisitable.accept.php        30-May-2024 18:01                3158
commonmark-interfaces-ivisitor.enter.php           30-May-2024 18:01                4188
commonmark-interfaces-ivisitor.leave.php           30-May-2024 18:01                4190
commonmark-node-bulletlist.construct.php           30-May-2024 18:01                3239
commonmark-node-codeblock.construct.php            30-May-2024 18:01                2887
commonmark-node-heading.construct.php              30-May-2024 18:01                2680
commonmark-node-image.construct.php                30-May-2024 18:01                3330
commonmark-node-link.construct.php                 30-May-2024 18:01                3327
commonmark-node-orderedlist.construct.php          30-May-2024 18:01                4215
commonmark-node-text.construct.php                 30-May-2024 18:01                2715
commonmark-node.accept.php                         30-May-2024 18:01                2898
commonmark-node.appendchild.php                    30-May-2024 18:01                2756
commonmark-node.insertafter.php                    30-May-2024 18:01                2781
commonmark-node.insertbefore.php                   30-May-2024 18:01                2779
commonmark-node.prependchild.php                   30-May-2024 18:01                2783
commonmark-node.replace.php                        30-May-2024 18:01                2727
commonmark-node.unlink.php                         30-May-2024 18:01                2431
commonmark-parser.construct.php                    30-May-2024 18:01                3860
commonmark-parser.finish.php                       30-May-2024 18:01                2461
commonmark-parser.parse.php                        30-May-2024 18:01                2686
compersisthelper.construct.php                     30-May-2024 18:01                3649
compersisthelper.getcurfilename.php                30-May-2024 18:01                3171
compersisthelper.getmaxstreamsize.php              30-May-2024 18:01                3177
compersisthelper.initnew.php                       30-May-2024 18:01                3142
compersisthelper.loadfromfile.php                  30-May-2024 18:01                4352
compersisthelper.loadfromstream.php                30-May-2024 18:01                3570
compersisthelper.savetofile.php                    30-May-2024 18:01                6356
compersisthelper.savetostream.php                  30-May-2024 18:01                3597
componere-abstract-definition.addinterface.php     30-May-2024 18:01                3292
componere-abstract-definition.addmethod.php        30-May-2024 18:01                4019
componere-abstract-definition.addtrait.php         30-May-2024 18:01                3244
componere-abstract-definition.getreflector.php     30-May-2024 18:01                2420
componere-definition.addconstant.php               30-May-2024 18:01                4344
componere-definition.addproperty.php               30-May-2024 18:01                3751
componere-definition.construct.php                 30-May-2024 18:01                5986
componere-definition.getclosure.php                30-May-2024 18:01                3457
componere-definition.getclosures.php               30-May-2024 18:01                2703
componere-definition.isregistered.php              30-May-2024 18:01                2302
componere-definition.register.php                  30-May-2024 18:01                2451
componere-method.construct.php                     30-May-2024 18:01                2238
componere-method.getreflector.php                  30-May-2024 18:01                2223
componere-method.setprivate.php                    30-May-2024 18:01                2452
componere-method.setprotected.php                  30-May-2024 18:01                2467
componere-method.setstatic.php                     30-May-2024 18:01                2048
componere-patch.apply.php                          30-May-2024 18:01                1908
componere-patch.construct.php                      30-May-2024 18:01                3652
componere-patch.derive.php                         30-May-2024 18:01                3149
componere-patch.getclosure.php                     30-May-2024 18:01                3086
componere-patch.getclosures.php                    30-May-2024 18:01                2223
componere-patch.isapplied.php                      30-May-2024 18:01                1862
componere-patch.revert.php                         30-May-2024 18:01                1905
componere-value.construct.php                      30-May-2024 18:01                2672
componere-value.hasdefault.php                     30-May-2024 18:01                1910
componere-value.isprivate.php                      30-May-2024 18:01                1927
componere-value.isprotected.php                    30-May-2024 18:01                1937
componere-value.isstatic.php                       30-May-2024 18:01                1921
componere-value.setprivate.php                     30-May-2024 18:01                2475
componere-value.setprotected.php                   30-May-2024 18:01                2489
componere-value.setstatic.php                      30-May-2024 18:01                2065
componere.cast.php                                 30-May-2024 18:01                4922
componere.cast_by_ref.php                          30-May-2024 18:01                5095
componere.installation.php                         30-May-2024 18:01                1373
componere.requirements.php                         30-May-2024 18:01                1223
componere.setup.php                                30-May-2024 18:01                1520
configuration.changes.modes.php                    30-May-2024 18:01                4040
configuration.changes.php                          30-May-2024 18:01                9181
configuration.file.per-user.php                    30-May-2024 18:01                3254
configuration.file.php                             30-May-2024 18:01               10716
configuration.php                                  30-May-2024 18:01                1735
configure.about.php                                30-May-2024 18:01               13093
configure.php                                      30-May-2024 18:01                1464
context.ftp.php                                    30-May-2024 18:01                4358
context.http.php                                   30-May-2024 18:01               16183
context.params.php                                 30-May-2024 18:01                2540
context.phar.php                                   30-May-2024 18:01                2781
context.php                                        30-May-2024 18:01                2901
context.socket.php                                 30-May-2024 18:01                9681
context.ssl.php                                    30-May-2024 18:01               13143                                    30-May-2024 18:01                4276
context.zlib.php                                   30-May-2024 18:01                2493
control-structures.alternative-syntax.php          30-May-2024 18:01                6967
control-structures.break.php                       30-May-2024 18:01                4739
control-structures.continue.php                    30-May-2024 18:01                8263
control-structures.declare.php                     30-May-2024 18:01               10530                    30-May-2024 18:01                5253
control-structures.else.php                        30-May-2024 18:01                4800
control-structures.elseif.php                      30-May-2024 18:01                7560
control-structures.for.php                         30-May-2024 18:01               11576
control-structures.foreach.php                     30-May-2024 18:01               21021
control-structures.goto.php                        30-May-2024 18:01                7333
control-structures.if.php                          30-May-2024 18:01                4967
control-structures.intro.php                       30-May-2024 18:01                2572
control-structures.match.php                       30-May-2024 18:01               17871
control-structures.switch.php                      30-May-2024 18:01               19105
control-structures.while.php                       30-May-2024 18:01                4399
copyright.php                                      30-May-2024 18:01                2147
countable.count.php                                30-May-2024 18:01                5493
ctype.configuration.php                            30-May-2024 18:01                1284
ctype.constants.php                                30-May-2024 18:01                1196
ctype.installation.php                             30-May-2024 18:01                1532
ctype.requirements.php                             30-May-2024 18:01                1256
ctype.resources.php                                30-May-2024 18:01                1227
ctype.setup.php                                    30-May-2024 18:01                1615
cubrid.configuration.php                           30-May-2024 18:01                1232
cubrid.constants.php                               30-May-2024 18:01               13853
cubrid.examples.php                                30-May-2024 18:01               13866
cubrid.installation.php                            30-May-2024 18:01                2118
cubrid.requirements.php                            30-May-2024 18:01                1299
cubrid.resources.php                               30-May-2024 18:01                3123
cubrid.setup.php                                   30-May-2024 18:01                1628
cubridmysql.cubrid.php                             30-May-2024 18:01                4967
curl.configuration.php                             30-May-2024 18:01                2602
curl.constants.php                                 30-May-2024 18:01              196083
curl.examples-basic.php                            30-May-2024 18:01                4686
curl.examples.php                                  30-May-2024 18:01                1413
curl.installation.php                              30-May-2024 18:01                2584
curl.requirements.php                              30-May-2024 18:01                1494
curl.resources.php                                 30-May-2024 18:01                1401
curl.setup.php                                     30-May-2024 18:01                1624
curlfile.construct.php                             30-May-2024 18:01               21415
curlfile.getfilename.php                           30-May-2024 18:01                2192
curlfile.getmimetype.php                           30-May-2024 18:01                2194
curlfile.getpostfilename.php                       30-May-2024 18:01                2250
curlfile.setmimetype.php                           30-May-2024 18:01                2489
curlfile.setpostfilename.php                       30-May-2024 18:01                2535
curlstringfile.construct.php                       30-May-2024 18:01                7067
dateinterval.construct.php                         30-May-2024 18:01               13814
dateinterval.createfromdatestring.php              30-May-2024 18:01               15791
dateinterval.format.php                            30-May-2024 18:01               14966
dateperiod.construct.php                           30-May-2024 18:01               20317
dateperiod.createfromiso8601string.php             30-May-2024 18:01                8058
dateperiod.getdateinterval.php                     30-May-2024 18:01                4730
dateperiod.getenddate.php                          30-May-2024 18:01                7643
dateperiod.getrecurrences.php                      30-May-2024 18:01                8955
dateperiod.getstartdate.php                        30-May-2024 18:01                5133
datetime.add.php                                   30-May-2024 18:01                5000
datetime.configuration.php                         30-May-2024 18:01                6232
datetime.constants.php                             30-May-2024 18:01                2928
datetime.construct.php                             30-May-2024 18:01                6477
datetime.createfromformat.php                      30-May-2024 18:01                7663
datetime.createfromimmutable.php                   30-May-2024 18:01                4982
datetime.createfrominterface.php                   30-May-2024 18:01                4949
datetime.diff.php                                  30-May-2024 18:01               17440
datetime.error.tree.php                            30-May-2024 18:01                3359
datetime.examples-arithmetic.php                   30-May-2024 18:01               15555
datetime.examples.php                              30-May-2024 18:01                1487
datetime.format.php                                30-May-2024 18:01               27880
datetime.formats.php                               30-May-2024 18:01               58418
datetime.getlasterrors.php                         30-May-2024 18:01                1893
datetime.getoffset.php                             30-May-2024 18:01                7938
datetime.gettimestamp.php                          30-May-2024 18:01               10405
datetime.gettimezone.php                           30-May-2024 18:01                7871
datetime.installation.php                          30-May-2024 18:01                1679
datetime.modify.php                                30-May-2024 18:01               14543
datetime.requirements.php                          30-May-2024 18:01                1265
datetime.resources.php                             30-May-2024 18:01                1248
datetime.set-state.php                             30-May-2024 18:01                2902
datetime.setdate.php                               30-May-2024 18:01                5680
datetime.setisodate.php                            30-May-2024 18:01                5809
datetime.settime.php                               30-May-2024 18:01                7276
datetime.settimestamp.php                          30-May-2024 18:01                5095
datetime.settimezone.php                           30-May-2024 18:01                9348
datetime.setup.php                                 30-May-2024 18:01                1687
datetime.sub.php                                   30-May-2024 18:01                6387
datetime.wakeup.php                                30-May-2024 18:01                3059
datetimeimmutable.add.php                          30-May-2024 18:01               10671
datetimeimmutable.construct.php                    30-May-2024 18:01               18820
datetimeimmutable.createfromformat.php             30-May-2024 18:01               49381
datetimeimmutable.createfrominterface.php          30-May-2024 18:01                5200
datetimeimmutable.createfrommutable.php            30-May-2024 18:01                5134
datetimeimmutable.getlasterrors.php                30-May-2024 18:01                5728
datetimeimmutable.modify.php                       30-May-2024 18:01                9582
datetimeimmutable.set-state.php                    30-May-2024 18:01                2817
datetimeimmutable.setdate.php                      30-May-2024 18:01                9290
datetimeimmutable.setisodate.php                   30-May-2024 18:01               12892
datetimeimmutable.settime.php                      30-May-2024 18:01               12142
datetimeimmutable.settimestamp.php                 30-May-2024 18:01                5902
datetimeimmutable.settimezone.php                  30-May-2024 18:01                6061
datetimeimmutable.sub.php                          30-May-2024 18:01               12190
datetimezone.construct.php                         30-May-2024 18:01               10760
datetimezone.getlocation.php                       30-May-2024 18:01                6029
datetimezone.getname.php                           30-May-2024 18:01                3775
datetimezone.getoffset.php                         30-May-2024 18:01                7270
datetimezone.gettransitions.php                    30-May-2024 18:01               12273
datetimezone.listabbreviations.php                 30-May-2024 18:01                6185
datetimezone.listidentifiers.php                   30-May-2024 18:01               14881
dba.configuration.php                              30-May-2024 18:01                2315
dba.constants.php                                  30-May-2024 18:01                2258
dba.example.php                                    30-May-2024 18:01                6498
dba.examples.php                                   30-May-2024 18:01                1402
dba.installation.php                               30-May-2024 18:01               10596
dba.requirements.php                               30-May-2024 18:01                7757
dba.resources.php                                  30-May-2024 18:01                1519
dba.setup.php                                      30-May-2024 18:01                1606
dbase.configuration.php                            30-May-2024 18:01                1284
dbase.constants.php                                30-May-2024 18:01                3757
dbase.installation.php                             30-May-2024 18:01                1581
dbase.requirements.php                             30-May-2024 18:01                1244
dbase.resources.php                                30-May-2024 18:01                1502
dbase.setup.php                                    30-May-2024 18:01                1632
debugger-about.php                                 30-May-2024 18:01                1618
debugger.php                                       30-May-2024 18:01                1420
dio.configuration.php                              30-May-2024 18:01                1270
dio.constants.php                                  30-May-2024 18:01               11059
dio.installation.php                               30-May-2024 18:01                2042
dio.requirements.php                               30-May-2024 18:01                1230
dio.resources.php                                  30-May-2024 18:01                1373
dio.setup.php                                      30-May-2024 18:01                1612
dir.configuration.php                              30-May-2024 18:01                1270
dir.constants.php                                  30-May-2024 18:01                2852
dir.installation.php                               30-May-2024 18:01                1254
dir.requirements.php                               30-May-2024 18:01                1230
dir.resources.php                                  30-May-2024 18:01                1213
dir.setup.php                                      30-May-2024 18:01                1624
directory.close.php                                30-May-2024 18:01                2239                                 30-May-2024 18:01                2373
directory.rewind.php                               30-May-2024 18:01                2257
directoryiterator.construct.php                    30-May-2024 18:01                5807
directoryiterator.current.php                      30-May-2024 18:01                6111
directoryiterator.getbasename.php                  30-May-2024 18:01                6404
directoryiterator.getextension.php                 30-May-2024 18:01                6160
directoryiterator.getfilename.php                  30-May-2024 18:01                5142
directoryiterator.isdot.php                        30-May-2024 18:01                5335
directoryiterator.key.php                          30-May-2024 18:01                6545                         30-May-2024 18:01                5491
directoryiterator.rewind.php                       30-May-2024 18:01                5387                         30-May-2024 18:01                5318
directoryiterator.tostring.php                     30-May-2024 18:01                4654
directoryiterator.valid.php                        30-May-2024 18:01                5786
doc.changelog.php                                  30-May-2024 18:01                1332
dom.configuration.php                              30-May-2024 18:01                1270
dom.constants.php                                  30-May-2024 18:01               19988
dom.examples.php                                   30-May-2024 18:01                2986
dom.installation.php                               30-May-2024 18:01                1347
dom.requirements.php                               30-May-2024 18:01                1527
dom.resources.php                                  30-May-2024 18:01                1213
dom.setup.php                                      30-May-2024 18:01                1599
domattr.construct.php                              30-May-2024 18:01                5608
domattr.isid.php                                   30-May-2024 18:01                5054
domcdatasection.construct.php                      30-May-2024 18:01                5187
domcharacterdata.after.php                         30-May-2024 18:01                7842
domcharacterdata.appenddata.php                    30-May-2024 18:01                4396
domcharacterdata.before.php                        30-May-2024 18:01                7463
domcharacterdata.deletedata.php                    30-May-2024 18:01                5095
domcharacterdata.insertdata.php                    30-May-2024 18:01                4819
domcharacterdata.remove.php                        30-May-2024 18:01                5432
domcharacterdata.replacedata.php                   30-May-2024 18:01                5487
domcharacterdata.replacewith.php                   30-May-2024 18:01                7919
domcharacterdata.substringdata.php                 30-May-2024 18:01                4926
domchildnode.after.php                             30-May-2024 18:01                5746
domchildnode.before.php                            30-May-2024 18:01                5165
domchildnode.remove.php                            30-May-2024 18:01                3125
domchildnode.replacewith.php                       30-May-2024 18:01                5357
domcomment.construct.php                           30-May-2024 18:01                5002
domdocument.adoptnode.php                          30-May-2024 18:01                6729
domdocument.append.php                             30-May-2024 18:01                6886
domdocument.construct.php                          30-May-2024 18:01                4390
domdocument.createattribute.php                    30-May-2024 18:01                5879
domdocument.createattributens.php                  30-May-2024 18:01                8190
domdocument.createcdatasection.php                 30-May-2024 18:01                5490
domdocument.createcomment.php                      30-May-2024 18:01                5865
domdocument.createdocumentfragment.php             30-May-2024 18:01                5700
domdocument.createelement.php                      30-May-2024 18:01               11351
domdocument.createelementns.php                    30-May-2024 18:01               14072
domdocument.createentityreference.php              30-May-2024 18:01                6196
domdocument.createprocessinginstruction.php        30-May-2024 18:01                6516
domdocument.createtextnode.php                     30-May-2024 18:01                5853
domdocument.getelementbyid.php                     30-May-2024 18:01                7699
domdocument.getelementsbytagname.php               30-May-2024 18:01                6062
domdocument.getelementsbytagnamens.php             30-May-2024 18:01                7697
domdocument.importnode.php                         30-May-2024 18:01                8958
domdocument.load.php                               30-May-2024 18:01                6621
domdocument.loadhtml.php                           30-May-2024 18:01                7848
domdocument.loadhtmlfile.php                       30-May-2024 18:01                7967
domdocument.loadxml.php                            30-May-2024 18:01                6335
domdocument.normalizedocument.php                  30-May-2024 18:01                2986
domdocument.prepend.php                            30-May-2024 18:01                6978
domdocument.registernodeclass.php                  30-May-2024 18:01               20858
domdocument.relaxngvalidate.php                    30-May-2024 18:01                4052
domdocument.relaxngvalidatesource.php              30-May-2024 18:01                4107
domdocument.replacechildren.php                    30-May-2024 18:01                7275                               30-May-2024 18:01                7603
domdocument.savehtml.php                           30-May-2024 18:01                7538
domdocument.savehtmlfile.php                       30-May-2024 18:01                7979
domdocument.savexml.php                            30-May-2024 18:01                9738
domdocument.schemavalidate.php                     30-May-2024 18:01                4438
domdocument.schemavalidatesource.php               30-May-2024 18:01                4500
domdocument.validate.php                           30-May-2024 18:01                6080
domdocument.xinclude.php                           30-May-2024 18:01                7195
domdocumentfragment.append.php                     30-May-2024 18:01                7576
domdocumentfragment.appendxml.php                  30-May-2024 18:01                5603
domdocumentfragment.construct.php                  30-May-2024 18:01                2160
domdocumentfragment.prepend.php                    30-May-2024 18:01                7634
domdocumentfragment.replacechildren.php            30-May-2024 18:01                8019
domelement.after.php                               30-May-2024 18:01                7520
domelement.append.php                              30-May-2024 18:01                7198
domelement.before.php                              30-May-2024 18:01                7098
domelement.construct.php                           30-May-2024 18:01                6678
domelement.getattribute.php                        30-May-2024 18:01                3550
domelement.getattributenames.php                   30-May-2024 18:01                3998
domelement.getattributenode.php                    30-May-2024 18:01                4099
domelement.getattributenodens.php                  30-May-2024 18:01                4589
domelement.getattributens.php                      30-May-2024 18:01                4092
domelement.getelementsbytagname.php                30-May-2024 18:01                3657
domelement.getelementsbytagnamens.php              30-May-2024 18:01                4740
domelement.hasattribute.php                        30-May-2024 18:01                3856
domelement.hasattributens.php                      30-May-2024 18:01                4328
domelement.insertadjacentelement.php               30-May-2024 18:01                6672
domelement.insertadjacenttext.php                  30-May-2024 18:01                6494
domelement.prepend.php                             30-May-2024 18:01                7248
domelement.remove.php                              30-May-2024 18:01                5075
domelement.removeattribute.php                     30-May-2024 18:01                4072
domelement.removeattributenode.php                 30-May-2024 18:01                4483
domelement.removeattributens.php                   30-May-2024 18:01                4348
domelement.replacechildren.php                     30-May-2024 18:01                7839
domelement.replacewith.php                         30-May-2024 18:01                7903
domelement.setattribute.php                        30-May-2024 18:01                6212
domelement.setattributenode.php                    30-May-2024 18:01                4763
domelement.setattributenodens.php                  30-May-2024 18:01                4830
domelement.setattributens.php                      30-May-2024 18:01                5277
domelement.setidattribute.php                      30-May-2024 18:01                4866
domelement.setidattributenode.php                  30-May-2024 18:01                4860
domelement.setidattributens.php                    30-May-2024 18:01                5318
domelement.toggleattribute.php                     30-May-2024 18:01                6452
domentityreference.construct.php                   30-May-2024 18:01                4844
domimplementation.construct.php                    30-May-2024 18:01                2170
domimplementation.createdocument.php               30-May-2024 18:01                7363
domimplementation.createdocumenttype.php           30-May-2024 18:01                9893
domimplementation.hasfeature.php                   30-May-2024 18:01                9295
domnamednodemap.count.php                          30-May-2024 18:01                2445
domnamednodemap.getiterator.php                    30-May-2024 18:01                3227
domnamednodemap.getnameditem.php                   30-May-2024 18:01                3478
domnamednodemap.getnameditemns.php                 30-May-2024 18:01                3930
domnamednodemap.item.php                           30-May-2024 18:01                3081
domnode.appendchild.php                            30-May-2024 18:01                8719
domnode.c14n.php                                   30-May-2024 18:01                8051
domnode.c14nfile.php                               30-May-2024 18:01                5786
domnode.clonenode.php                              30-May-2024 18:01                2854
domnode.contains.php                               30-May-2024 18:01                5387
domnode.getlineno.php                              30-May-2024 18:01                4904
domnode.getnodepath.php                            30-May-2024 18:01                5255
domnode.getrootnode.php                            30-May-2024 18:01                4430
domnode.hasattributes.php                          30-May-2024 18:01                2992
domnode.haschildnodes.php                          30-May-2024 18:01                2856
domnode.insertbefore.php                           30-May-2024 18:01                5483
domnode.isdefaultnamespace.php                     30-May-2024 18:01                2942
domnode.isequalnode.php                            30-May-2024 18:01                4726
domnode.issamenode.php                             30-May-2024 18:01                2815
domnode.issupported.php                            30-May-2024 18:01                3840
domnode.lookupnamespaceuri.php                     30-May-2024 18:01                3595
domnode.lookupprefix.php                           30-May-2024 18:01                3233
domnode.normalize.php                              30-May-2024 18:01                2832
domnode.removechild.php                            30-May-2024 18:01                7061
domnode.replacechild.php                           30-May-2024 18:01                5731
domnodelist.count.php                              30-May-2024 18:01                2374
domnodelist.getiterator.php                        30-May-2024 18:01                3130
domnodelist.item.php                               30-May-2024 18:01                7002
domparentnode.append.php                           30-May-2024 18:01                4841
domparentnode.prepend.php                          30-May-2024 18:01                4881
domparentnode.replacechildren.php                  30-May-2024 18:01                6709
domprocessinginstruction.construct.php             30-May-2024 18:01                6711
domtext.construct.php                              30-May-2024 18:01                4800
domtext.iselementcontentwhitespace.php             30-May-2024 18:01                2673
domtext.iswhitespaceinelementcontent.php           30-May-2024 18:01                2860
domtext.splittext.php                              30-May-2024 18:01                3250
domxpath.construct.php                             30-May-2024 18:01                3620
domxpath.evaluate.php                              30-May-2024 18:01                8035
domxpath.query.php                                 30-May-2024 18:01               12500
domxpath.registernamespace.php                     30-May-2024 18:01                3333
domxpath.registerphpfunctions.php                  30-May-2024 18:01               13810
dotnet.construct.php                               30-May-2024 18:01                3133
ds-collection.clear.php                            30-May-2024 18:01                3950
ds-collection.copy.php                             30-May-2024 18:01                4348
ds-collection.isempty.php                          30-May-2024 18:01                4276
ds-collection.toarray.php                          30-May-2024 18:01                4144
ds-deque.allocate.php                              30-May-2024 18:01                4704
ds-deque.apply.php                                 30-May-2024 18:01                4998
ds-deque.capacity.php                              30-May-2024 18:01                3975
ds-deque.clear.php                                 30-May-2024 18:01                3867
ds-deque.construct.php                             30-May-2024 18:01                4277
ds-deque.contains.php                              30-May-2024 18:01                7109
ds-deque.copy.php                                  30-May-2024 18:01                4214
ds-deque.count.php                                 30-May-2024 18:01                1626
ds-deque.filter.php                                30-May-2024 18:01                7647
ds-deque.find.php                                  30-May-2024 18:01                5449
ds-deque.first.php                                 30-May-2024 18:01                3784
ds-deque.get.php                                   30-May-2024 18:01                6622
ds-deque.insert.php                                30-May-2024 18:01                6698
ds-deque.isempty.php                               30-May-2024 18:01                4162
ds-deque.join.php                                  30-May-2024 18:01                5772
ds-deque.jsonserialize.php                         30-May-2024 18:01                1883
ds-deque.last.php                                  30-May-2024 18:01                3772                                   30-May-2024 18:01                5345
ds-deque.merge.php                                 30-May-2024 18:01                4863
ds-deque.pop.php                                   30-May-2024 18:01                4269
ds-deque.push.php                                  30-May-2024 18:01                4702
ds-deque.reduce.php                                30-May-2024 18:01                8026
ds-deque.remove.php                                30-May-2024 18:01                4890
ds-deque.reverse.php                               30-May-2024 18:01                3703
ds-deque.reversed.php                              30-May-2024 18:01                4042
ds-deque.rotate.php                                30-May-2024 18:01                5088
ds-deque.set.php                                   30-May-2024 18:01                6104
ds-deque.shift.php                                 30-May-2024 18:01                4370
ds-deque.slice.php                                 30-May-2024 18:01                7170
ds-deque.sort.php                                  30-May-2024 18:01                7469
ds-deque.sorted.php                                30-May-2024 18:01                7481
ds-deque.sum.php                                   30-May-2024 18:01                5300
ds-deque.toarray.php                               30-May-2024 18:01                4030
ds-deque.unshift.php                               30-May-2024 18:01                4784
ds-hashable.equals.php                             30-May-2024 18:01                3711
ds-hashable.hash.php                               30-May-2024 18:01                7479
ds-map.allocate.php                                30-May-2024 18:01                4570
ds-map.apply.php                                   30-May-2024 18:01                5694
ds-map.capacity.php                                30-May-2024 18:01                3265
ds-map.clear.php                                   30-May-2024 18:01                4343
ds-map.construct.php                               30-May-2024 18:01                4779
ds-map.copy.php                                    30-May-2024 18:01                4074
ds-map.count.php                                   30-May-2024 18:01                1587
ds-map.diff.php                                    30-May-2024 18:01                5470
ds-map.filter.php                                  30-May-2024 18:01                8431
ds-map.first.php                                   30-May-2024 18:01                4083
ds-map.get.php                                     30-May-2024 18:01                8449
ds-map.haskey.php                                  30-May-2024 18:01                4705
ds-map.hasvalue.php                                30-May-2024 18:01                4749
ds-map.intersect.php                               30-May-2024 18:01                5994
ds-map.isempty.php                                 30-May-2024 18:01                4384
ds-map.jsonserialize.php                           30-May-2024 18:01                1861
ds-map.keys.php                                    30-May-2024 18:01                3975
ds-map.ksort.php                                   30-May-2024 18:01                8156
ds-map.ksorted.php                                 30-May-2024 18:01                8230
ds-map.last.php                                    30-May-2024 18:01                4068                                     30-May-2024 18:01                6326
ds-map.merge.php                                   30-May-2024 18:01                5782
ds-map.pairs.php                                   30-May-2024 18:01                4390
ds-map.put.php                                     30-May-2024 18:01               13984
ds-map.putall.php                                  30-May-2024 18:01                5506
ds-map.reduce.php                                  30-May-2024 18:01                8961
ds-map.remove.php                                  30-May-2024 18:01                6992
ds-map.reverse.php                                 30-May-2024 18:01                4155
ds-map.reversed.php                                30-May-2024 18:01                4252
ds-map.skip.php                                    30-May-2024 18:01                4640
ds-map.slice.php                                   30-May-2024 18:01                8022
ds-map.sort.php                                    30-May-2024 18:01                8079
ds-map.sorted.php                                  30-May-2024 18:01                8209
ds-map.sum.php                                     30-May-2024 18:01                5767
ds-map.toarray.php                                 30-May-2024 18:01                4963
ds-map.union.php                                   30-May-2024 18:01                5978
ds-map.values.php                                  30-May-2024 18:01                3974
ds-map.xor.php                                     30-May-2024 18:01                5536
ds-pair.clear.php                                  30-May-2024 18:01                3772
ds-pair.construct.php                              30-May-2024 18:01                2609
ds-pair.copy.php                                   30-May-2024 18:01                4128
ds-pair.isempty.php                                30-May-2024 18:01                4112
ds-pair.jsonserialize.php                          30-May-2024 18:01                1881
ds-pair.toarray.php                                30-May-2024 18:01                3964
ds-priorityqueue.allocate.php                      30-May-2024 18:01                4870
ds-priorityqueue.capacity.php                      30-May-2024 18:01                3474
ds-priorityqueue.clear.php                         30-May-2024 18:01                4524
ds-priorityqueue.construct.php                     30-May-2024 18:01                2944
ds-priorityqueue.copy.php                          30-May-2024 18:01                4517
ds-priorityqueue.count.php                         30-May-2024 18:01                1735
ds-priorityqueue.isempty.php                       30-May-2024 18:01                5072
ds-priorityqueue.jsonserialize.php                 30-May-2024 18:01                2001
ds-priorityqueue.peek.php                          30-May-2024 18:01                4762
ds-priorityqueue.pop.php                           30-May-2024 18:01                5535
ds-priorityqueue.push.php                          30-May-2024 18:01                5628
ds-priorityqueue.toarray.php                       30-May-2024 18:01                5132
ds-queue.allocate.php                              30-May-2024 18:01                4900
ds-queue.capacity.php                              30-May-2024 18:01                3981
ds-queue.clear.php                                 30-May-2024 18:01                3852
ds-queue.construct.php                             30-May-2024 18:01                4275
ds-queue.copy.php                                  30-May-2024 18:01                4316
ds-queue.count.php                                 30-May-2024 18:01                1623
ds-queue.isempty.php                               30-May-2024 18:01                4178
ds-queue.jsonserialize.php                         30-May-2024 18:01                1889
ds-queue.peek.php                                  30-May-2024 18:01                4366
ds-queue.pop.php                                   30-May-2024 18:01                4900
ds-queue.push.php                                  30-May-2024 18:01                4737
ds-queue.toarray.php                               30-May-2024 18:01                4197
ds-sequence.allocate.php                           30-May-2024 18:01                4605
ds-sequence.apply.php                              30-May-2024 18:01                5113
ds-sequence.capacity.php                           30-May-2024 18:01                4530
ds-sequence.contains.php                           30-May-2024 18:01                7236
ds-sequence.filter.php                             30-May-2024 18:01                7786
ds-sequence.find.php                               30-May-2024 18:01                5561
ds-sequence.first.php                              30-May-2024 18:01                3899
ds-sequence.get.php                                30-May-2024 18:01                6750
ds-sequence.insert.php                             30-May-2024 18:01                6817
ds-sequence.join.php                               30-May-2024 18:01                5868
ds-sequence.last.php                               30-May-2024 18:01                3866                                30-May-2024 18:01                5474
ds-sequence.merge.php                              30-May-2024 18:01                4989
ds-sequence.pop.php                                30-May-2024 18:01                4381
ds-sequence.push.php                               30-May-2024 18:01                4824
ds-sequence.reduce.php                             30-May-2024 18:01                8145
ds-sequence.remove.php                             30-May-2024 18:01                5002
ds-sequence.reverse.php                            30-May-2024 18:01                3816
ds-sequence.reversed.php                           30-May-2024 18:01                4165
ds-sequence.rotate.php                             30-May-2024 18:01                5225
ds-sequence.set.php                                30-May-2024 18:01                6228
ds-sequence.shift.php                              30-May-2024 18:01                4482
ds-sequence.slice.php                              30-May-2024 18:01                7335
ds-sequence.sort.php                               30-May-2024 18:01                7596
ds-sequence.sorted.php                             30-May-2024 18:01                7608
ds-sequence.sum.php                                30-May-2024 18:01                5425
ds-sequence.unshift.php                            30-May-2024 18:01                4895
ds-set.add.php                                     30-May-2024 18:01               12214
ds-set.allocate.php                                30-May-2024 18:01                4579
ds-set.capacity.php                                30-May-2024 18:01                3933
ds-set.clear.php                                   30-May-2024 18:01                3798
ds-set.construct.php                               30-May-2024 18:01                4229
ds-set.contains.php                                30-May-2024 18:01                7305
ds-set.copy.php                                    30-May-2024 18:01                4255
ds-set.count.php                                   30-May-2024 18:01                1587
ds-set.diff.php                                    30-May-2024 18:01                4760
ds-set.filter.php                                  30-May-2024 18:01                7595
ds-set.first.php                                   30-May-2024 18:01                3737
ds-set.get.php                                     30-May-2024 18:01                6566
ds-set.intersect.php                               30-May-2024 18:01                4991
ds-set.isempty.php                                 30-May-2024 18:01                4120
ds-set.join.php                                    30-May-2024 18:01                5718
ds-set.jsonserialize.php                           30-May-2024 18:01                1855
ds-set.last.php                                    30-May-2024 18:01                3738
ds-set.merge.php                                   30-May-2024 18:01                4789
ds-set.reduce.php                                  30-May-2024 18:01                7972
ds-set.remove.php                                  30-May-2024 18:01                5008
ds-set.reverse.php                                 30-May-2024 18:01                3651
ds-set.reversed.php                                30-May-2024 18:01                3980
ds-set.slice.php                                   30-May-2024 18:01                7084
ds-set.sort.php                                    30-May-2024 18:01                7405
ds-set.sorted.php                                  30-May-2024 18:01                7417
ds-set.sum.php                                     30-May-2024 18:01                5240
ds-set.toarray.php                                 30-May-2024 18:01                3976
ds-set.union.php                                   30-May-2024 18:01                4954
ds-set.xor.php                                     30-May-2024 18:01                4930
ds-stack.allocate.php                              30-May-2024 18:01                2876
ds-stack.capacity.php                              30-May-2024 18:01                2203
ds-stack.clear.php                                 30-May-2024 18:01                3848
ds-stack.construct.php                             30-May-2024 18:01                4241
ds-stack.copy.php                                  30-May-2024 18:01                4316
ds-stack.count.php                                 30-May-2024 18:01                1623
ds-stack.isempty.php                               30-May-2024 18:01                4178
ds-stack.jsonserialize.php                         30-May-2024 18:01                1889
ds-stack.peek.php                                  30-May-2024 18:01                4360
ds-stack.pop.php                                   30-May-2024 18:01                4894
ds-stack.push.php                                  30-May-2024 18:01                4737
ds-stack.toarray.php                               30-May-2024 18:01                4021
ds-vector.allocate.php                             30-May-2024 18:01                4522
ds-vector.apply.php                                30-May-2024 18:01                5024
ds-vector.capacity.php                             30-May-2024 18:01                4435
ds-vector.clear.php                                30-May-2024 18:01                3879
ds-vector.construct.php                            30-May-2024 18:01                4309
ds-vector.contains.php                             30-May-2024 18:01                7139
ds-vector.copy.php                                 30-May-2024 18:01                4340
ds-vector.count.php                                30-May-2024 18:01                1640
ds-vector.filter.php                               30-May-2024 18:01                7681
ds-vector.find.php                                 30-May-2024 18:01                5474
ds-vector.first.php                                30-May-2024 18:01                3810
ds-vector.get.php                                  30-May-2024 18:01                6653
ds-vector.insert.php                               30-May-2024 18:01                6728
ds-vector.isempty.php                              30-May-2024 18:01                4186
ds-vector.join.php                                 30-May-2024 18:01                5799
ds-vector.jsonserialize.php                        30-May-2024 18:01                1897
ds-vector.last.php                                 30-May-2024 18:01                3797                                  30-May-2024 18:01                5377
ds-vector.merge.php                                30-May-2024 18:01                4894
ds-vector.pop.php                                  30-May-2024 18:01                4294
ds-vector.push.php                                 30-May-2024 18:01                4731
ds-vector.reduce.php                               30-May-2024 18:01                8054
ds-vector.remove.php                               30-May-2024 18:01                4915
ds-vector.reverse.php                              30-May-2024 18:01                3729
ds-vector.reversed.php                             30-May-2024 18:01                4072
ds-vector.rotate.php                               30-May-2024 18:01                5122
ds-vector.set.php                                  30-May-2024 18:01                6135
ds-vector.shift.php                                30-May-2024 18:01                4395
ds-vector.slice.php                                30-May-2024 18:01                7216
ds-vector.sort.php                                 30-May-2024 18:01                7501
ds-vector.sorted.php                               30-May-2024 18:01                7513
ds-vector.sum.php                                  30-May-2024 18:01                5330
ds-vector.toarray.php                              30-May-2024 18:01                4055
ds-vector.unshift.php                              30-May-2024 18:01                4814
ds.constants.php                                   30-May-2024 18:01                1183
ds.examples.php                                    30-May-2024 18:01                4756
ds.installation.php                                30-May-2024 18:01                2533
ds.requirements.php                                30-May-2024 18:01                1224
ds.setup.php                                       30-May-2024 18:01                1457
eio.configuration.php                              30-May-2024 18:01                1268
eio.constants.php                                  30-May-2024 18:01               21880
eio.examples.php                                   30-May-2024 18:01               27147
eio.installation.php                               30-May-2024 18:01                1719
eio.requirements.php                               30-May-2024 18:01                1344
eio.resources.php                                  30-May-2024 18:01                1253
eio.setup.php                                      30-May-2024 18:01                1611
emptyiterator.current.php                          30-May-2024 18:01                2779
emptyiterator.key.php                              30-May-2024 18:01                2743                             30-May-2024 18:01                2441
emptyiterator.rewind.php                           30-May-2024 18:01                2463
emptyiterator.valid.php                            30-May-2024 18:01                2759
enchant.configuration.php                          30-May-2024 18:01                1298
enchant.constants.php                              30-May-2024 18:01                2958
enchant.examples.php                               30-May-2024 18:01                5446
enchant.installation.php                           30-May-2024 18:01                3175
enchant.requirements.php                           30-May-2024 18:01                1827
enchant.resources.php                              30-May-2024 18:01                1360
enchant.setup.php                                  30-May-2024 18:01                1656
error.clone.php                                    30-May-2024 18:01                2868
error.construct.php                                30-May-2024 18:01                3485
error.getcode.php                                  30-May-2024 18:01                4086
error.getfile.php                                  30-May-2024 18:01                3826
error.getline.php                                  30-May-2024 18:01                4050
error.getmessage.php                               30-May-2024 18:01                3900
error.getprevious.php                              30-May-2024 18:01                6664
error.gettrace.php                                 30-May-2024 18:01                4358
error.gettraceasstring.php                         30-May-2024 18:01                4136
error.tostring.php                                 30-May-2024 18:01                4102
errorexception.construct.php                       30-May-2024 18:01                6262
errorexception.getseverity.php                     30-May-2024 18:01                4404
errorfunc.configuration.php                        30-May-2024 18:01               25128
errorfunc.constants.php                            30-May-2024 18:01               12218
errorfunc.examples.php                             30-May-2024 18:01               19311
errorfunc.installation.php                         30-May-2024 18:01                1296
errorfunc.requirements.php                         30-May-2024 18:01                1272
errorfunc.resources.php                            30-May-2024 18:01                1255
errorfunc.setup.php                                30-May-2024 18:01                1673
ev.backend.php                                     30-May-2024 18:01                3410
ev.configuration.php                               30-May-2024 18:01                1263
ev.depth.php                                       30-May-2024 18:01                3280
ev.embeddablebackends.php                          30-May-2024 18:01                6481
ev.examples.php                                    30-May-2024 18:01               41851
ev.feedsignal.php                                  30-May-2024 18:01                3408
ev.feedsignalevent.php                             30-May-2024 18:01                3195                            30-May-2024 18:01                1338
ev.installation.php                                30-May-2024 18:01                1711
ev.iteration.php                                   30-May-2024 18:01                2656                                         30-May-2024 18:01                3127
ev.nowupdate.php                                   30-May-2024 18:01                3216
ev.periodic-modes.php                              30-May-2024 18:01                7687
ev.recommendedbackends.php                         30-May-2024 18:01                7173
ev.requirements.php                                30-May-2024 18:01                1279
ev.resources.php                                   30-May-2024 18:01                1213
ev.resume.php                                      30-May-2024 18:01                3738                                         30-May-2024 18:01                5106
ev.setup.php                                       30-May-2024 18:01                1566
ev.sleep.php                                       30-May-2024 18:01                2469
ev.stop.php                                        30-May-2024 18:01                2907
ev.supportedbackends.php                           30-May-2024 18:01                6463
ev.suspend.php                                     30-May-2024 18:01                3505
ev.time.php                                        30-May-2024 18:01                2701
ev.verify.php                                      30-May-2024 18:01                2298
ev.watcher-callbacks.php                           30-May-2024 18:01                4559
ev.watchers.php                                    30-May-2024 18:01                3480
evcheck.construct.php                              30-May-2024 18:01                3676
evcheck.createstopped.php                          30-May-2024 18:01                3783
evchild.construct.php                              30-May-2024 18:01                6753
evchild.createstopped.php                          30-May-2024 18:01                5154
evchild.set.php                                    30-May-2024 18:01                3244
evembed.construct.php                              30-May-2024 18:01                7971
evembed.createstopped.php                          30-May-2024 18:01                4796
evembed.set.php                                    30-May-2024 18:01                2593
evembed.sweep.php                                  30-May-2024 18:01                3101
event.add.php                                      30-May-2024 18:01               10352
event.addsignal.php                                30-May-2024 18:01                1698
event.addtimer.php                                 30-May-2024 18:01                1707
event.callbacks.php                                30-May-2024 18:01                5714
event.configuration.php                            30-May-2024 18:01                1284
event.construct.php                                30-May-2024 18:01                4604               30-May-2024 18:01                6076
event.del.php                                      30-May-2024 18:01                2677
event.delsignal.php                                30-May-2024 18:01                1698
event.deltimer.php                                 30-May-2024 18:01                1695
event.examples.php                                 30-May-2024 18:01              165115
event.flags.php                                    30-May-2024 18:01                2641                                     30-May-2024 18:01                3060
event.getsupportedmethods.php                      30-May-2024 18:01                2698
event.installation.php                             30-May-2024 18:01                1738
event.pending.php                                  30-May-2024 18:01                3147
event.persistence.php                              30-May-2024 18:01                2968
event.requirements.php                             30-May-2024 18:01                1497
event.resources.php                                30-May-2024 18:01                1211
event.set.php                                      30-May-2024 18:01                4739
event.setpriority.php                              30-May-2024 18:01                2655
event.settimer.php                                 30-May-2024 18:01                4166
event.setup.php                                    30-May-2024 18:01                1605
event.signal.php                                   30-May-2024 18:01                4336
event.timer.php                                    30-May-2024 18:01                3628
eventbase.construct.php                            30-May-2024 18:01                3078
eventbase.dispatch.php                             30-May-2024 18:01                3371
eventbase.exit.php                                 30-May-2024 18:01                3152                                 30-May-2024 18:01                3415
eventbase.getfeatures.php                          30-May-2024 18:01                5803
eventbase.getmethod.php                            30-May-2024 18:01                4601
eventbase.gettimeofdaycached.php                   30-May-2024 18:01                2771
eventbase.gotexit.php                              30-May-2024 18:01                3389
eventbase.gotstop.php                              30-May-2024 18:01                3361
eventbase.loop.php                                 30-May-2024 18:01                3695
eventbase.priorityinit.php                         30-May-2024 18:01                3129
eventbase.reinit.php                               30-May-2024 18:01                2463
eventbase.stop.php                                 30-May-2024 18:01                2930
eventbuffer.add.php                                30-May-2024 18:01                3130
eventbuffer.addbuffer.php                          30-May-2024 18:01                3482
eventbuffer.appendfrom.php                         30-May-2024 18:01                4960
eventbuffer.construct.php                          30-May-2024 18:01                2009
eventbuffer.copyout.php                            30-May-2024 18:01                4010
eventbuffer.drain.php                              30-May-2024 18:01                3605
eventbuffer.enablelocking.php                      30-May-2024 18:01                2942
eventbuffer.expand.php                             30-May-2024 18:01                2928
eventbuffer.freeze.php                             30-May-2024 18:01                3178
eventbuffer.lock.php                               30-May-2024 18:01                3067
eventbuffer.prepend.php                            30-May-2024 18:01                3605
eventbuffer.prependbuffer.php                      30-May-2024 18:01                3767
eventbuffer.pullup.php                             30-May-2024 18:01                4718                               30-May-2024 18:01                4985
eventbuffer.readfrom.php                           30-May-2024 18:01                4423
eventbuffer.readline.php                           30-May-2024 18:01                4344                             30-May-2024 18:01                8499
eventbuffer.searcheol.php                          30-May-2024 18:01                5028
eventbuffer.substr.php                             30-May-2024 18:01                3630
eventbuffer.unfreeze.php                           30-May-2024 18:01                3192
eventbuffer.unlock.php                             30-May-2024 18:01                2905
eventbuffer.write.php                              30-May-2024 18:01                3586
eventbufferevent.about.callbacks.php               30-May-2024 18:01                6179
eventbufferevent.close.php                         30-May-2024 18:01                2633
eventbufferevent.connect.php                       30-May-2024 18:01               24000
eventbufferevent.connecthost.php                   30-May-2024 18:01               17886
eventbufferevent.construct.php                     30-May-2024 18:01                6926
eventbufferevent.createpair.php                    30-May-2024 18:01                4378
eventbufferevent.disable.php                       30-May-2024 18:01                3633
eventbufferevent.enable.php                        30-May-2024 18:01                4103                          30-May-2024 18:01                2854
eventbufferevent.getdnserrorstring.php             30-May-2024 18:01                3168
eventbufferevent.getenabled.php                    30-May-2024 18:01                3117
eventbufferevent.getinput.php                      30-May-2024 18:01                5061
eventbufferevent.getoutput.php                     30-May-2024 18:01                7942                          30-May-2024 18:01                3132
eventbufferevent.readbuffer.php                    30-May-2024 18:01                3319
eventbufferevent.setcallbacks.php                  30-May-2024 18:01                4631
eventbufferevent.setpriority.php                   30-May-2024 18:01                3038
eventbufferevent.settimeouts.php                   30-May-2024 18:01                3262
eventbufferevent.setwatermark.php                  30-May-2024 18:01                4165
eventbufferevent.sslerror.php                      30-May-2024 18:01                5946
eventbufferevent.sslfilter.php                     30-May-2024 18:01               34555
eventbufferevent.sslgetcipherinfo.php              30-May-2024 18:01                2984
eventbufferevent.sslgetciphername.php              30-May-2024 18:01                2887
eventbufferevent.sslgetcipherversion.php           30-May-2024 18:01                2916
eventbufferevent.sslgetprotocol.php                30-May-2024 18:01                2793
eventbufferevent.sslrenegotiate.php                30-May-2024 18:01                2890
eventbufferevent.sslsocket.php                     30-May-2024 18:01                5955
eventbufferevent.write.php                         30-May-2024 18:01                3347
eventbufferevent.writebuffer.php                   30-May-2024 18:01                3456
eventconfig.avoidmethod.php                        30-May-2024 18:01                4479
eventconfig.construct.php                          30-May-2024 18:01                4103
eventconfig.requirefeatures.php                    30-May-2024 18:01                6088
eventconfig.setflags.php                           30-May-2024 18:01                3432
eventconfig.setmaxdispatchinterval.php             30-May-2024 18:01                4633
eventdnsbase.addnameserverip.php                   30-May-2024 18:01                3064
eventdnsbase.addsearch.php                         30-May-2024 18:01                2623
eventdnsbase.clearsearch.php                       30-May-2024 18:01                2873
eventdnsbase.construct.php                         30-May-2024 18:01                7576
eventdnsbase.countnameservers.php                  30-May-2024 18:01                2597
eventdnsbase.loadhosts.php                         30-May-2024 18:01                2937
eventdnsbase.parseresolvconf.php                   30-May-2024 18:01                4313
eventdnsbase.setoption.php                         30-May-2024 18:01                3511
eventdnsbase.setsearchndots.php                    30-May-2024 18:01                3000
eventhttp.accept.php                               30-May-2024 18:01               12491
eventhttp.addserveralias.php                       30-May-2024 18:01                6521
eventhttp.bind.php                                 30-May-2024 18:01                7951
eventhttp.construct.php                            30-May-2024 18:01               17458
eventhttp.removeserveralias.php                    30-May-2024 18:01                3325
eventhttp.setallowedmethods.php                    30-May-2024 18:01                3462
eventhttp.setcallback.php                          30-May-2024 18:01               18150
eventhttp.setdefaultcallback.php                   30-May-2024 18:01                7939
eventhttp.setmaxbodysize.php                       30-May-2024 18:01                2975
eventhttp.setmaxheaderssize.php                    30-May-2024 18:01                2887
eventhttp.settimeout.php                           30-May-2024 18:01                2576
eventhttpconnection.construct.php                  30-May-2024 18:01                5168
eventhttpconnection.getbase.php                    30-May-2024 18:01                2672
eventhttpconnection.getpeer.php                    30-May-2024 18:01                3092
eventhttpconnection.makerequest.php                30-May-2024 18:01               11758
eventhttpconnection.setclosecallback.php           30-May-2024 18:01                9499
eventhttpconnection.setlocaladdress.php            30-May-2024 18:01                3274
eventhttpconnection.setlocalport.php               30-May-2024 18:01                3153
eventhttpconnection.setmaxbodysize.php             30-May-2024 18:01                3199
eventhttpconnection.setmaxheaderssize.php          30-May-2024 18:01                3220
eventhttpconnection.setretries.php                 30-May-2024 18:01                2806
eventhttpconnection.settimeout.php                 30-May-2024 18:01                2703
eventhttprequest.addheader.php                     30-May-2024 18:01                4047
eventhttprequest.cancel.php                        30-May-2024 18:01                2908
eventhttprequest.clearheaders.php                  30-May-2024 18:01                2858
eventhttprequest.closeconnection.php               30-May-2024 18:01                2463
eventhttprequest.construct.php                     30-May-2024 18:01               11462
eventhttprequest.findheader.php                    30-May-2024 18:01                3595                          30-May-2024 18:01                2371
eventhttprequest.getbufferevent.php                30-May-2024 18:01                3730
eventhttprequest.getcommand.php                    30-May-2024 18:01                2736
eventhttprequest.getconnection.php                 30-May-2024 18:01                4484
eventhttprequest.gethost.php                       30-May-2024 18:01                2911
eventhttprequest.getinputbuffer.php                30-May-2024 18:01                2813
eventhttprequest.getinputheaders.php               30-May-2024 18:01                2904
eventhttprequest.getoutputbuffer.php               30-May-2024 18:01                2872
eventhttprequest.getoutputheaders.php              30-May-2024 18:01                2855
eventhttprequest.getresponsecode.php               30-May-2024 18:01                3191
eventhttprequest.geturi.php                        30-May-2024 18:01                3104
eventhttprequest.removeheader.php                  30-May-2024 18:01                3555
eventhttprequest.senderror.php                     30-May-2024 18:01                5904
eventhttprequest.sendreply.php                     30-May-2024 18:01                4110
eventhttprequest.sendreplychunk.php                30-May-2024 18:01                3482
eventhttprequest.sendreplyend.php                  30-May-2024 18:01                3091
eventhttprequest.sendreplystart.php                30-May-2024 18:01                4369
eventlistener.construct.php                        30-May-2024 18:01               22459
eventlistener.disable.php                          30-May-2024 18:01                2881
eventlistener.enable.php                           30-May-2024 18:01                2867
eventlistener.getbase.php                          30-May-2024 18:01                2375
eventlistener.getsocketname.php                    30-May-2024 18:01                3432
eventlistener.setcallback.php                      30-May-2024 18:01                6084
eventlistener.seterrorcallback.php                 30-May-2024 18:01                4444
eventsslcontext.construct.php                      30-May-2024 18:01                5341
eventutil.construct.php                            30-May-2024 18:01                2203
eventutil.getlastsocketerrno.php                   30-May-2024 18:01                3344
eventutil.getlastsocketerror.php                   30-May-2024 18:01                3160
eventutil.getsocketfd.php                          30-May-2024 18:01                3264
eventutil.getsocketname.php                        30-May-2024 18:01                3835
eventutil.setsocketoption.php                      30-May-2024 18:01                5784
eventutil.sslrandpoll.php                          30-May-2024 18:01                2436
evfork.construct.php                               30-May-2024 18:01                3702
evfork.createstopped.php                           30-May-2024 18:01                3985
evidle.construct.php                               30-May-2024 18:01                3706
evidle.createstopped.php                           30-May-2024 18:01                4183
evio.construct.php                                 30-May-2024 18:01                4854
evio.createstopped.php                             30-May-2024 18:01                5189
evio.set.php                                       30-May-2024 18:01                2888
evloop.backend.php                                 30-May-2024 18:01                2757
evloop.check.php                                   30-May-2024 18:01                3340
evloop.child.php                                   30-May-2024 18:01                3822
evloop.construct.php                               30-May-2024 18:01                4073
evloop.defaultloop.php                             30-May-2024 18:01                4669
evloop.embed.php                                   30-May-2024 18:01                3865
evloop.fork.php                                    30-May-2024 18:01                3422
evloop.idle.php                                    30-May-2024 18:01                3442
evloop.invokepending.php                           30-May-2024 18:01                2278                                      30-May-2024 18:01                3878
evloop.loopfork.php                                30-May-2024 18:01                2616                                     30-May-2024 18:01                2871
evloop.nowupdate.php                               30-May-2024 18:01                3195
evloop.periodic.php                                30-May-2024 18:01                4016
evloop.prepare.php                                 30-May-2024 18:01                3440
evloop.resume.php                                  30-May-2024 18:01                2855                                     30-May-2024 18:01                5089
evloop.signal.php                                  30-May-2024 18:01                3745
evloop.stat.php                                    30-May-2024 18:01                3926
evloop.stop.php                                    30-May-2024 18:01                3019
evloop.suspend.php                                 30-May-2024 18:01                2847
evloop.timer.php                                   30-May-2024 18:01                3943
evloop.verify.php                                  30-May-2024 18:01                2620
evperiodic.again.php                               30-May-2024 18:01                2610                                  30-May-2024 18:01                2676
evperiodic.construct.php                           30-May-2024 18:01               10063
evperiodic.createstopped.php                       30-May-2024 18:01                5891
evperiodic.set.php                                 30-May-2024 18:01                3245
evprepare.construct.php                            30-May-2024 18:01                3609
evprepare.createstopped.php                        30-May-2024 18:01                4346
evsignal.construct.php                             30-May-2024 18:01                5533
evsignal.createstopped.php                         30-May-2024 18:01                4871
evsignal.set.php                                   30-May-2024 18:01                2545
evstat.attr.php                                    30-May-2024 18:01                8259
evstat.construct.php                               30-May-2024 18:01                7254
evstat.createstopped.php                           30-May-2024 18:01                5247
evstat.prev.php                                    30-May-2024 18:01                2969
evstat.set.php                                     30-May-2024 18:01                2904
evstat.stat.php                                    30-May-2024 18:01                3026
evtimer.again.php                                  30-May-2024 18:01                3105
evtimer.construct.php                              30-May-2024 18:01               12707
evtimer.createstopped.php                          30-May-2024 18:01                8389
evtimer.set.php                                    30-May-2024 18:01                3061
evwatcher.clear.php                                30-May-2024 18:01                2863
evwatcher.construct.php                            30-May-2024 18:01                2144
evwatcher.feed.php                                 30-May-2024 18:01                2658
evwatcher.getloop.php                              30-May-2024 18:01                2349
evwatcher.invoke.php                               30-May-2024 18:01                2665
evwatcher.keepalive.php                            30-May-2024 18:01                5372
evwatcher.setcallback.php                          30-May-2024 18:01                2620
evwatcher.start.php                                30-May-2024 18:01                2552
evwatcher.stop.php                                 30-May-2024 18:01                2521
example.xml-external-entity.php                    30-May-2024 18:01               21398
example.xml-map-tags.php                           30-May-2024 18:01                8168
example.xml-structure.php                          30-May-2024 18:01                6257
example.xmlwriter-namespace.php                    30-May-2024 18:01                5422
example.xmlwriter-oop.php                          30-May-2024 18:01                3430
example.xmlwriter-simple.php                       30-May-2024 18:01                8678
exception.clone.php                                30-May-2024 18:01                3107
exception.construct.php                            30-May-2024 18:01                3908
exception.getcode.php                              30-May-2024 18:01                4727
exception.getfile.php                              30-May-2024 18:01                3973
exception.getline.php                              30-May-2024 18:01                4165
exception.getmessage.php                           30-May-2024 18:01                4011
exception.getprevious.php                          30-May-2024 18:01                6936
exception.gettrace.php                             30-May-2024 18:01                4481
exception.gettraceasstring.php                     30-May-2024 18:01                4231
exception.tostring.php                             30-May-2024 18:01                4218
exec.configuration.php                             30-May-2024 18:01                1277
exec.constants.php                                 30-May-2024 18:01                1229
exec.installation.php                              30-May-2024 18:01                1261
exec.requirements.php                              30-May-2024 18:01                1237
exec.resources.php                                 30-May-2024 18:01                1385
exec.setup.php                                     30-May-2024 18:01                1631
exif.configuration.php                             30-May-2024 18:01                7676
exif.constants.php                                 30-May-2024 18:01                2082
exif.installation.php                              30-May-2024 18:01                1736
exif.requirements.php                              30-May-2024 18:01                1840
exif.resources.php                                 30-May-2024 18:01                1220
exif.setup.php                                     30-May-2024 18:01                1625
expect.configuration.php                           30-May-2024 18:01                5468
expect.constants.php                               30-May-2024 18:01                3929
expect.examples-usage.php                          30-May-2024 18:01               12222
expect.examples.php                                30-May-2024 18:01                1434
expect.installation.php                            30-May-2024 18:01                2394
expect.requirements.php                            30-May-2024 18:01                1361
expect.resources.php                               30-May-2024 18:01                1464
expect.setup.php                                   30-May-2024 18:01                1649
extensions.alphabetical.php                        30-May-2024 18:01               20884
extensions.membership.php                          30-May-2024 18:01               20652
extensions.php                                     30-May-2024 18:01                1719
extensions.state.php                               30-May-2024 18:01                2878
fann.configuration.php                             30-May-2024 18:01                1277
fann.constants.php                                 30-May-2024 18:01               23653
fann.examples-1.php                                30-May-2024 18:01                8533
fann.examples.php                                  30-May-2024 18:01                1388
fann.installation.php                              30-May-2024 18:01                4922
fann.requirements.php                              30-May-2024 18:01                1205
fann.resources.php                                 30-May-2024 18:01                1174
fann.setup.php                                     30-May-2024 18:01                1596
fannconnection.construct.php                       30-May-2024 18:01                3037
fannconnection.getfromneuron.php                   30-May-2024 18:01                2402
fannconnection.gettoneuron.php                     30-May-2024 18:01                2390
fannconnection.getweight.php                       30-May-2024 18:01                2325
fannconnection.setweight.php                       30-May-2024 18:01                2977                                      30-May-2024 18:01               24695                                        30-May-2024 18:01               12487
faq.databases.php                                  30-May-2024 18:01                8315
faq.general.php                                    30-May-2024 18:01                5088
faq.html.php                                       30-May-2024 18:01               20681
faq.installation.php                               30-May-2024 18:01               26851
faq.mailinglist.php                                30-May-2024 18:01               10847
faq.misc.php                                       30-May-2024 18:01                4551
faq.obtaining.php                                  30-May-2024 18:01               11010
faq.passwords.php                                  30-May-2024 18:01               10350
faq.php                                            30-May-2024 18:01                2062
faq.using.php                                      30-May-2024 18:01               23403
fdf.configuration.php                              30-May-2024 18:01                1270
fdf.constants.php                                  30-May-2024 18:01                9166
fdf.examples.php                                   30-May-2024 18:01                7112
fdf.installation.php                               30-May-2024 18:01                3591
fdf.requirements.php                               30-May-2024 18:01                1648
fdf.resources.php                                  30-May-2024 18:01                1806
fdf.setup.php                                      30-May-2024 18:01                1605
features.commandline.differences.php               30-May-2024 18:01               12850
features.commandline.ini.php                       30-May-2024 18:01                2322
features.commandline.interactive.php               30-May-2024 18:01                9248                30-May-2024 18:01                6167
features.commandline.options.php                   30-May-2024 18:01               26914
features.commandline.php                           30-May-2024 18:01                7706
features.commandline.usage.php                     30-May-2024 18:01               14662
features.commandline.webserver.php                 30-May-2024 18:01               13668
features.connection-handling.php                   30-May-2024 18:01                6501
features.cookies.php                               30-May-2024 18:01                3226
features.dtrace.dtrace.php                         30-May-2024 18:01               14776
features.dtrace.introduction.php                   30-May-2024 18:01                3547
features.dtrace.php                                30-May-2024 18:01                1773
features.dtrace.systemtap.php                      30-May-2024 18:01                8268
features.file-upload.common-pitfalls.php           30-May-2024 18:01                5196
features.file-upload.errors.php                    30-May-2024 18:01                3956
features.file-upload.errors.seealso.php            30-May-2024 18:01                1378
features.file-upload.multiple.php                  30-May-2024 18:01                6878
features.file-upload.php                           30-May-2024 18:01                1916               30-May-2024 18:01               16156
features.file-upload.put-method.php                30-May-2024 18:01                5587
features.gc.collecting-cycles.php                  30-May-2024 18:01                8951
features.gc.performance-considerations.php         30-May-2024 18:01               14810
features.gc.php                                    30-May-2024 18:01                1888
features.gc.refcounting-basics.php                 30-May-2024 18:01               22474
features.http-auth.php                             30-May-2024 18:01               23702
features.persistent-connections.php                30-May-2024 18:01                9293
features.php                                       30-May-2024 18:01                4140
features.remote-files.php                          30-May-2024 18:01                8213           30-May-2024 18:01               27502
features.sessions.php                              30-May-2024 18:01                1478
features.xforms.php                                30-May-2024 18:01                5501
ffi-ctype.getalignment.php                         30-May-2024 18:01                2394
ffi-ctype.getarrayelementtype.php                  30-May-2024 18:01                2480
ffi-ctype.getarraylength.php                       30-May-2024 18:01                2437
ffi-ctype.getattributes.php                        30-May-2024 18:01                2413
ffi-ctype.getenumkind.php                          30-May-2024 18:01                2389
ffi-ctype.getfuncabi.php                           30-May-2024 18:01                2397
ffi-ctype.getfuncparametercount.php                30-May-2024 18:01                2503
ffi-ctype.getfuncparametertype.php                 30-May-2024 18:01                2741
ffi-ctype.getfuncreturntype.php                    30-May-2024 18:01                2462
ffi-ctype.getkind.php                              30-May-2024 18:01                2351
ffi-ctype.getname.php                              30-May-2024 18:01                2357
ffi-ctype.getpointertype.php                       30-May-2024 18:01                2406
ffi-ctype.getsize.php                              30-May-2024 18:01                2369
ffi-ctype.getstructfieldnames.php                  30-May-2024 18:01                2479
ffi-ctype.getstructfieldoffset.php                 30-May-2024 18:01                2737
ffi-ctype.getstructfieldtype.php                   30-May-2024 18:01                2699
ffi.addr.php                                       30-May-2024 18:01                2810
ffi.alignof.php                                    30-May-2024 18:01                2940
ffi.arraytype.php                                  30-May-2024 18:01                4640
ffi.cast.php                                       30-May-2024 18:01                4848
ffi.cdef.php                                       30-May-2024 18:01                4472
ffi.configuration.php                              30-May-2024 18:01                4364
ffi.constants.php                                  30-May-2024 18:01                1178
ffi.examples-basic.php                             30-May-2024 18:01               15928
ffi.examples-callback.php                          30-May-2024 18:01                4967
ffi.examples-complete.php                          30-May-2024 18:01                5354
ffi.examples.php                                   30-May-2024 18:01                1545                                       30-May-2024 18:01                2459
ffi.installation.php                               30-May-2024 18:01                1446
ffi.isnull.php                                     30-May-2024 18:01                2553
ffi.load.php                                       30-May-2024 18:01                4321
ffi.memcmp.php                                     30-May-2024 18:01                4118
ffi.memcpy.php                                     30-May-2024 18:01                3311
ffi.memset.php                                     30-May-2024 18:01                3151                                        30-May-2024 18:01                5180
ffi.requirements.php                               30-May-2024 18:01                1301
ffi.resources.php                                  30-May-2024 18:01                1213
ffi.scope.php                                      30-May-2024 18:01                3160
ffi.setup.php                                      30-May-2024 18:01                1594
ffi.sizeof.php                                     30-May-2024 18:01                2781
ffi.string.php                                     30-May-2024 18:01                4217
ffi.type.php                                       30-May-2024 18:01                3594
ffi.typeof.php                                     30-May-2024 18:01                2874
fiber.construct.php                                30-May-2024 18:01                2426
fiber.getcurrent.php                               30-May-2024 18:01                2562
fiber.getreturn.php                                30-May-2024 18:01                2661
fiber.isrunning.php                                30-May-2024 18:01                2813
fiber.isstarted.php                                30-May-2024 18:01                2396
fiber.issuspended.php                              30-May-2024 18:01                2414
fiber.isterminated.php                             30-May-2024 18:01                2498
fiber.resume.php                                   30-May-2024 18:01                3496
fiber.start.php                                    30-May-2024 18:01                3180
fiber.suspend.php                                  30-May-2024 18:01                4233
fiber.throw.php                                    30-May-2024 18:01                3349
fibererror.construct.php                           30-May-2024 18:01                2223
fileinfo.configuration.php                         30-May-2024 18:01                1305
fileinfo.constants.php                             30-May-2024 18:01                6594
fileinfo.installation.php                          30-May-2024 18:01                1800
fileinfo.requirements.php                          30-May-2024 18:01                1265
fileinfo.resources.php                             30-May-2024 18:01                1461
fileinfo.setup.php                                 30-May-2024 18:01                1671
filesystem.configuration.php                       30-May-2024 18:01                7669
filesystem.constants.php                           30-May-2024 18:01               13720
filesystem.installation.php                        30-May-2024 18:01                1303
filesystem.requirements.php                        30-May-2024 18:01                1279
filesystem.resources.php                           30-May-2024 18:01                1404
filesystem.setup.php                               30-May-2024 18:01                1698
filesystemiterator.construct.php                   30-May-2024 18:01                7571
filesystemiterator.current.php                     30-May-2024 18:01                5426
filesystemiterator.getflags.php                    30-May-2024 18:01                3226
filesystemiterator.key.php                         30-May-2024 18:01                5144                        30-May-2024 18:01                4553
filesystemiterator.rewind.php                      30-May-2024 18:01                5182
filesystemiterator.setflags.php                    30-May-2024 18:01                6708
filter.configuration.php                           30-May-2024 18:01                5294
filter.constants.php                               30-May-2024 18:01               25286
filter.examples.php                                30-May-2024 18:01                1495
filter.examples.sanitization.php                   30-May-2024 18:01                5609
filter.examples.validation.php                     30-May-2024 18:01               10215
filter.filters.flags.php                           30-May-2024 18:01               17318
filter.filters.misc.php                            30-May-2024 18:01                2003
filter.filters.php                                 30-May-2024 18:01                1677
filter.filters.sanitize.php                        30-May-2024 18:01               13937
filter.filters.validate.php                        30-May-2024 18:01               14692
filter.installation.php                            30-May-2024 18:01                1369
filter.requirements.php                            30-May-2024 18:01                1251
filter.resources.php                               30-May-2024 18:01                1219
filter.setup.php                                   30-May-2024 18:01                1635
filteriterator.accept.php                          30-May-2024 18:01                5343
filteriterator.construct.php                       30-May-2024 18:01                3117
filteriterator.current.php                         30-May-2024 18:01                3007
filteriterator.key.php                             30-May-2024 18:01                2947                            30-May-2024 18:01                2972
filteriterator.rewind.php                          30-May-2024 18:01                3150
filteriterator.valid.php                           30-May-2024 18:01                2842
filters.compression.php                            30-May-2024 18:01               15944
filters.convert.php                                30-May-2024 18:01               11803
filters.encryption.php                             30-May-2024 18:01               41294
filters.php                                        30-May-2024 18:01                3615
filters.string.php                                 30-May-2024 18:01               10104
finfo.buffer.php                                   30-May-2024 18:01                2912
finfo.construct.php                                30-May-2024 18:01                3083
finfo.file.php                                     30-May-2024 18:01                2903
finfo.set-flags.php                                30-May-2024 18:01                2117
fpm.observability.php                              30-May-2024 18:01                1429
fpm.setup.php                                      30-May-2024 18:01                1346
fpm.status.php                                     30-May-2024 18:01               10129
ftp.configuration.php                              30-May-2024 18:01                1270
ftp.constants.php                                  30-May-2024 18:01                5477
ftp.examples-basic.php                             30-May-2024 18:01                4881
ftp.examples.php                                   30-May-2024 18:01                1408
ftp.installation.php                               30-May-2024 18:01                1495
ftp.requirements.php                               30-May-2024 18:01                1230
ftp.resources.php                                  30-May-2024 18:01                1537
ftp.setup.php                                      30-May-2024 18:01                1605
funchand.configuration.php                         30-May-2024 18:01                1305
funchand.constants.php                             30-May-2024 18:01                1241
funchand.installation.php                          30-May-2024 18:01                1289
funchand.requirements.php                          30-May-2024 18:01                1265
funchand.resources.php                             30-May-2024 18:01                1248
funchand.setup.php                                 30-May-2024 18:01                1657
funcref.php                                        30-May-2024 18:01               14198
function.abs.php                                   30-May-2024 18:01                5640
function.acos.php                                  30-May-2024 18:01                3552
function.acosh.php                                 30-May-2024 18:01                3308
function.addcslashes.php                           30-May-2024 18:01                8293
function.addslashes.php                            30-May-2024 18:01                6553
function.apache-child-terminate.php                30-May-2024 18:01                3512
function.apache-get-modules.php                    30-May-2024 18:01                3465
function.apache-get-version.php                    30-May-2024 18:01                3981
function.apache-getenv.php                         30-May-2024 18:01                5309
function.apache-lookup-uri.php                     30-May-2024 18:01                5889
function.apache-note.php                           30-May-2024 18:01                7701
function.apache-request-headers.php                30-May-2024 18:01                5852
function.apache-response-headers.php               30-May-2024 18:01                4453
function.apache-setenv.php                         30-May-2024 18:01                5890
function.apcu-add.php                              30-May-2024 18:01                8537
function.apcu-cache-info.php                       30-May-2024 18:01                6771
function.apcu-cas.php                              30-May-2024 18:01                8839
function.apcu-clear-cache.php                      30-May-2024 18:01                2635
function.apcu-dec.php                              30-May-2024 18:01                8304
function.apcu-delete.php                           30-May-2024 18:01                6050
function.apcu-enabled.php                          30-May-2024 18:01                2426
function.apcu-entry.php                            30-May-2024 18:01                8509
function.apcu-exists.php                           30-May-2024 18:01                6997
function.apcu-fetch.php                            30-May-2024 18:01                5832
function.apcu-inc.php                              30-May-2024 18:01                8288
function.apcu-key-info.php                         30-May-2024 18:01                5027
function.apcu-sma-info.php                         30-May-2024 18:01                4666
function.apcu-store.php                            30-May-2024 18:01                7425
function.array-change-key-case.php                 30-May-2024 18:01                5539
function.array-chunk.php                           30-May-2024 18:01                7883
function.array-column.php                          30-May-2024 18:01               17528
function.array-combine.php                         30-May-2024 18:01                7785
function.array-count-values.php                    30-May-2024 18:01                6017
function.array-diff-assoc.php                      30-May-2024 18:01               11623
function.array-diff-key.php                        30-May-2024 18:01               13291
function.array-diff-uassoc.php                     30-May-2024 18:01               12413
function.array-diff-ukey.php                       30-May-2024 18:01               12747
function.array-diff.php                            30-May-2024 18:01               12441
function.array-fill-keys.php                       30-May-2024 18:01                5562
function.array-fill.php                            30-May-2024 18:01                9399
function.array-filter.php                          30-May-2024 18:01               17135
function.array-flip.php                            30-May-2024 18:01                7440
function.array-intersect-assoc.php                 30-May-2024 18:01                9176
function.array-intersect-key.php                   30-May-2024 18:01               10610
function.array-intersect-uassoc.php                30-May-2024 18:01                9299
function.array-intersect-ukey.php                  30-May-2024 18:01               12454
function.array-intersect.php                       30-May-2024 18:01                7146
function.array-is-list.php                         30-May-2024 18:01                7173
function.array-key-exists.php                      30-May-2024 18:01               10192
function.array-key-first.php                       30-May-2024 18:01                7302
function.array-key-last.php                        30-May-2024 18:01                3492
function.array-keys.php                            30-May-2024 18:01                8648
function.array-map.php                             30-May-2024 18:01               28028
function.array-merge-recursive.php                 30-May-2024 18:01                6986
function.array-merge.php                           30-May-2024 18:01               12844
function.array-multisort.php                       30-May-2024 18:01               24539
function.array-pad.php                             30-May-2024 18:01                7686
function.array-pop.php                             30-May-2024 18:01                5777
function.array-product.php                         30-May-2024 18:01                5764
function.array-push.php                            30-May-2024 18:01                7270
function.array-rand.php                            30-May-2024 18:01                9892
function.array-reduce.php                          30-May-2024 18:01               10188
function.array-replace-recursive.php               30-May-2024 18:01               11457
function.array-replace.php                         30-May-2024 18:01                7009
function.array-reverse.php                         30-May-2024 18:01                6339
function.array-search.php                          30-May-2024 18:01                8687
function.array-shift.php                           30-May-2024 18:01                5890
function.array-slice.php                           30-May-2024 18:01               14172
function.array-splice.php                          30-May-2024 18:01               17928
function.array-sum.php                             30-May-2024 18:01                6426
function.array-udiff-assoc.php                     30-May-2024 18:01               18366
function.array-udiff-uassoc.php                    30-May-2024 18:01               19776
function.array-udiff.php                           30-May-2024 18:01               30643
function.array-uintersect-assoc.php                30-May-2024 18:01               12119
function.array-uintersect-uassoc.php               30-May-2024 18:01               12453
function.array-uintersect.php                      30-May-2024 18:01               11694
function.array-unique.php                          30-May-2024 18:01               10047
function.array-unshift.php                         30-May-2024 18:01               11321
function.array-values.php                          30-May-2024 18:01                4694
function.array-walk-recursive.php                  30-May-2024 18:01                7887
function.array-walk.php                            30-May-2024 18:01               14331
function.array.php                                 30-May-2024 18:01               11907
function.arsort.php                                30-May-2024 18:01                9734
function.asin.php                                  30-May-2024 18:01                3548
function.asinh.php                                 30-May-2024 18:01                3343
function.asort.php                                 30-May-2024 18:01                9716
function.assert-options.php                        30-May-2024 18:01               14744
function.assert.php                                30-May-2024 18:01               23377
function.atan.php                                  30-May-2024 18:01                3533
function.atan2.php                                 30-May-2024 18:01                3481
function.atanh.php                                 30-May-2024 18:01                3324
function.autoload.php                              30-May-2024 18:01                3275
function.base-convert.php                          30-May-2024 18:01                7071
function.base64-decode.php                         30-May-2024 18:01                5351
function.base64-encode.php                         30-May-2024 18:01                4823
function.basename.php                              30-May-2024 18:01                7741
function.bcadd.php                                 30-May-2024 18:01                5853
function.bccomp.php                                30-May-2024 18:01                5836
function.bcdiv.php                                 30-May-2024 18:01                5444
function.bcmod.php                                 30-May-2024 18:01                7591
function.bcmul.php                                 30-May-2024 18:01                7266
function.bcpow.php                                 30-May-2024 18:01                7269
function.bcpowmod.php                              30-May-2024 18:01                7415
function.bcscale.php                               30-May-2024 18:01                5676
function.bcsqrt.php                                30-May-2024 18:01                6311
function.bcsub.php                                 30-May-2024 18:01                5810
function.bin2hex.php                               30-May-2024 18:01                4654
function.bind-textdomain-codeset.php               30-May-2024 18:01                4687
function.bindec.php                                30-May-2024 18:01               15306
function.bindtextdomain.php                        30-May-2024 18:01                5731
function.boolval.php                               30-May-2024 18:01               10294
function.bzclose.php                               30-May-2024 18:01                3213
function.bzcompress.php                            30-May-2024 18:01                5329
function.bzdecompress.php                          30-May-2024 18:01                6771
function.bzerrno.php                               30-May-2024 18:01                3201
function.bzerror.php                               30-May-2024 18:01                4436
function.bzerrstr.php                              30-May-2024 18:01                3211
function.bzflush.php                               30-May-2024 18:01                3429
function.bzopen.php                                30-May-2024 18:01                5229
function.bzread.php                                30-May-2024 18:01                6693
function.bzwrite.php                               30-May-2024 18:01                6542                     30-May-2024 18:01                4761                           30-May-2024 18:01                7239                              30-May-2024 18:01                6396                             30-May-2024 18:01                6212                  30-May-2024 18:01               17696                        30-May-2024 18:01               14688
function.ceil.php                                  30-May-2024 18:01                5267
function.chdir.php                                 30-May-2024 18:01                5747
function.checkdate.php                             30-May-2024 18:01                5747
function.checkdnsrr.php                            30-May-2024 18:01                5313
function.chgrp.php                                 30-May-2024 18:01                6962
function.chmod.php                                 30-May-2024 18:01                9361
function.chop.php                                  30-May-2024 18:01                2075
function.chown.php                                 30-May-2024 18:01                7035
function.chr.php                                   30-May-2024 18:01                9221
function.chroot.php                                30-May-2024 18:01                4922
function.chunk-split.php                           30-May-2024 18:01                5439
function.class-alias.php                           30-May-2024 18:01                9366
function.class-exists.php                          30-May-2024 18:01                7243
function.class-implements.php                      30-May-2024 18:01                7382
function.class-parents.php                         30-May-2024 18:01                7073
function.class-uses.php                            30-May-2024 18:01                6363
function.clearstatcache.php                        30-May-2024 18:01               11232
function.cli-get-process-title.php                 30-May-2024 18:01                4537
function.cli-set-process-title.php                 30-May-2024 18:01                5616
function.closedir.php                              30-May-2024 18:01                5036
function.closelog.php                              30-May-2024 18:01                2977                       30-May-2024 18:01                2914                        30-May-2024 18:01               10465                 30-May-2024 18:01                5724                      30-May-2024 18:01                5490                      30-May-2024 18:01                4104                    30-May-2024 18:01                5208
function.commonmark-parse.php                      30-May-2024 18:01                4186
function.commonmark-render-html.php                30-May-2024 18:01                4743
function.commonmark-render-latex.php               30-May-2024 18:01                5073
function.commonmark-render-man.php                 30-May-2024 18:01                5055
function.commonmark-render-xml.php                 30-May-2024 18:01                4700
function.commonmark-render.php                     30-May-2024 18:01                5001
function.compact.php                               30-May-2024 18:01                8461
function.connection-aborted.php                    30-May-2024 18:01                3157
function.connection-status.php                     30-May-2024 18:01                3319
function.constant.php                              30-May-2024 18:01                9374
function.convert-cyr-string.php                    30-May-2024 18:01                5205
function.convert-uudecode.php                      30-May-2024 18:01                4601
function.convert-uuencode.php                      30-May-2024 18:01                5593
function.copy.php                                  30-May-2024 18:01                6188
function.cos.php                                   30-May-2024 18:01                4011
function.cosh.php                                  30-May-2024 18:01                3275
function.count-chars.php                           30-May-2024 18:01                7595
function.count.php                                 30-May-2024 18:01               16616
function.crc32.php                                 30-May-2024 18:01                7299
function.create-function.php                       30-May-2024 18:01               32068
function.crypt.php                                 30-May-2024 18:01               13862
function.ctype-alnum.php                           30-May-2024 18:01                6910
function.ctype-alpha.php                           30-May-2024 18:01                7269
function.ctype-cntrl.php                           30-May-2024 18:01                6832
function.ctype-digit.php                           30-May-2024 18:01                8981
function.ctype-graph.php                           30-May-2024 18:01                7575
function.ctype-lower.php                           30-May-2024 18:01                6895
function.ctype-print.php                           30-May-2024 18:01                7615
function.ctype-punct.php                           30-May-2024 18:01                6948
function.ctype-space.php                           30-May-2024 18:01                7665
function.ctype-upper.php                           30-May-2024 18:01                7028
function.ctype-xdigit.php                          30-May-2024 18:01                6752
function.cubrid-affected-rows.php                  30-May-2024 18:01                9460
function.cubrid-bind.php                           30-May-2024 18:01               20775
function.cubrid-client-encoding.php                30-May-2024 18:01                5340
function.cubrid-close-prepare.php                  30-May-2024 18:01                6296
function.cubrid-close-request.php                  30-May-2024 18:01                6307
function.cubrid-close.php                          30-May-2024 18:01                6438
function.cubrid-col-get.php                        30-May-2024 18:01                8620
function.cubrid-col-size.php                       30-May-2024 18:01                8735
function.cubrid-column-names.php                   30-May-2024 18:01                8580
function.cubrid-column-types.php                   30-May-2024 18:01                8560
function.cubrid-commit.php                         30-May-2024 18:01               15402
function.cubrid-connect-with-url.php               30-May-2024 18:01               15164
function.cubrid-connect.php                        30-May-2024 18:01               12394
function.cubrid-current-oid.php                    30-May-2024 18:01                6061
function.cubrid-data-seek.php                      30-May-2024 18:01                7526
function.cubrid-db-name.php                        30-May-2024 18:01                6612
function.cubrid-disconnect.php                     30-May-2024 18:01                7186
function.cubrid-drop.php                           30-May-2024 18:01               11497
function.cubrid-errno.php                          30-May-2024 18:01                6869
function.cubrid-error-code-facility.php            30-May-2024 18:01                5883
function.cubrid-error-code.php                     30-May-2024 18:01                5793
function.cubrid-error-msg.php                      30-May-2024 18:01                5243
function.cubrid-error.php                          30-May-2024 18:01                6429
function.cubrid-execute.php                        30-May-2024 18:01               14438
function.cubrid-fetch-array.php                    30-May-2024 18:01                9870
function.cubrid-fetch-assoc.php                    30-May-2024 18:01                9104
function.cubrid-fetch-field.php                    30-May-2024 18:01               14138
function.cubrid-fetch-lengths.php                  30-May-2024 18:01                6191
function.cubrid-fetch-object.php                   30-May-2024 18:01               12049
function.cubrid-fetch-row.php                      30-May-2024 18:01                9062
function.cubrid-fetch.php                          30-May-2024 18:01               10003
function.cubrid-field-flags.php                    30-May-2024 18:01                7846
function.cubrid-field-len.php                      30-May-2024 18:01                8355
function.cubrid-field-name.php                     30-May-2024 18:01                7261
function.cubrid-field-seek.php                     30-May-2024 18:01               11013
function.cubrid-field-table.php                    30-May-2024 18:01                7466
function.cubrid-field-type.php                     30-May-2024 18:01                7540
function.cubrid-free-result.php                    30-May-2024 18:01                6012
function.cubrid-get-autocommit.php                 30-May-2024 18:01                3840
function.cubrid-get-charset.php                    30-May-2024 18:01                5073
function.cubrid-get-class-name.php                 30-May-2024 18:01                6428
function.cubrid-get-client-info.php                30-May-2024 18:01                8209
function.cubrid-get-db-parameter.php               30-May-2024 18:01               14367
function.cubrid-get-query-timeout.php              30-May-2024 18:01                6789
function.cubrid-get-server-info.php                30-May-2024 18:01                8500
function.cubrid-get.php                            30-May-2024 18:01                9913
function.cubrid-insert-id.php                      30-May-2024 18:01                7196
function.cubrid-is-instance.php                    30-May-2024 18:01                7237
function.cubrid-list-dbs.php                       30-May-2024 18:01                4608
function.cubrid-load-from-glo.php                  30-May-2024 18:01                6933
function.cubrid-lob-close.php                      30-May-2024 18:01                7305
function.cubrid-lob-export.php                     30-May-2024 18:01                7884
function.cubrid-lob-get.php                        30-May-2024 18:01                7683
function.cubrid-lob-send.php                       30-May-2024 18:01                7059
function.cubrid-lob-size.php                       30-May-2024 18:01                5876
function.cubrid-lob2-bind.php                      30-May-2024 18:01                9769
function.cubrid-lob2-close.php                     30-May-2024 18:01                3458
function.cubrid-lob2-export.php                    30-May-2024 18:01                8762
function.cubrid-lob2-import.php                    30-May-2024 18:01                8631
function.cubrid-lob2-new.php                       30-May-2024 18:01                3978
function.cubrid-lob2-read.php                      30-May-2024 18:01               13727
function.cubrid-lob2-seek.php                      30-May-2024 18:01               11293
function.cubrid-lob2-seek64.php                    30-May-2024 18:01               12716
function.cubrid-lob2-size.php                      30-May-2024 18:01                4359
function.cubrid-lob2-size64.php                    30-May-2024 18:01                4539
function.cubrid-lob2-tell.php                      30-May-2024 18:01                4378
function.cubrid-lob2-tell64.php                    30-May-2024 18:01                4576
function.cubrid-lob2-write.php                     30-May-2024 18:01               14056
function.cubrid-lock-read.php                      30-May-2024 18:01                9218
function.cubrid-lock-write.php                     30-May-2024 18:01                9606
function.cubrid-move-cursor.php                    30-May-2024 18:01                9590
function.cubrid-new-glo.php                        30-May-2024 18:01                6984
function.cubrid-next-result.php                    30-May-2024 18:01               16377
function.cubrid-num-cols.php                       30-May-2024 18:01                6034
function.cubrid-num-fields.php                     30-May-2024 18:01                5755
function.cubrid-num-rows.php                       30-May-2024 18:01                7218
function.cubrid-pconnect-with-url.php              30-May-2024 18:01               14491
function.cubrid-pconnect.php                       30-May-2024 18:01               12175
function.cubrid-ping.php                           30-May-2024 18:01                6122
function.cubrid-prepare.php                        30-May-2024 18:01               10330
function.cubrid-put.php                            30-May-2024 18:01               11439
function.cubrid-query.php                          30-May-2024 18:01               14759
function.cubrid-real-escape-string.php             30-May-2024 18:01                8276
function.cubrid-result.php                         30-May-2024 18:01                7486
function.cubrid-rollback.php                       30-May-2024 18:01               14697
function.cubrid-save-to-glo.php                    30-May-2024 18:01                6846
function.cubrid-schema.php                         30-May-2024 18:01               20526
function.cubrid-send-glo.php                       30-May-2024 18:01                6313
function.cubrid-seq-drop.php                       30-May-2024 18:01                9867
function.cubrid-seq-insert.php                     30-May-2024 18:01               10373
function.cubrid-seq-put.php                        30-May-2024 18:01               10300
function.cubrid-set-add.php                        30-May-2024 18:01                9639
function.cubrid-set-autocommit.php                 30-May-2024 18:01                4221
function.cubrid-set-db-parameter.php               30-May-2024 18:01                8257
function.cubrid-set-drop.php                       30-May-2024 18:01                9616
function.cubrid-set-query-timeout.php              30-May-2024 18:01                3609
function.cubrid-unbuffered-query.php               30-May-2024 18:01                7059
function.cubrid-version.php                        30-May-2024 18:01                8745
function.curl-close.php                            30-May-2024 18:01                6114
function.curl-copy-handle.php                      30-May-2024 18:01                6410
function.curl-errno.php                            30-May-2024 18:01                6102
function.curl-error.php                            30-May-2024 18:01                6033
function.curl-escape.php                           30-May-2024 18:01                7541
function.curl-exec.php                             30-May-2024 18:01                7594
function.curl-getinfo.php                          30-May-2024 18:01               37567
function.curl-init.php                             30-May-2024 18:01                7465
function.curl-multi-add-handle.php                 30-May-2024 18:01               10238
function.curl-multi-close.php                      30-May-2024 18:01                9630
function.curl-multi-errno.php                      30-May-2024 18:01                4023
function.curl-multi-exec.php                       30-May-2024 18:01               10398
function.curl-multi-getcontent.php                 30-May-2024 18:01                4403
function.curl-multi-info-read.php                  30-May-2024 18:01               12129
function.curl-multi-init.php                       30-May-2024 18:01                8751
function.curl-multi-remove-handle.php              30-May-2024 18:01                5459
function.curl-multi-select.php                     30-May-2024 18:01                4407
function.curl-multi-setopt.php                     30-May-2024 18:01               13638
function.curl-multi-strerror.php                   30-May-2024 18:01                7173
function.curl-pause.php                            30-May-2024 18:01                3952
function.curl-reset.php                            30-May-2024 18:01                6445
function.curl-setopt-array.php                     30-May-2024 18:01                7670
function.curl-setopt.php                           30-May-2024 18:01              175971
function.curl-share-close.php                      30-May-2024 18:01                7816
function.curl-share-errno.php                      30-May-2024 18:01                4020
function.curl-share-init.php                       30-May-2024 18:01                7552
function.curl-share-setopt.php                     30-May-2024 18:01               10332
function.curl-share-strerror.php                   30-May-2024 18:01                3554
function.curl-strerror.php                         30-May-2024 18:01                6367
function.curl-unescape.php                         30-May-2024 18:01                8037
function.curl-version.php                          30-May-2024 18:01                6829
function.curl_upkeep.php                           30-May-2024 18:01                7080
function.current.php                               30-May-2024 18:01               11545                              30-May-2024 18:01                1759               30-May-2024 18:01                1934     30-May-2024 18:01                2046                 30-May-2024 18:01                4362                           30-May-2024 18:01                4527                         30-May-2024 18:01                1818             30-May-2024 18:01                7146             30-May-2024 18:01                5779                             30-May-2024 18:01                1778                           30-May-2024 18:01                1786                  30-May-2024 18:01                1951 30-May-2024 18:01                2062                  30-May-2024 18:01                1913                      30-May-2024 18:01                1841                           30-May-2024 18:01                1790                       30-May-2024 18:01                1834                30-May-2024 18:01               14281                            30-May-2024 18:01               20155                              30-May-2024 18:01                2389                         30-May-2024 18:01               16133                          30-May-2024 18:01               14781                           30-May-2024 18:01               14801                         30-May-2024 18:01                1804                    30-May-2024 18:01                1863                    30-May-2024 18:01                1871                     30-May-2024 18:01                1860                     30-May-2024 18:01                1832                                  30-May-2024 18:01               22368
function.db2-autocommit.php                        30-May-2024 18:01               11160
function.db2-bind-param.php                        30-May-2024 18:01               22931
function.db2-client-info.php                       30-May-2024 18:01               11699
function.db2-close.php                             30-May-2024 18:01                5717
function.db2-column-privileges.php                 30-May-2024 18:01                9176
function.db2-columns.php                           30-May-2024 18:01               11225
function.db2-commit.php                            30-May-2024 18:01                3765
function.db2-conn-error.php                        30-May-2024 18:01                6983
function.db2-conn-errormsg.php                     30-May-2024 18:01                6808
function.db2-connect.php                           30-May-2024 18:01               39324
function.db2-cursor-type.php                       30-May-2024 18:01                3346
function.db2-escape-string.php                     30-May-2024 18:01                7643
function.db2-exec.php                              30-May-2024 18:01               26429
function.db2-execute.php                           30-May-2024 18:01               25793
function.db2-fetch-array.php                       30-May-2024 18:01               11352
function.db2-fetch-assoc.php                       30-May-2024 18:01               11368
function.db2-fetch-both.php                        30-May-2024 18:01               11901
function.db2-fetch-object.php                      30-May-2024 18:01                9058
function.db2-fetch-row.php                         30-May-2024 18:01               16365
function.db2-field-display-size.php                30-May-2024 18:01                5140
function.db2-field-name.php                        30-May-2024 18:01                5028
function.db2-field-num.php                         30-May-2024 18:01                5036
function.db2-field-precision.php                   30-May-2024 18:01                5068
function.db2-field-scale.php                       30-May-2024 18:01                5030
function.db2-field-type.php                        30-May-2024 18:01                5033
function.db2-field-width.php                       30-May-2024 18:01                5238
function.db2-foreign-keys.php                      30-May-2024 18:01                9081
function.db2-free-result.php                       30-May-2024 18:01                3423
function.db2-free-stmt.php                         30-May-2024 18:01                3411
function.db2-get-option.php                        30-May-2024 18:01               24157
function.db2-last-insert-id.php                    30-May-2024 18:01                8197
function.db2-lob-read.php                          30-May-2024 18:01               16427
function.db2-next-result.php                       30-May-2024 18:01                8871
function.db2-num-fields.php                        30-May-2024 18:01                7214
function.db2-num-rows.php                          30-May-2024 18:01                4779
function.db2-pclose.php                            30-May-2024 18:01                5913
function.db2-pconnect.php                          30-May-2024 18:01               32325
function.db2-prepare.php                           30-May-2024 18:01               10598
function.db2-primary-keys.php                      30-May-2024 18:01                7715
function.db2-procedure-columns.php                 30-May-2024 18:01               12183
function.db2-procedures.php                        30-May-2024 18:01                8044
function.db2-result.php                            30-May-2024 18:01                8017
function.db2-rollback.php                          30-May-2024 18:01                9369
function.db2-server-info.php                       30-May-2024 18:01               22545
function.db2-set-option.php                        30-May-2024 18:01               67572
function.db2-special-columns.php                   30-May-2024 18:01               10296
function.db2-statistics.php                        30-May-2024 18:01               12567
function.db2-stmt-error.php                        30-May-2024 18:01                4645
function.db2-stmt-errormsg.php                     30-May-2024 18:01                4276
function.db2-table-privileges.php                  30-May-2024 18:01                8605
function.db2-tables.php                            30-May-2024 18:01                8935
function.dba-close.php                             30-May-2024 18:01                3317
function.dba-delete.php                            30-May-2024 18:01                4349
function.dba-exists.php                            30-May-2024 18:01                4417
function.dba-fetch.php                             30-May-2024 18:01                7603
function.dba-firstkey.php                          30-May-2024 18:01                3831
function.dba-handlers.php                          30-May-2024 18:01                5666
function.dba-insert.php                            30-May-2024 18:01                5062
function.dba-key-split.php                         30-May-2024 18:01                4116
function.dba-list.php                              30-May-2024 18:01                2292
function.dba-nextkey.php                           30-May-2024 18:01                3743
function.dba-open.php                              30-May-2024 18:01               15471
function.dba-optimize.php                          30-May-2024 18:01                3316
function.dba-popen.php                             30-May-2024 18:01                9859
function.dba-replace.php                           30-May-2024 18:01                4859
function.dba-sync.php                              30-May-2024 18:01                3383
function.dbase-add-record.php                      30-May-2024 18:01                7097
function.dbase-close.php                           30-May-2024 18:01                5381
function.dbase-create.php                          30-May-2024 18:01                8411
function.dbase-delete-record.php                   30-May-2024 18:01                5146
function.dbase-get-header-info.php                 30-May-2024 18:01                7224
function.dbase-get-record-with-names.php           30-May-2024 18:01                9076
function.dbase-get-record.php                      30-May-2024 18:01                5968
function.dbase-numfields.php                       30-May-2024 18:01                6096
function.dbase-numrecords.php                      30-May-2024 18:01                7099
function.dbase-open.php                            30-May-2024 18:01                6754
function.dbase-pack.php                            30-May-2024 18:01                6525
function.dbase-replace-record.php                  30-May-2024 18:01                9862
function.dcgettext.php                             30-May-2024 18:01                3560
function.dcngettext.php                            30-May-2024 18:01                4188
function.debug-backtrace.php                       30-May-2024 18:01               12481
function.debug-print-backtrace.php                 30-May-2024 18:01                6813
function.debug-zval-dump.php                       30-May-2024 18:01                9626
function.decbin.php                                30-May-2024 18:01                8989
function.dechex.php                                30-May-2024 18:01                7402
function.decoct.php                                30-May-2024 18:01                4985
function.define.php                                30-May-2024 18:01               12462
function.defined.php                               30-May-2024 18:01                8041
function.deflate-add.php                           30-May-2024 18:01                5994
function.deflate-init.php                          30-May-2024 18:01                7936
function.deg2rad.php                               30-May-2024 18:01                4045
function.delete.php                                30-May-2024 18:01                2447
function.dgettext.php                              30-May-2024 18:01                3290
function.die.php                                   30-May-2024 18:01                1584
function.dio-close.php                             30-May-2024 18:01                4071
function.dio-fcntl.php                             30-May-2024 18:01               10092
function.dio-open.php                              30-May-2024 18:01                8693
function.dio-read.php                              30-May-2024 18:01                3487
function.dio-seek.php                              30-May-2024 18:01                7379
function.dio-stat.php                              30-May-2024 18:01                4383
function.dio-tcsetattr.php                         30-May-2024 18:01                7083
function.dio-truncate.php                          30-May-2024 18:01                3768
function.dio-write.php                             30-May-2024 18:01                3898
function.dir.php                                   30-May-2024 18:01                7470
function.dirname.php                               30-May-2024 18:01                9835
function.disk-free-space.php                       30-May-2024 18:01                5688
function.disk-total-space.php                      30-May-2024 18:01                5360
function.diskfreespace.php                         30-May-2024 18:01                1789
function.dl.php                                    30-May-2024 18:01               10238
function.dngettext.php                             30-May-2024 18:01                3946
function.dns-check-record.php                      30-May-2024 18:01                1771
function.dns-get-mx.php                            30-May-2024 18:01                1741
function.dns-get-record.php                        30-May-2024 18:01               24383
function.dom-import-simplexml.php                  30-May-2024 18:01                7126
function.doubleval.php                             30-May-2024 18:01                1735
function.each.php                                  30-May-2024 18:01               11715
function.easter-date.php                           30-May-2024 18:01               14299
function.easter-days.php                           30-May-2024 18:01                7444
function.echo.php                                  30-May-2024 18:01               17682
function.eio-busy.php                              30-May-2024 18:01                4954
function.eio-cancel.php                            30-May-2024 18:01                7616
function.eio-chmod.php                             30-May-2024 18:01                6278
function.eio-chown.php                             30-May-2024 18:01                6480
function.eio-close.php                             30-May-2024 18:01                5710
function.eio-custom.php                            30-May-2024 18:01               10380
function.eio-dup2.php                              30-May-2024 18:01                5762
function.eio-event-loop.php                        30-May-2024 18:01                5822
function.eio-fallocate.php                         30-May-2024 18:01                7620
function.eio-fchmod.php                            30-May-2024 18:01                6237
function.eio-fchown.php                            30-May-2024 18:01                6539
function.eio-fdatasync.php                         30-May-2024 18:01                5626
function.eio-fstat.php                             30-May-2024 18:01               11619
function.eio-fstatvfs.php                          30-May-2024 18:01                5752
function.eio-fsync.php                             30-May-2024 18:01                5726
function.eio-ftruncate.php                         30-May-2024 18:01                6255
function.eio-futime.php                            30-May-2024 18:01                6561
function.eio-get-event-stream.php                  30-May-2024 18:01                8084
function.eio-get-last-error.php                    30-May-2024 18:01                3169
function.eio-grp-add.php                           30-May-2024 18:01               11480
function.eio-grp-cancel.php                        30-May-2024 18:01                3156
function.eio-grp-limit.php                         30-May-2024 18:01                3070
function.eio-grp.php                               30-May-2024 18:01               11815
function.eio-init.php                              30-May-2024 18:01                2624
function.eio-link.php                              30-May-2024 18:01               12616
function.eio-lstat.php                             30-May-2024 18:01                9989
function.eio-mkdir.php                             30-May-2024 18:01                9305
function.eio-mknod.php                             30-May-2024 18:01               11611
function.eio-nop.php                               30-May-2024 18:01                5383
function.eio-npending.php                          30-May-2024 18:01                3026
function.eio-nready.php                            30-May-2024 18:01                2774
function.eio-nreqs.php                             30-May-2024 18:01                5569
function.eio-nthreads.php                          30-May-2024 18:01                3448
function.eio-open.php                              30-May-2024 18:01               11572
function.eio-poll.php                              30-May-2024 18:01                5700
function.eio-read.php                              30-May-2024 18:01               12586
function.eio-readahead.php                         30-May-2024 18:01                6295
function.eio-readdir.php                           30-May-2024 18:01               18331
function.eio-readlink.php                          30-May-2024 18:01               12316
function.eio-realpath.php                          30-May-2024 18:01                5373
function.eio-rename.php                            30-May-2024 18:01                9392
function.eio-rmdir.php                             30-May-2024 18:01                8336
function.eio-seek.php                              30-May-2024 18:01                7105
function.eio-sendfile.php                          30-May-2024 18:01                6620
function.eio-set-max-idle.php                      30-May-2024 18:01                3159
function.eio-set-max-parallel.php                  30-May-2024 18:01                3208
function.eio-set-max-poll-reqs.php                 30-May-2024 18:01                2528
function.eio-set-max-poll-time.php                 30-May-2024 18:01                2598
function.eio-set-min-parallel.php                  30-May-2024 18:01                3199
function.eio-stat.php                              30-May-2024 18:01                9966
function.eio-statvfs.php                           30-May-2024 18:01                8466
function.eio-symlink.php                           30-May-2024 18:01               10950
function.eio-sync-file-range.php                   30-May-2024 18:01                7400
function.eio-sync.php                              30-May-2024 18:01                2929
function.eio-syncfs.php                            30-May-2024 18:01                5309
function.eio-truncate.php                          30-May-2024 18:01                6232
function.eio-unlink.php                            30-May-2024 18:01                5415
function.eio-utime.php                             30-May-2024 18:01                6270
function.eio-write.php                             30-May-2024 18:01                6988
function.empty.php                                 30-May-2024 18:01                9549
function.enchant-broker-describe.php               30-May-2024 18:01                6099
function.enchant-broker-dict-exists.php            30-May-2024 18:01                5795
function.enchant-broker-free-dict.php              30-May-2024 18:01                4894
function.enchant-broker-free.php                   30-May-2024 18:01                4459
function.enchant-broker-get-dict-path.php          30-May-2024 18:01                5427
function.enchant-broker-get-error.php              30-May-2024 18:01                3745
function.enchant-broker-init.php                   30-May-2024 18:01                3522
function.enchant-broker-list-dicts.php             30-May-2024 18:01                6974
function.enchant-broker-request-dict.php           30-May-2024 18:01                7130
function.enchant-broker-request-pwl-dict.php       30-May-2024 18:01                5451
function.enchant-broker-set-dict-path.php          30-May-2024 18:01                5714
function.enchant-broker-set-ordering.php           30-May-2024 18:01                4891
function.enchant-dict-add-to-personal.php          30-May-2024 18:01                2235
function.enchant-dict-add-to-session.php           30-May-2024 18:01                4518
function.enchant-dict-add.php                      30-May-2024 18:01                6469
function.enchant-dict-check.php                    30-May-2024 18:01                4329
function.enchant-dict-describe.php                 30-May-2024 18:01                6635
function.enchant-dict-get-error.php                30-May-2024 18:01                3951
function.enchant-dict-is-added.php                 30-May-2024 18:01                4558
function.enchant-dict-is-in-session.php            30-May-2024 18:01                2221
function.enchant-dict-quick-check.php              30-May-2024 18:01                8381
function.enchant-dict-store-replacement.php        30-May-2024 18:01                4805
function.enchant-dict-suggest.php                  30-May-2024 18:01                7520
function.end.php                                   30-May-2024 18:01                6784
function.enum-exists.php                           30-May-2024 18:01                5605
function.error-clear-last.php                      30-May-2024 18:01                4660
function.error-get-last.php                        30-May-2024 18:01                4994
function.error-log.php                             30-May-2024 18:01               11212
function.error-reporting.php                       30-May-2024 18:01                9584
function.escapeshellarg.php                        30-May-2024 18:01                5660
function.escapeshellcmd.php                        30-May-2024 18:01                7840
function.eval.php                                  30-May-2024 18:01                9619
function.exec.php                                  30-May-2024 18:01               10845
function.exif-imagetype.php                        30-May-2024 18:01                9963
function.exif-read-data.php                        30-May-2024 18:01               22243
function.exif-tagname.php                          30-May-2024 18:01                4818
function.exif-thumbnail.php                        30-May-2024 18:01                9147
function.exit.php                                  30-May-2024 18:01                9477
function.exp.php                                   30-May-2024 18:01                4333
function.expect-expectl.php                        30-May-2024 18:01               11101
function.expect-popen.php                          30-May-2024 18:01                4670
function.explode.php                               30-May-2024 18:01               15767
function.expm1.php                                 30-May-2024 18:01                3601
function.extension-loaded.php                      30-May-2024 18:01                5692
function.extract.php                               30-May-2024 18:01               14797
function.ezmlm-hash.php                            30-May-2024 18:01                4614
function.fann-cascadetrain-on-data.php             30-May-2024 18:01                6706
function.fann-cascadetrain-on-file.php             30-May-2024 18:01                5633
function.fann-clear-scaling-params.php             30-May-2024 18:01                2766
function.fann-copy.php                             30-May-2024 18:01                3302
function.fann-create-from-file.php                 30-May-2024 18:01                3315
function.fann-create-shortcut-array.php            30-May-2024 18:01                4183
function.fann-create-shortcut.php                  30-May-2024 18:01                5203
function.fann-create-sparse-array.php              30-May-2024 18:01                4822
function.fann-create-sparse.php                    30-May-2024 18:01                5580
function.fann-create-standard-array.php            30-May-2024 18:01                4496
function.fann-create-standard.php                  30-May-2024 18:01                5271
function.fann-create-train-from-callback.php       30-May-2024 18:01                9109
function.fann-create-train.php                     30-May-2024 18:01                4634
function.fann-descale-input.php                    30-May-2024 18:01                3824
function.fann-descale-output.php                   30-May-2024 18:01                3840
function.fann-descale-train.php                    30-May-2024 18:01                3806
function.fann-destroy-train.php                    30-May-2024 18:01                2725
function.fann-destroy.php                          30-May-2024 18:01                2753
function.fann-duplicate-train-data.php             30-May-2024 18:01                2928
function.fann-get-activation-function.php          30-May-2024 18:01                5296
function.fann-get-activation-steepness.php         30-May-2024 18:01                5709
function.fann-get-bias-array.php                   30-May-2024 18:01                2638
function.fann-get-bit-fail-limit.php               30-May-2024 18:01                3856
function.fann-get-bit-fail.php                     30-May-2024 18:01                4944
function.fann-get-cascade-activation-functions-..> 30-May-2024 18:01                3893
function.fann-get-cascade-activation-functions.php 30-May-2024 18:01                4709
function.fann-get-cascade-activation-steepnesse..> 30-May-2024 18:01                3949
function.fann-get-cascade-activation-steepnesse..> 30-May-2024 18:01                4100
function.fann-get-cascade-candidate-change-frac..> 30-May-2024 18:01                5206
function.fann-get-cascade-candidate-limit.php      30-May-2024 18:01                3596
function.fann-get-cascade-candidate-stagnation-..> 30-May-2024 18:01                4332
function.fann-get-cascade-max-cand-epochs.php      30-May-2024 18:01                3478
function.fann-get-cascade-max-out-epochs.php       30-May-2024 18:01                3399
function.fann-get-cascade-min-cand-epochs.php      30-May-2024 18:01                3797
function.fann-get-cascade-min-out-epochs.php       30-May-2024 18:01                3754
function.fann-get-cascade-num-candidate-groups.php 30-May-2024 18:01                3876
function.fann-get-cascade-num-candidates.php       30-May-2024 18:01                6010
function.fann-get-cascade-output-change-fractio..> 30-May-2024 18:01                5134
function.fann-get-cascade-output-stagnation-epo..> 30-May-2024 18:01                4275
function.fann-get-cascade-weight-multiplier.php    30-May-2024 18:01                3554
function.fann-get-connection-array.php             30-May-2024 18:01                2665
function.fann-get-connection-rate.php              30-May-2024 18:01                2788
function.fann-get-errno.php                        30-May-2024 18:01                3198
function.fann-get-errstr.php                       30-May-2024 18:01                3203
function.fann-get-layer-array.php                  30-May-2024 18:01                2739
function.fann-get-learning-momentum.php            30-May-2024 18:01                3937
function.fann-get-learning-rate.php                30-May-2024 18:01                3873
function.fann-get-mse.php                          30-May-2024 18:01                3259
function.fann-get-network-type.php                 30-May-2024 18:01                2758
function.fann-get-num-input.php                    30-May-2024 18:01                2645
function.fann-get-num-layers.php                   30-May-2024 18:01                2700
function.fann-get-num-output.php                   30-May-2024 18:01                2664
function.fann-get-quickprop-decay.php              30-May-2024 18:01                3411
function.fann-get-quickprop-mu.php                 30-May-2024 18:01                3304
function.fann-get-rprop-decrease-factor.php        30-May-2024 18:01                3365
function.fann-get-rprop-delta-max.php              30-May-2024 18:01                3427
function.fann-get-rprop-delta-min.php              30-May-2024 18:01                3238
function.fann-get-rprop-delta-zero.php             30-May-2024 18:01                3611
function.fann-get-rprop-increase-factor.php        30-May-2024 18:01                3390
function.fann-get-sarprop-step-error-shift.php     30-May-2024 18:01                3714
function.fann-get-sarprop-step-error-threshold-..> 30-May-2024 18:01                3866
function.fann-get-sarprop-temperature.php          30-May-2024 18:01                3628
function.fann-get-sarprop-weight-decay-shift.php   30-May-2024 18:01                3695
function.fann-get-total-connections.php            30-May-2024 18:01                2837
function.fann-get-total-neurons.php                30-May-2024 18:01                2884
function.fann-get-train-error-function.php         30-May-2024 18:01                3643
function.fann-get-train-stop-function.php          30-May-2024 18:01                3629
function.fann-get-training-algorithm.php           30-May-2024 18:01                3863
function.fann-init-weights.php                     30-May-2024 18:01                4457
function.fann-length-train-data.php                30-May-2024 18:01                2966
function.fann-merge-train-data.php                 30-May-2024 18:01                3292
function.fann-num-input-train-data.php             30-May-2024 18:01                3601
function.fann-num-output-train-data.php            30-May-2024 18:01                3599
function.fann-print-error.php                      30-May-2024 18:01                2961
function.fann-randomize-weights.php                30-May-2024 18:01                4014
function.fann-read-train-from-file.php             30-May-2024 18:01                5027
function.fann-reset-errno.php                      30-May-2024 18:01                3137
function.fann-reset-errstr.php                     30-May-2024 18:01                3118
function.fann-reset-mse.php                        30-May-2024 18:01                3501
function.fann-run.php                              30-May-2024 18:01                2954
function.fann-save-train.php                       30-May-2024 18:01                3570
function.fann-save.php                             30-May-2024 18:01                4377
function.fann-scale-input-train-data.php           30-May-2024 18:01                4197
function.fann-scale-input.php                      30-May-2024 18:01                3838
function.fann-scale-output-train-data.php          30-May-2024 18:01                4225
function.fann-scale-output.php                     30-May-2024 18:01                3842
function.fann-scale-train-data.php                 30-May-2024 18:01                4195
function.fann-scale-train.php                      30-May-2024 18:01                3824
function.fann-set-activation-function-hidden.php   30-May-2024 18:01                4533
function.fann-set-activation-function-layer.php    30-May-2024 18:01                5047
function.fann-set-activation-function-output.php   30-May-2024 18:01                4549
function.fann-set-activation-function.php          30-May-2024 18:01                6524
function.fann-set-activation-steepness-hidden.php  30-May-2024 18:01                4819
function.fann-set-activation-steepness-layer.php   30-May-2024 18:01                5284
function.fann-set-activation-steepness-output.php  30-May-2024 18:01                4800
function.fann-set-activation-steepness.php         30-May-2024 18:01                6180
function.fann-set-bit-fail-limit.php               30-May-2024 18:01                3522
function.fann-set-callback.php                     30-May-2024 18:01                5695
function.fann-set-cascade-activation-functions.php 30-May-2024 18:01                4178
function.fann-set-cascade-activation-steepnesse..> 30-May-2024 18:01                4391
function.fann-set-cascade-candidate-change-frac..> 30-May-2024 18:01                3873
function.fann-set-cascade-candidate-limit.php      30-May-2024 18:01                3680
function.fann-set-cascade-candidate-stagnation-..> 30-May-2024 18:01                3935
function.fann-set-cascade-max-cand-epochs.php      30-May-2024 18:01                3681
function.fann-set-cascade-max-out-epochs.php       30-May-2024 18:01                3632
function.fann-set-cascade-min-cand-epochs.php      30-May-2024 18:01                4005
function.fann-set-cascade-min-out-epochs.php       30-May-2024 18:01                3987
function.fann-set-cascade-num-candidate-groups.php 30-May-2024 18:01                3766
function.fann-set-cascade-output-change-fractio..> 30-May-2024 18:01                3830
function.fann-set-cascade-output-stagnation-epo..> 30-May-2024 18:01                3896
function.fann-set-cascade-weight-multiplier.php    30-May-2024 18:01                3665
function.fann-set-error-log.php                    30-May-2024 18:01                2984
function.fann-set-input-scaling-params.php         30-May-2024 18:01                4584
function.fann-set-learning-momentum.php            30-May-2024 18:01                3906
function.fann-set-learning-rate.php                30-May-2024 18:01                3832
function.fann-set-output-scaling-params.php        30-May-2024 18:01                4604
function.fann-set-quickprop-decay.php              30-May-2024 18:01                3593
function.fann-set-quickprop-mu.php                 30-May-2024 18:01                3448
function.fann-set-rprop-decrease-factor.php        30-May-2024 18:01                3650
function.fann-set-rprop-delta-max.php              30-May-2024 18:01                3762
function.fann-set-rprop-delta-min.php              30-May-2024 18:01                3568
function.fann-set-rprop-delta-zero.php             30-May-2024 18:01                3950
function.fann-set-rprop-increase-factor.php        30-May-2024 18:01                3676
function.fann-set-sarprop-step-error-shift.php     30-May-2024 18:01                4055
function.fann-set-sarprop-step-error-threshold-..> 30-May-2024 18:01                4249
function.fann-set-sarprop-temperature.php          30-May-2024 18:01                3966
function.fann-set-sarprop-weight-decay-shift.php   30-May-2024 18:01                4049
function.fann-set-scaling-params.php               30-May-2024 18:01                5621
function.fann-set-train-error-function.php         30-May-2024 18:01                3862
function.fann-set-train-stop-function.php          30-May-2024 18:01                3850
function.fann-set-training-algorithm.php           30-May-2024 18:01                3798
function.fann-set-weight-array.php                 30-May-2024 18:01                3308
function.fann-set-weight.php                       30-May-2024 18:01                3756
function.fann-shuffle-train-data.php               30-May-2024 18:01                2925
function.fann-subset-train-data.php                30-May-2024 18:01                4293
function.fann-test-data.php                        30-May-2024 18:01                4217
function.fann-test.php                             30-May-2024 18:01                4557
function.fann-train-epoch.php                      30-May-2024 18:01                4591
function.fann-train-on-data.php                    30-May-2024 18:01                6531
function.fann-train-on-file.php                    30-May-2024 18:01                6506
function.fann-train.php                            30-May-2024 18:01                4633
function.fastcgi-finish-request.php                30-May-2024 18:01                2646
function.fbird-add-user.php                        30-May-2024 18:01                2351
function.fbird-affected-rows.php                   30-May-2024 18:01                2365
function.fbird-backup.php                          30-May-2024 18:01                1792
function.fbird-blob-add.php                        30-May-2024 18:01                2679
function.fbird-blob-cancel.php                     30-May-2024 18:01                3735
function.fbird-blob-close.php                      30-May-2024 18:01                2710
function.fbird-blob-create.php                     30-May-2024 18:01                2710
function.fbird-blob-echo.php                       30-May-2024 18:01                2513
function.fbird-blob-get.php                        30-May-2024 18:01                2506
function.fbird-blob-import.php                     30-May-2024 18:01                2706
function.fbird-blob-info.php                       30-May-2024 18:01                1824
function.fbird-blob-open.php                       30-May-2024 18:01                2503
function.fbird-close.php                           30-May-2024 18:01                2288
function.fbird-commit-ret.php                      30-May-2024 18:01                1817
function.fbird-commit.php                          30-May-2024 18:01                1785
function.fbird-connect.php                         30-May-2024 18:01                2294
function.fbird-db-info.php                         30-May-2024 18:01                1798
function.fbird-delete-user.php                     30-May-2024 18:01                2362
function.fbird-drop-db.php                         30-May-2024 18:01                2310
function.fbird-errcode.php                         30-May-2024 18:01                2132
function.fbird-errmsg.php                          30-May-2024 18:01                2125
function.fbird-execute.php                         30-May-2024 18:01                2137
function.fbird-fetch-assoc.php                     30-May-2024 18:01                2378
function.fbird-fetch-object.php                    30-May-2024 18:01                2389
function.fbird-fetch-row.php                       30-May-2024 18:01                2366
function.fbird-field-info.php                      30-May-2024 18:01                2207
function.fbird-free-event-handler.php              30-May-2024 18:01                2311
function.fbird-free-query.php                      30-May-2024 18:01                1853
function.fbird-free-result.php                     30-May-2024 18:01                1838
function.fbird-gen-id.php                          30-May-2024 18:01                1795
function.fbird-maintain-db.php                     30-May-2024 18:01                1840
function.fbird-modify-user.php                     30-May-2024 18:01                2378
function.fbird-name-result.php                     30-May-2024 18:01                2361
function.fbird-num-fields.php                      30-May-2024 18:01                2196
function.fbird-num-params.php                      30-May-2024 18:01                2356
function.fbird-param-info.php                      30-May-2024 18:01                2361
function.fbird-pconnect.php                        30-May-2024 18:01                2311
function.fbird-prepare.php                         30-May-2024 18:01                1788
function.fbird-query.php                           30-May-2024 18:01                2629
function.fbird-restore.php                         30-May-2024 18:01                1795
function.fbird-rollback-ret.php                    30-May-2024 18:01                1847
function.fbird-rollback.php                        30-May-2024 18:01                1819
function.fbird-server-info.php                     30-May-2024 18:01                1850
function.fbird-service-attach.php                  30-May-2024 18:01                1889
function.fbird-service-detach.php                  30-May-2024 18:01                1901
function.fbird-set-event-handler.php               30-May-2024 18:01                2471
function.fbird-trans.php                           30-May-2024 18:01                1794
function.fbird-wait-event.php                      30-May-2024 18:01                2396
function.fclose.php                                30-May-2024 18:01                4501
function.fdatasync.php                             30-May-2024 18:01                6060
function.fdf-add-doc-javascript.php                30-May-2024 18:01                5617
function.fdf-add-template.php                      30-May-2024 18:01                2937
function.fdf-close.php                             30-May-2024 18:01                3143
function.fdf-create.php                            30-May-2024 18:01                3830
function.fdf-enum-values.php                       30-May-2024 18:01                2520
function.fdf-errno.php                             30-May-2024 18:01                2847
function.fdf-error.php                             30-May-2024 18:01                3333
function.fdf-get-ap.php                            30-May-2024 18:01                4449
function.fdf-get-attachment.php                    30-May-2024 18:01                6099
function.fdf-get-encoding.php                      30-May-2024 18:01                3466
function.fdf-get-file.php                          30-May-2024 18:01                3305
function.fdf-get-flags.php                         30-May-2024 18:01                2435
function.fdf-get-opt.php                           30-May-2024 18:01                2477
function.fdf-get-status.php                        30-May-2024 18:01                3318
function.fdf-get-value.php                         30-May-2024 18:01                4671
function.fdf-get-version.php                       30-May-2024 18:01                3680
function.fdf-header.php                            30-May-2024 18:01                2358
function.fdf-next-field-name.php                   30-May-2024 18:01                4398
function.fdf-open-string.php                       30-May-2024 18:01                4871
function.fdf-open.php                              30-May-2024 18:01                4657
function.fdf-remove-item.php                       30-May-2024 18:01                2441
function.fdf-save-string.php                       30-May-2024 18:01                5666
function.fdf-save.php                              30-May-2024 18:01                4178
function.fdf-set-ap.php                            30-May-2024 18:01                4714
function.fdf-set-encoding.php                      30-May-2024 18:01                3827
function.fdf-set-file.php                          30-May-2024 18:01                5483
function.fdf-set-flags.php                         30-May-2024 18:01                4469
function.fdf-set-javascript-action.php             30-May-2024 18:01                4673
function.fdf-set-on-import-javascript.php          30-May-2024 18:01                3231
function.fdf-set-opt.php                           30-May-2024 18:01                4754
function.fdf-set-status.php                        30-May-2024 18:01                3866
function.fdf-set-submit-form-action.php            30-May-2024 18:01                4969
function.fdf-set-target-frame.php                  30-May-2024 18:01                3838
function.fdf-set-value.php                         30-May-2024 18:01                5325
function.fdf-set-version.php                       30-May-2024 18:01                4079
function.fdiv.php                                  30-May-2024 18:01                6560
function.feof.php                                  30-May-2024 18:01                7841
function.fflush.php                                30-May-2024 18:01                5725
function.fgetc.php                                 30-May-2024 18:01                6738
function.fgetcsv.php                               30-May-2024 18:01               13304
function.fgets.php                                 30-May-2024 18:01                8643
function.fgetss.php                                30-May-2024 18:01                9614
function.file-exists.php                           30-May-2024 18:01                7276
function.file-get-contents.php                     30-May-2024 18:01               19009
function.file-put-contents.php                     30-May-2024 18:01               13515
function.file.php                                  30-May-2024 18:01               12309
function.fileatime.php                             30-May-2024 18:01                7066
function.filectime.php                             30-May-2024 18:01                7106
function.filegroup.php                             30-May-2024 18:01                5992
function.fileinode.php                             30-May-2024 18:01                5399
function.filemtime.php                             30-May-2024 18:01                6835
function.fileowner.php                             30-May-2024 18:01                5789
function.fileperms.php                             30-May-2024 18:01               16573
function.filesize.php                              30-May-2024 18:01                5856
function.filetype.php                              30-May-2024 18:01                6851
function.filter-has-var.php                        30-May-2024 18:01                3460
function.filter-id.php                             30-May-2024 18:01                2995
function.filter-input-array.php                    30-May-2024 18:01               13574
function.filter-input.php                          30-May-2024 18:01                8716
function.filter-list.php                           30-May-2024 18:01                3766
function.filter-var-array.php                      30-May-2024 18:01               12427
function.filter-var.php                            30-May-2024 18:01               14513
function.finfo-buffer.php                          30-May-2024 18:01                8492
function.finfo-close.php                           30-May-2024 18:01                3637
function.finfo-file.php                            30-May-2024 18:01                9360
function.finfo-open.php                            30-May-2024 18:01               10473
function.finfo-set-flags.php                       30-May-2024 18:01                4702
function.floatval.php                              30-May-2024 18:01                6918
function.flock.php                                 30-May-2024 18:01               13446
function.floor.php                                 30-May-2024 18:01                5071
function.flush.php                                 30-May-2024 18:01                4693
function.fmod.php                                  30-May-2024 18:01                5036
function.fnmatch.php                               30-May-2024 18:01               11114
function.fopen.php                                 30-May-2024 18:01               23992
function.forward-static-call-array.php             30-May-2024 18:01                9550
function.forward-static-call.php                   30-May-2024 18:01                8877
function.fpassthru.php                             30-May-2024 18:01                7390
function.fpm-get-status.php                        30-May-2024 18:01                2832
function.fprintf.php                               30-May-2024 18:01               23826
function.fputcsv.php                               30-May-2024 18:01               10469
function.fputs.php                                 30-May-2024 18:01                1677
function.fread.php                                 30-May-2024 18:01               14938
function.frenchtojd.php                            30-May-2024 18:01                4230
function.fscanf.php                                30-May-2024 18:01                9633
function.fseek.php                                 30-May-2024 18:01                8096
function.fsockopen.php                             30-May-2024 18:01               17685
function.fstat.php                                 30-May-2024 18:01                6251
function.fsync.php                                 30-May-2024 18:01                5822
function.ftell.php                                 30-May-2024 18:01                6227
function.ftok.php                                  30-May-2024 18:01                3836
function.ftp-alloc.php                             30-May-2024 18:01                8662
function.ftp-append.php                            30-May-2024 18:01                4644
function.ftp-cdup.php                              30-May-2024 18:01                6713
function.ftp-chdir.php                             30-May-2024 18:01                7629
function.ftp-chmod.php                             30-May-2024 18:01                7165
function.ftp-close.php                             30-May-2024 18:01                6143
function.ftp-connect.php                           30-May-2024 18:01                6752
function.ftp-delete.php                            30-May-2024 18:01                6349
function.ftp-exec.php                              30-May-2024 18:01                6849
function.ftp-fget.php                              30-May-2024 18:01               10230
function.ftp-fput.php                              30-May-2024 18:01                9606
function.ftp-get-option.php                        30-May-2024 18:01                6270
function.ftp-get.php                               30-May-2024 18:01                9529
function.ftp-login.php                             30-May-2024 18:01                6978
function.ftp-mdtm.php                              30-May-2024 18:01                7228
function.ftp-mkdir.php                             30-May-2024 18:01                7072
function.ftp-mlsd.php                              30-May-2024 18:01                9258
function.ftp-nb-continue.php                       30-May-2024 18:01                5591
function.ftp-nb-fget.php                           30-May-2024 18:01               10720
function.ftp-nb-fput.php                           30-May-2024 18:01               10477
function.ftp-nb-get.php                            30-May-2024 18:01               14504
function.ftp-nb-put.php                            30-May-2024 18:01               11814
function.ftp-nlist.php                             30-May-2024 18:01                7029
function.ftp-pasv.php                              30-May-2024 18:01                7443
function.ftp-put.php                               30-May-2024 18:01                9221
function.ftp-pwd.php                               30-May-2024 18:01                6108
function.ftp-quit.php                              30-May-2024 18:01                1696
function.ftp-raw.php                               30-May-2024 18:01                5718
function.ftp-rawlist.php                           30-May-2024 18:01                8391
function.ftp-rename.php                            30-May-2024 18:01                7284
function.ftp-rmdir.php                             30-May-2024 18:01                6698
function.ftp-set-option.php                        30-May-2024 18:01                7632
function.ftp-site.php                              30-May-2024 18:01                6867
function.ftp-size.php                              30-May-2024 18:01                6872
function.ftp-ssl-connect.php                       30-May-2024 18:01                9145
function.ftp-systype.php                           30-May-2024 18:01                5640
function.ftruncate.php                             30-May-2024 18:01                6578
function.func-get-arg.php                          30-May-2024 18:01               11420
function.func-get-args.php                         30-May-2024 18:01               11921
function.func-num-args.php                         30-May-2024 18:01                6095
function.function-exists.php                       30-May-2024 18:01                6392
function.fwrite.php                                30-May-2024 18:01               14934
function.gc-collect-cycles.php                     30-May-2024 18:01                2577
function.gc-disable.php                            30-May-2024 18:01                2619
function.gc-enable.php                             30-May-2024 18:01                2592
function.gc-enabled.php                            30-May-2024 18:01                3437
function.gc-mem-caches.php                         30-May-2024 18:01                2517
function.gc-status.php                             30-May-2024 18:01                8787                               30-May-2024 18:01                9504
function.geoip-asnum-by-name.php                   30-May-2024 18:01                4279
function.geoip-continent-code-by-name.php          30-May-2024 18:01                5786
function.geoip-country-code-by-name.php            30-May-2024 18:01                5513
function.geoip-country-code3-by-name.php           30-May-2024 18:01                5072
function.geoip-country-name-by-name.php            30-May-2024 18:01                5036
function.geoip-database-info.php                   30-May-2024 18:01                4361
function.geoip-db-avail.php                        30-May-2024 18:01                4577
function.geoip-db-filename.php                     30-May-2024 18:01                4237
function.geoip-db-get-all-info.php                 30-May-2024 18:01                6834
function.geoip-domain-by-name.php                  30-May-2024 18:01                4512
function.geoip-id-by-name.php                      30-May-2024 18:01                5584
function.geoip-isp-by-name.php                     30-May-2024 18:01                4516
function.geoip-netspeedcell-by-name.php            30-May-2024 18:01                5254
function.geoip-org-by-name.php                     30-May-2024 18:01                4535
function.geoip-record-by-name.php                  30-May-2024 18:01                7855
function.geoip-region-by-name.php                  30-May-2024 18:01                5196
function.geoip-region-name-by-code.php             30-May-2024 18:01                7265
function.geoip-setup-custom-directory.php          30-May-2024 18:01                4287
function.geoip-time-zone-by-country-and-region.php 30-May-2024 18:01                7475
function.get-browser.php                           30-May-2024 18:01                8952
function.get-called-class.php                      30-May-2024 18:01                6361
function.get-cfg-var.php                           30-May-2024 18:01                4016
function.get-class-methods.php                     30-May-2024 18:01                6985
function.get-class-vars.php                        30-May-2024 18:01                9822
function.get-class.php                             30-May-2024 18:01               13044
function.get-current-user.php                      30-May-2024 18:01                4453
function.get-debug-type.php                        30-May-2024 18:01                9578
function.get-declared-classes.php                  30-May-2024 18:01                5303
function.get-declared-interfaces.php               30-May-2024 18:01                4358
function.get-declared-traits.php                   30-May-2024 18:01                2889
function.get-defined-constants.php                 30-May-2024 18:01                7626
function.get-defined-functions.php                 30-May-2024 18:01                7199
function.get-defined-vars.php                      30-May-2024 18:01                6295
function.get-extension-funcs.php                   30-May-2024 18:01                5703
function.get-headers.php                           30-May-2024 18:01                9558
function.get-html-translation-table.php            30-May-2024 18:01               14606
function.get-include-path.php                      30-May-2024 18:01                4470
function.get-included-files.php                    30-May-2024 18:01                6048
function.get-loaded-extensions.php                 30-May-2024 18:01                5676
function.get-magic-quotes-gpc.php                  30-May-2024 18:01                4274
function.get-magic-quotes-runtime.php              30-May-2024 18:01                3750
function.get-mangled-object-vars.php               30-May-2024 18:01                8275
function.get-meta-tags.php                         30-May-2024 18:01                8198
function.get-object-vars.php                       30-May-2024 18:01                6322
function.get-parent-class.php                      30-May-2024 18:01                7931
function.get-required-files.php                    30-May-2024 18:01                1873
function.get-resource-id.php                       30-May-2024 18:01                4910
function.get-resource-type.php                     30-May-2024 18:01                4949
function.get-resources.php                         30-May-2024 18:01                8019
function.getallheaders.php                         30-May-2024 18:01                4758
function.getcwd.php                                30-May-2024 18:01                5580
function.getdate.php                               30-May-2024 18:01               10020
function.getenv.php                                30-May-2024 18:01                9034
function.gethostbyaddr.php                         30-May-2024 18:01                4476
function.gethostbyname.php                         30-May-2024 18:01                4628
function.gethostbynamel.php                        30-May-2024 18:01                5257
function.gethostname.php                           30-May-2024 18:01                4017
function.getimagesize.php                          30-May-2024 18:01               17524
function.getimagesizefromstring.php                30-May-2024 18:01                5761
function.getlastmod.php                            30-May-2024 18:01                5341
function.getmxrr.php                               30-May-2024 18:01                6166
function.getmygid.php                              30-May-2024 18:01                3497
function.getmyinode.php                            30-May-2024 18:01                3551
function.getmypid.php                              30-May-2024 18:01                3941
function.getmyuid.php                              30-May-2024 18:01                3505
function.getopt.php                                30-May-2024 18:01               15352
function.getprotobyname.php                        30-May-2024 18:01                4795
function.getprotobynumber.php                      30-May-2024 18:01                3447
function.getrandmax.php                            30-May-2024 18:01                3090
function.getrusage.php                             30-May-2024 18:01               11339
function.getservbyname.php                         30-May-2024 18:01                6606
function.getservbyport.php                         30-May-2024 18:01                3961
function.gettext.php                               30-May-2024 18:01                6004
function.gettimeofday.php                          30-May-2024 18:01                5124
function.gettype.php                               30-May-2024 18:01                9199
function.glob.php                                  30-May-2024 18:01               11149
function.gmdate.php                                30-May-2024 18:01                7918
function.gmmktime.php                              30-May-2024 18:01               11933
function.gmp-abs.php                               30-May-2024 18:01                4505
function.gmp-add.php                               30-May-2024 18:01                4822
function.gmp-and.php                               30-May-2024 18:01                5273
function.gmp-binomial.php                          30-May-2024 18:01                4047
function.gmp-clrbit.php                            30-May-2024 18:01                5535
function.gmp-cmp.php                               30-May-2024 18:01                5685
function.gmp-com.php                               30-May-2024 18:01                3997
function.gmp-div-q.php                             30-May-2024 18:01               10169
function.gmp-div-qr.php                            30-May-2024 18:01                6797
function.gmp-div-r.php                             30-May-2024 18:01                6205
function.gmp-div.php                               30-May-2024 18:01                1714
function.gmp-divexact.php                          30-May-2024 18:01                5914
function.gmp-export.php                            30-May-2024 18:01                5739
function.gmp-fact.php                              30-May-2024 18:01                4868
function.gmp-gcd.php                               30-May-2024 18:01                5203
function.gmp-gcdext.php                            30-May-2024 18:01                9357
function.gmp-hamdist.php                           30-May-2024 18:01                6554
function.gmp-import.php                            30-May-2024 18:01                6058
function.gmp-init.php                              30-May-2024 18:01                5671
function.gmp-intval.php                            30-May-2024 18:01                5366
function.gmp-invert.php                            30-May-2024 18:01                5407
function.gmp-jacobi.php                            30-May-2024 18:01                5716
function.gmp-kronecker.php                         30-May-2024 18:01                4028
function.gmp-lcm.php                               30-May-2024 18:01                3798
function.gmp-legendre.php                          30-May-2024 18:01                5735
function.gmp-mod.php                               30-May-2024 18:01                4946
function.gmp-mul.php                               30-May-2024 18:01                5028
function.gmp-neg.php                               30-May-2024 18:01                4453
function.gmp-nextprime.php                         30-May-2024 18:01                5112
function.gmp-or.php                                30-May-2024 18:01                5487
function.gmp-perfect-power.php                     30-May-2024 18:01                3397
function.gmp-perfect-square.php                    30-May-2024 18:01                5658
function.gmp-popcount.php                          30-May-2024 18:01                4948
function.gmp-pow.php                               30-May-2024 18:01                5806
function.gmp-powm.php                              30-May-2024 18:01                5882
function.gmp-prob-prime.php                        30-May-2024 18:01                5824
function.gmp-random-bits.php                       30-May-2024 18:01                6157
function.gmp-random-range.php                      30-May-2024 18:01                7522
function.gmp-random-seed.php                       30-May-2024 18:01                7590
function.gmp-random.php                            30-May-2024 18:01                6524
function.gmp-root.php                              30-May-2024 18:01                3238
function.gmp-rootrem.php                           30-May-2024 18:01                3404
function.gmp-scan0.php                             30-May-2024 18:01                5613
function.gmp-scan1.php                             30-May-2024 18:01                5625
function.gmp-setbit.php                            30-May-2024 18:01               11695
function.gmp-sign.php                              30-May-2024 18:01                5209
function.gmp-sqrt.php                              30-May-2024 18:01                5025
function.gmp-sqrtrem.php                           30-May-2024 18:01                6405
function.gmp-strval.php                            30-May-2024 18:01                4769
function.gmp-sub.php                               30-May-2024 18:01                5100
function.gmp-testbit.php                           30-May-2024 18:01                6064
function.gmp-xor.php                               30-May-2024 18:01                5493
function.gmstrftime.php                            30-May-2024 18:01                9460
function.gnupg-adddecryptkey.php                   30-May-2024 18:01                5462
function.gnupg-addencryptkey.php                   30-May-2024 18:01                5032
function.gnupg-addsignkey.php                      30-May-2024 18:01                5500
function.gnupg-cleardecryptkeys.php                30-May-2024 18:01                4555
function.gnupg-clearencryptkeys.php                30-May-2024 18:01                4559
function.gnupg-clearsignkeys.php                   30-May-2024 18:01                4497
function.gnupg-decrypt.php                         30-May-2024 18:01                6246
function.gnupg-decryptverify.php                   30-May-2024 18:01                7404
function.gnupg-deletekey.php                       30-May-2024 18:01                5308
function.gnupg-encrypt.php                         30-May-2024 18:01                6163
function.gnupg-encryptsign.php                     30-May-2024 18:01                7090
function.gnupg-export.php                          30-May-2024 18:01                5353
function.gnupg-getengineinfo.php                   30-May-2024 18:01                5728
function.gnupg-geterror.php                        30-May-2024 18:01                4463
function.gnupg-geterrorinfo.php                    30-May-2024 18:01                5836
function.gnupg-getprotocol.php                     30-May-2024 18:01                4554
function.gnupg-gettrustlist.php                    30-May-2024 18:01                5429
function.gnupg-import.php                          30-May-2024 18:01                5599
function.gnupg-init.php                            30-May-2024 18:01                7478
function.gnupg-keyinfo.php                         30-May-2024 18:01                5526
function.gnupg-listsignatures.php                  30-May-2024 18:01                5634
function.gnupg-setarmor.php                        30-May-2024 18:01                5847
function.gnupg-seterrormode.php                    30-May-2024 18:01                5839
function.gnupg-setsignmode.php                     30-May-2024 18:01                5907
function.gnupg-sign.php                            30-May-2024 18:01                6363
function.gnupg-verify.php                          30-May-2024 18:01                8596
function.grapheme-extract.php                      30-May-2024 18:01                9024
function.grapheme-stripos.php                      30-May-2024 18:01                8285
function.grapheme-stristr.php                      30-May-2024 18:01                7905
function.grapheme-strlen.php                       30-May-2024 18:01                5640
function.grapheme-strpos.php                       30-May-2024 18:01                7957
function.grapheme-strripos.php                     30-May-2024 18:01                7739
function.grapheme-strrpos.php                      30-May-2024 18:01                7403
function.grapheme-strstr.php                       30-May-2024 18:01                7554
function.grapheme-substr.php                       30-May-2024 18:01                8161
function.gregoriantojd.php                         30-May-2024 18:01                8233
function.gzclose.php                               30-May-2024 18:01                4387
function.gzcompress.php                            30-May-2024 18:01                6224
function.gzdecode.php                              30-May-2024 18:01                3903
function.gzdeflate.php                             30-May-2024 18:01                5919
function.gzencode.php                              30-May-2024 18:01                7101
function.gzeof.php                                 30-May-2024 18:01                4264
function.gzfile.php                                30-May-2024 18:01                4937
function.gzgetc.php                                30-May-2024 18:01                4811
function.gzgets.php                                30-May-2024 18:01                6213
function.gzgetss.php                               30-May-2024 18:01                6278
function.gzinflate.php                             30-May-2024 18:01                5658
function.gzopen.php                                30-May-2024 18:01                5833
function.gzpassthru.php                            30-May-2024 18:01                4875
function.gzputs.php                                30-May-2024 18:01                1681
function.gzread.php                                30-May-2024 18:01                6837
function.gzrewind.php                              30-May-2024 18:01                3370
function.gzseek.php                                30-May-2024 18:01                6607
function.gztell.php                                30-May-2024 18:01                3590
function.gzuncompress.php                          30-May-2024 18:01                5499
function.gzwrite.php                               30-May-2024 18:01                6857
function.halt-compiler.php                         30-May-2024 18:01                5429
function.hash-algos.php                            30-May-2024 18:01                5915
function.hash-copy.php                             30-May-2024 18:01                5638
function.hash-equals.php                           30-May-2024 18:01                7404
function.hash-file.php                             30-May-2024 18:01                7797
function.hash-final.php                            30-May-2024 18:01                5032
function.hash-hkdf.php                             30-May-2024 18:01                9946
function.hash-hmac-algos.php                       30-May-2024 18:01                5386
function.hash-hmac-file.php                        30-May-2024 18:01                8518
function.hash-hmac.php                             30-May-2024 18:01                8305
function.hash-init.php                             30-May-2024 18:01               11057
function.hash-pbkdf2.php                           30-May-2024 18:01               12789
function.hash-update-file.php                      30-May-2024 18:01                5993
function.hash-update-stream.php                    30-May-2024 18:01                7616
function.hash-update.php                           30-May-2024 18:01                4548
function.hash.php                                  30-May-2024 18:01                7664
function.header-register-callback.php              30-May-2024 18:01                6921
function.header-remove.php                         30-May-2024 18:01                6919
function.header.php                                30-May-2024 18:01               20612
function.headers-list.php                          30-May-2024 18:01                6185
function.headers-sent.php                          30-May-2024 18:01                8525
function.hebrev.php                                30-May-2024 18:01                3466
function.hebrevc.php                               30-May-2024 18:01                3918
function.hex2bin.php                               30-May-2024 18:01                5178
function.hexdec.php                                30-May-2024 18:01                6735
function.highlight-file.php                        30-May-2024 18:01                6391
function.highlight-string.php                      30-May-2024 18:01                7219
function.hrtime.php                                30-May-2024 18:01                5284
function.html-entity-decode.php                    30-May-2024 18:01               15344
function.htmlentities.php                          30-May-2024 18:01               18526
function.htmlspecialchars-decode.php               30-May-2024 18:01                9787
function.htmlspecialchars.php                      30-May-2024 18:01               23759
function.http-build-query.php                      30-May-2024 18:01               20462
function.http-response-code.php                    30-May-2024 18:01                7141
function.hypot.php                                 30-May-2024 18:01                3056
function.ibase-add-user.php                        30-May-2024 18:01                5279
function.ibase-affected-rows.php                   30-May-2024 18:01                3553
function.ibase-backup.php                          30-May-2024 18:01               10700
function.ibase-blob-add.php                        30-May-2024 18:01                4135
function.ibase-blob-cancel.php                     30-May-2024 18:01                3852
function.ibase-blob-close.php                      30-May-2024 18:01                4076
function.ibase-blob-create.php                     30-May-2024 18:01                4227
function.ibase-blob-echo.php                       30-May-2024 18:01                4353
function.ibase-blob-get.php                        30-May-2024 18:01                6720
function.ibase-blob-import.php                     30-May-2024 18:01                8195
function.ibase-blob-info.php                       30-May-2024 18:01                3648
function.ibase-blob-open.php                       30-May-2024 18:01                4571
function.ibase-close.php                           30-May-2024 18:01                3959
function.ibase-commit-ret.php                      30-May-2024 18:01                3438
function.ibase-commit.php                          30-May-2024 18:01                3214
function.ibase-connect.php                         30-May-2024 18:01               10793
function.ibase-db-info.php                         30-May-2024 18:01                2783
function.ibase-delete-user.php                     30-May-2024 18:01                3695
function.ibase-drop-db.php                         30-May-2024 18:01                3826
function.ibase-errcode.php                         30-May-2024 18:01                2766
function.ibase-errmsg.php                          30-May-2024 18:01                2749
function.ibase-execute.php                         30-May-2024 18:01                7180
function.ibase-fetch-assoc.php                     30-May-2024 18:01                5006
function.ibase-fetch-object.php                    30-May-2024 18:01                6837
function.ibase-fetch-row.php                       30-May-2024 18:01                4678
function.ibase-field-info.php                      30-May-2024 18:01                7024
function.ibase-free-event-handler.php              30-May-2024 18:01                3659
function.ibase-free-query.php                      30-May-2024 18:01                2915
function.ibase-free-result.php                     30-May-2024 18:01                3013
function.ibase-gen-id.php                          30-May-2024 18:01                2925
function.ibase-maintain-db.php                     30-May-2024 18:01                3223
function.ibase-modify-user.php                     30-May-2024 18:01                5291
function.ibase-name-result.php                     30-May-2024 18:01                5918
function.ibase-num-fields.php                      30-May-2024 18:01                6463
function.ibase-num-params.php                      30-May-2024 18:01                3581
function.ibase-param-info.php                      30-May-2024 18:01                3805
function.ibase-pconnect.php                        30-May-2024 18:01                8247
function.ibase-prepare.php                         30-May-2024 18:01                4818
function.ibase-query.php                           30-May-2024 18:01                7506
function.ibase-restore.php                         30-May-2024 18:01               10992
function.ibase-rollback-ret.php                    30-May-2024 18:01                3475
function.ibase-rollback.php                        30-May-2024 18:01                3253
function.ibase-server-info.php                     30-May-2024 18:01                9935
function.ibase-service-attach.php                  30-May-2024 18:01               11145
function.ibase-service-detach.php                  30-May-2024 18:01                6170
function.ibase-set-event-handler.php               30-May-2024 18:01                8073
function.ibase-trans.php                           30-May-2024 18:01                6167
function.ibase-wait-event.php                      30-May-2024 18:01                4481
function.iconv-get-encoding.php                    30-May-2024 18:01                5875
function.iconv-mime-decode-headers.php             30-May-2024 18:01               10526
function.iconv-mime-decode.php                     30-May-2024 18:01                8418
function.iconv-mime-encode.php                     30-May-2024 18:01               12061
function.iconv-set-encoding.php                    30-May-2024 18:01                5127
function.iconv-strlen.php                          30-May-2024 18:01                5116
function.iconv-strpos.php                          30-May-2024 18:01                7614
function.iconv-strrpos.php                         30-May-2024 18:01                6847
function.iconv-substr.php                          30-May-2024 18:01                8541
function.iconv.php                                 30-May-2024 18:01                9311
function.idate.php                                 30-May-2024 18:01               11926
function.idn-to-ascii.php                          30-May-2024 18:01                8002
function.idn-to-utf8.php                           30-May-2024 18:01                8019
function.igbinary-serialize.php                    30-May-2024 18:01                9823
function.igbinary-unserialize.php                  30-May-2024 18:01                9938
function.ignore-user-abort.php                     30-May-2024 18:01                7926
function.image-type-to-extension.php               30-May-2024 18:01                5477
function.image-type-to-mime-type.php               30-May-2024 18:01                9109
function.image2wbmp.php                            30-May-2024 18:01                6633
function.imageaffine.php                           30-May-2024 18:01                4943
function.imageaffinematrixconcat.php               30-May-2024 18:01                6708
function.imageaffinematrixget.php                  30-May-2024 18:01                6779
function.imagealphablending.php                    30-May-2024 18:01                7734
function.imageantialias.php                        30-May-2024 18:01               10931
function.imagearc.php                              30-May-2024 18:01               13847
function.imageavif.php                             30-May-2024 18:01                6292
function.imagebmp.php                              30-May-2024 18:01                8290
function.imagechar.php                             30-May-2024 18:01               10418
function.imagecharup.php                           30-May-2024 18:01               10154
function.imagecolorallocate.php                    30-May-2024 18:01               10257
function.imagecolorallocatealpha.php               30-May-2024 18:01               18308
function.imagecolorat.php                          30-May-2024 18:01               10598
function.imagecolorclosest.php                     30-May-2024 18:01               12407
function.imagecolorclosestalpha.php                30-May-2024 18:01               12704
function.imagecolorclosesthwb.php                  30-May-2024 18:01                6705
function.imagecolordeallocate.php                  30-May-2024 18:01                5998
function.imagecolorexact.php                       30-May-2024 18:01                8645
function.imagecolorexactalpha.php                  30-May-2024 18:01                9508
function.imagecolormatch.php                       30-May-2024 18:01                8548
function.imagecolorresolve.php                     30-May-2024 18:01                7868
function.imagecolorresolvealpha.php                30-May-2024 18:01                8465
function.imagecolorset.php                         30-May-2024 18:01                9018
function.imagecolorsforindex.php                   30-May-2024 18:01                7568
function.imagecolorstotal.php                      30-May-2024 18:01                5978
function.imagecolortransparent.php                 30-May-2024 18:01                9297
function.imageconvolution.php                      30-May-2024 18:01               11935
function.imagecopy.php                             30-May-2024 18:01                9600
function.imagecopymerge.php                        30-May-2024 18:01                9772
function.imagecopymergegray.php                    30-May-2024 18:01               10295
function.imagecopyresampled.php                    30-May-2024 18:01               19318
function.imagecopyresized.php                      30-May-2024 18:01               14626
function.imagecreate.php                           30-May-2024 18:01                8467
function.imagecreatefromavif.php                   30-May-2024 18:01                2953
function.imagecreatefrombmp.php                    30-May-2024 18:01                5735
function.imagecreatefromgd.php                     30-May-2024 18:01                6308
function.imagecreatefromgd2.php                    30-May-2024 18:01                6576
function.imagecreatefromgd2part.php                30-May-2024 18:01                9141
function.imagecreatefromgif.php                    30-May-2024 18:01               10018
function.imagecreatefromjpeg.php                   30-May-2024 18:01                9562
function.imagecreatefrompng.php                    30-May-2024 18:01                9503
function.imagecreatefromstring.php                 30-May-2024 18:01                8167
function.imagecreatefromtga.php                    30-May-2024 18:01                3596
function.imagecreatefromwbmp.php                   30-May-2024 18:01                9538
function.imagecreatefromwebp.php                   30-May-2024 18:01                5887
function.imagecreatefromxbm.php                    30-May-2024 18:01                5727
function.imagecreatefromxpm.php                    30-May-2024 18:01                6372
function.imagecreatetruecolor.php                  30-May-2024 18:01                7277
function.imagecrop.php                             30-May-2024 18:01                7899
function.imagecropauto.php                         30-May-2024 18:01               10791
function.imagedashedline.php                       30-May-2024 18:01               13023
function.imagedestroy.php                          30-May-2024 18:01                5256
function.imageellipse.php                          30-May-2024 18:01               10279
function.imagefill.php                             30-May-2024 18:01                7821
function.imagefilledarc.php                        30-May-2024 18:01               19136
function.imagefilledellipse.php                    30-May-2024 18:01                9972
function.imagefilledpolygon.php                    30-May-2024 18:01               12418
function.imagefilledrectangle.php                  30-May-2024 18:01                8628
function.imagefilltoborder.php                     30-May-2024 18:01               11576
function.imagefilter.php                           30-May-2024 18:01               34080
function.imageflip.php                             30-May-2024 18:01                9929
function.imagefontheight.php                       30-May-2024 18:01                6731
function.imagefontwidth.php                        30-May-2024 18:01                6717
function.imageftbbox.php                           30-May-2024 18:01               14270
function.imagefttext.php                           30-May-2024 18:01               15962
function.imagegammacorrect.php                     30-May-2024 18:01                6152
function.imagegd.php                               30-May-2024 18:01               10836
function.imagegd2.php                              30-May-2024 18:01               11790
function.imagegetclip.php                          30-May-2024 18:01                6159
function.imagegetinterpolation.php                 30-May-2024 18:01                3785
function.imagegif.php                              30-May-2024 18:01               17025
function.imagegrabscreen.php                       30-May-2024 18:01                4854
function.imagegrabwindow.php                       30-May-2024 18:01                9969
function.imageinterlace.php                        30-May-2024 18:01                7404
function.imageistruecolor.php                      30-May-2024 18:01                7449
function.imagejpeg.php                             30-May-2024 18:01               15449
function.imagelayereffect.php                      30-May-2024 18:01               12136
function.imageline.php                             30-May-2024 18:01               15733
function.imageloadfont.php                         30-May-2024 18:01                9607
function.imageopenpolygon.php                      30-May-2024 18:01               10619
function.imagepalettecopy.php                      30-May-2024 18:01                7509
function.imagepalettetotruecolor.php               30-May-2024 18:01                9875
function.imagepng.php                              30-May-2024 18:01                9428
function.imagepolygon.php                          30-May-2024 18:01               10974
function.imagerectangle.php                        30-May-2024 18:01               10757
function.imageresolution.php                       30-May-2024 18:01                8051
function.imagerotate.php                           30-May-2024 18:01                9283
function.imagesavealpha.php                        30-May-2024 18:01                7877
function.imagescale.php                            30-May-2024 18:01                6934
function.imagesetbrush.php                         30-May-2024 18:01                9562
function.imagesetclip.php                          30-May-2024 18:01                5362
function.imagesetinterpolation.php                 30-May-2024 18:01               11688
function.imagesetpixel.php                         30-May-2024 18:01               11644
function.imagesetstyle.php                         30-May-2024 18:01               12537
function.imagesetthickness.php                     30-May-2024 18:01                8550
function.imagesettile.php                          30-May-2024 18:01                8583
function.imagestring.php                           30-May-2024 18:01               10494
function.imagestringup.php                         30-May-2024 18:01                9674
function.imagesx.php                               30-May-2024 18:01                5191
function.imagesy.php                               30-May-2024 18:01                5205
function.imagetruecolortopalette.php               30-May-2024 18:01                6997
function.imagettfbbox.php                          30-May-2024 18:01               20098
function.imagettftext.php                          30-May-2024 18:01               19014
function.imagetypes.php                            30-May-2024 18:01                5247
function.imagewbmp.php                             30-May-2024 18:01               15379
function.imagewebp.php                             30-May-2024 18:01                7678
function.imagexbm.php                              30-May-2024 18:01               11959
function.imap-8bit.php                             30-May-2024 18:01                3277
function.imap-alerts.php                           30-May-2024 18:01                3336
function.imap-append.php                           30-May-2024 18:01               10059
function.imap-base64.php                           30-May-2024 18:01                3609
function.imap-binary.php                           30-May-2024 18:01                3256
function.imap-body.php                             30-May-2024 18:01                5855
function.imap-bodystruct.php                       30-May-2024 18:01                4866
function.imap-check.php                            30-May-2024 18:01                6193
function.imap-clearflag-full.php                   30-May-2024 18:01                6623
function.imap-close.php                            30-May-2024 18:01                5201
function.imap-create.php                           30-May-2024 18:01                1785
function.imap-createmailbox.php                    30-May-2024 18:01               14144
function.imap-delete.php                           30-May-2024 18:01               10897
function.imap-deletemailbox.php                    30-May-2024 18:01                5103
function.imap-errors.php                           30-May-2024 18:01                3536
function.imap-expunge.php                          30-May-2024 18:01                3738
function.imap-fetch-overview.php                   30-May-2024 18:01               11815
function.imap-fetchbody.php                        30-May-2024 18:01                6521
function.imap-fetchheader.php                      30-May-2024 18:01                5988
function.imap-fetchmime.php                        30-May-2024 18:01                6494
function.imap-fetchstructure.php                   30-May-2024 18:01               10254
function.imap-fetchtext.php                        30-May-2024 18:01                1766
function.imap-gc.php                               30-May-2024 18:01                5975
function.imap-get-quota.php                        30-May-2024 18:01               12635
function.imap-get-quotaroot.php                    30-May-2024 18:01                9339
function.imap-getacl.php                           30-May-2024 18:01                6151
function.imap-getmailboxes.php                     30-May-2024 18:01               12627
function.imap-getsubscribed.php                    30-May-2024 18:01                8294
function.imap-header.php                           30-May-2024 18:01                1976
function.imap-headerinfo.php                       30-May-2024 18:01               12512
function.imap-headers.php                          30-May-2024 18:01                3668
function.imap-is-open.php                          30-May-2024 18:01                4239
function.imap-last-error.php                       30-May-2024 18:01                3274
function.imap-list.php                             30-May-2024 18:01                8894
function.imap-listmailbox.php                      30-May-2024 18:01                1772
function.imap-listscan.php                         30-May-2024 18:01                7128
function.imap-listsubscribed.php                   30-May-2024 18:01                1793
function.imap-lsub.php                             30-May-2024 18:01                6204
function.imap-mail-compose.php                     30-May-2024 18:01               16959
function.imap-mail-copy.php                        30-May-2024 18:01                6639
function.imap-mail-move.php                        30-May-2024 18:01                6995
function.imap-mail.php                             30-May-2024 18:01                7609
function.imap-mailboxmsginfo.php                   30-May-2024 18:01                9569
function.imap-mime-header-decode.php               30-May-2024 18:01                6558
function.imap-msgno.php                            30-May-2024 18:01                4245
function.imap-mutf7-to-utf8.php                    30-May-2024 18:01                3398
function.imap-num-msg.php                          30-May-2024 18:01                4153
function.imap-num-recent.php                       30-May-2024 18:01                3985
function.imap-open.php                             30-May-2024 18:01               22747
function.imap-ping.php                             30-May-2024 18:01                5119
function.imap-qprint.php                           30-May-2024 18:01                3292
function.imap-rename.php                           30-May-2024 18:01                1787
function.imap-renamemailbox.php                    30-May-2024 18:01                5863
function.imap-reopen.php                           30-May-2024 18:01                9183
function.imap-rfc822-parse-adrlist.php             30-May-2024 18:01                8049
function.imap-rfc822-parse-headers.php             30-May-2024 18:01                3779
function.imap-rfc822-write-address.php             30-May-2024 18:01                5627
function.imap-savebody.php                         30-May-2024 18:01                6866
function.imap-scan.php                             30-May-2024 18:01                1753
function.imap-scanmailbox.php                      30-May-2024 18:01                1784
function.imap-search.php                           30-May-2024 18:01               14099
function.imap-set-quota.php                        30-May-2024 18:01                7008
function.imap-setacl.php                           30-May-2024 18:01                5837
function.imap-setflag-full.php                     30-May-2024 18:01                8897
function.imap-sort.php                             30-May-2024 18:01                9063
function.imap-status.php                           30-May-2024 18:01               11146
function.imap-subscribe.php                        30-May-2024 18:01                4592
function.imap-thread.php                           30-May-2024 18:01                8096
function.imap-timeout.php                          30-May-2024 18:01                4889
function.imap-uid.php                              30-May-2024 18:01                4747
function.imap-undelete.php                         30-May-2024 18:01                5148
function.imap-unsubscribe.php                      30-May-2024 18:01                4673
function.imap-utf7-decode.php                      30-May-2024 18:01                3722
function.imap-utf7-encode.php                      30-May-2024 18:01                3357
function.imap-utf8-to-mutf7.php                    30-May-2024 18:01                3401
function.imap-utf8.php                             30-May-2024 18:01                4396
function.implode.php                               30-May-2024 18:01                8097                              30-May-2024 18:01               12010
function.include-once.php                          30-May-2024 18:01                2268
function.include.php                               30-May-2024 18:01               20683
function.inet-ntop.php                             30-May-2024 18:01                6498
function.inet-pton.php                             30-May-2024 18:01                5059
function.inflate-add.php                           30-May-2024 18:01                6312
function.inflate-get-read-len.php                  30-May-2024 18:01                3518
function.inflate-get-status.php                    30-May-2024 18:01                3281
function.inflate-init.php                          30-May-2024 18:01                7137
function.ini-alter.php                             30-May-2024 18:01                1732
function.ini-get-all.php                           30-May-2024 18:01               10379
function.ini-get.php                               30-May-2024 18:01               10579
function.ini-parse-quantity.php                    30-May-2024 18:01                7629
function.ini-restore.php                           30-May-2024 18:01                6452
function.ini-set.php                               30-May-2024 18:01                6763
function.inotify-add-watch.php                     30-May-2024 18:01                4507
function.inotify-init.php                          30-May-2024 18:01                9000
function.inotify-queue-len.php                     30-May-2024 18:01                3870
function.inotify-read.php                          30-May-2024 18:01                4468
function.inotify-rm-watch.php                      30-May-2024 18:01                3744
function.intdiv.php                                30-May-2024 18:01                7634
function.interface-exists.php                      30-May-2024 18:01                5573
function.intl-error-name.php                       30-May-2024 18:01                5085
function.intl-get-error-code.php                   30-May-2024 18:01                4563
function.intl-get-error-message.php                30-May-2024 18:01                4574
function.intl-is-failure.php                       30-May-2024 18:01                5545
function.intval.php                                30-May-2024 18:01               14199
function.ip2long.php                               30-May-2024 18:01                9449
function.iptcembed.php                             30-May-2024 18:01               11833
function.iptcparse.php                             30-May-2024 18:01                4680                                  30-May-2024 18:01                7167                              30-May-2024 18:01                5817                               30-May-2024 18:01                5644                           30-May-2024 18:01               11232                          30-May-2024 18:01                6402                                30-May-2024 18:01                6825                             30-May-2024 18:01                1735                         30-May-2024 18:01                6641                               30-May-2024 18:01                6167                             30-May-2024 18:01                6319                              30-May-2024 18:01                6720                           30-May-2024 18:01                5481                                30-May-2024 18:01                6737                            30-May-2024 18:01                1728                           30-May-2024 18:01                5873                               30-May-2024 18:01                5835                               30-May-2024 18:01                1709                                30-May-2024 18:01                6678                               30-May-2024 18:01                6153                            30-May-2024 18:01               12316                             30-May-2024 18:01                7290                           30-May-2024 18:01                6556                               30-May-2024 18:01                1931                           30-May-2024 18:01                5315                             30-May-2024 18:01                8387                         30-May-2024 18:01                8507                             30-May-2024 18:01                6781                        30-May-2024 18:01               12745                            30-May-2024 18:01                2405                      30-May-2024 18:01                6944                           30-May-2024 18:01                6059                          30-May-2024 18:01                1756
function.isset.php                                 30-May-2024 18:01               16546
function.iterator-apply.php                        30-May-2024 18:01                6866
function.iterator-count.php                        30-May-2024 18:01                8814
function.iterator-to-array.php                     30-May-2024 18:01                8036
function.jddayofweek.php                           30-May-2024 18:01                4079
function.jdmonthname.php                           30-May-2024 18:01                5217
function.jdtofrench.php                            30-May-2024 18:01                3264
function.jdtogregorian.php                         30-May-2024 18:01                3300
function.jdtojewish.php                            30-May-2024 18:01                7685
function.jdtojulian.php                            30-May-2024 18:01                3270
function.jdtounix.php                              30-May-2024 18:01                4644
function.jewishtojd.php                            30-May-2024 18:01                4716
function.join.php                                  30-May-2024 18:01                1675
function.jpeg2wbmp.php                             30-May-2024 18:01                6791
function.json-decode.php                           30-May-2024 18:01               20872
function.json-encode.php                           30-May-2024 18:01               31786
function.json-last-error-msg.php                   30-May-2024 18:01                3181
function.json-last-error.php                       30-May-2024 18:01               14358
function.json-validate.php                         30-May-2024 18:01                8721
function.juliantojd.php                            30-May-2024 18:01                4849
function.key-exists.php                            30-May-2024 18:01                1752
function.key.php                                   30-May-2024 18:01                8158
function.krsort.php                                30-May-2024 18:01                9216
function.ksort.php                                 30-May-2024 18:01               11217
function.lcfirst.php                               30-May-2024 18:01                6146
function.lcg-value.php                             30-May-2024 18:01                5626
function.lchgrp.php                                30-May-2024 18:01                6129
function.lchown.php                                30-May-2024 18:01                5985
function.ldap-8859-to-t61.php                      30-May-2024 18:01                3455
function.ldap-add-ext.php                          30-May-2024 18:01                6011
function.ldap-add.php                              30-May-2024 18:01               10895
function.ldap-bind-ext.php                         30-May-2024 18:01                6287
function.ldap-bind.php                             30-May-2024 18:01                9929
function.ldap-close.php                            30-May-2024 18:01                1733
function.ldap-compare.php                          30-May-2024 18:01               10874
function.ldap-connect-wallet.php                   30-May-2024 18:01                4557
function.ldap-connect.php                          30-May-2024 18:01               10242
function.ldap-control-paged-result-response.php    30-May-2024 18:01                5980
function.ldap-control-paged-result.php             30-May-2024 18:01               14589
function.ldap-count-entries.php                    30-May-2024 18:01                5893
function.ldap-count-references.php                 30-May-2024 18:01                4872
function.ldap-delete-ext.php                       30-May-2024 18:01                5537
function.ldap-delete.php                           30-May-2024 18:01                5661
function.ldap-dn2ufn.php                           30-May-2024 18:01                2872
function.ldap-err2str.php                          30-May-2024 18:01                4751
function.ldap-errno.php                            30-May-2024 18:01                7755
function.ldap-error.php                            30-May-2024 18:01                4776
function.ldap-escape.php                           30-May-2024 18:01                6395
function.ldap-exop-passwd.php                      30-May-2024 18:01               10730
function.ldap-exop-refresh.php                     30-May-2024 18:01                5243
function.ldap-exop-sync.php                        30-May-2024 18:01                5705
function.ldap-exop-whoami.php                      30-May-2024 18:01                4017
function.ldap-exop.php                             30-May-2024 18:01               12585
function.ldap-explode-dn.php                       30-May-2024 18:01                3821
function.ldap-first-attribute.php                  30-May-2024 18:01                5653
function.ldap-first-entry.php                      30-May-2024 18:01                6071
function.ldap-first-reference.php                  30-May-2024 18:01                2419
function.ldap-free-result.php                      30-May-2024 18:01                4303
function.ldap-get-attributes.php                   30-May-2024 18:01                8507
function.ldap-get-dn.php                           30-May-2024 18:01                4453
function.ldap-get-entries.php                      30-May-2024 18:01                6548
function.ldap-get-option.php                       30-May-2024 18:01               16910
function.ldap-get-values-len.php                   30-May-2024 18:01                5750
function.ldap-get-values.php                       30-May-2024 18:01                9021
function.ldap-list.php                             30-May-2024 18:01               16323
function.ldap-mod-add.php                          30-May-2024 18:01                7224
function.ldap-mod-del.php                          30-May-2024 18:01                6683
function.ldap-mod-replace.php                      30-May-2024 18:01                7133
function.ldap-mod_add-ext.php                      30-May-2024 18:01                6000
function.ldap-mod_del-ext.php                      30-May-2024 18:01                6008
function.ldap-mod_replace-ext.php                  30-May-2024 18:01                6077
function.ldap-modify-batch.php                     30-May-2024 18:01               19175
function.ldap-modify.php                           30-May-2024 18:01                2144
function.ldap-next-attribute.php                   30-May-2024 18:01                5424
function.ldap-next-entry.php                       30-May-2024 18:01                6057
function.ldap-next-reference.php                   30-May-2024 18:01                2350
function.ldap-parse-exop.php                       30-May-2024 18:01                6123
function.ldap-parse-reference.php                  30-May-2024 18:01                2495
function.ldap-parse-result.php                     30-May-2024 18:01               10120
function.ldap-read.php                             30-May-2024 18:01               13640
function.ldap-rename-ext.php                       30-May-2024 18:01                6350
function.ldap-rename.php                           30-May-2024 18:01                7645
function.ldap-sasl-bind.php                        30-May-2024 18:01                7282
function.ldap-search.php                           30-May-2024 18:01               16627
function.ldap-set-option.php                       30-May-2024 18:01               19816
function.ldap-set-rebind-proc.php                  30-May-2024 18:01                3439
function.ldap-sort.php                             30-May-2024 18:01                7390
function.ldap-start-tls.php                        30-May-2024 18:01                2101
function.ldap-t61-to-8859.php                      30-May-2024 18:01                2246
function.ldap-unbind.php                           30-May-2024 18:01                3994
function.levenshtein.php                           30-May-2024 18:01               12739
function.libxml-clear-errors.php                   30-May-2024 18:01                2907
function.libxml-disable-entity-loader.php          30-May-2024 18:01                5025
function.libxml-get-errors.php                     30-May-2024 18:01               10764
function.libxml-get-external-entity-loader.php     30-May-2024 18:01                3530
function.libxml-get-last-error.php                 30-May-2024 18:01                3264
function.libxml-set-external-entity-loader.php     30-May-2024 18:01               10585
function.libxml-set-streams-context.php            30-May-2024 18:01                5117
function.libxml-use-internal-errors.php            30-May-2024 18:01                6741                                  30-May-2024 18:01                6164
function.linkinfo.php                              30-May-2024 18:01                4712
function.list.php                                  30-May-2024 18:01               17204
function.localeconv.php                            30-May-2024 18:01                9934
function.localtime.php                             30-May-2024 18:01                9648
function.log.php                                   30-May-2024 18:01                4110
function.log10.php                                 30-May-2024 18:01                2807
function.log1p.php                                 30-May-2024 18:01                3582
function.long2ip.php                               30-May-2024 18:01                4607
function.lstat.php                                 30-May-2024 18:01                6737
function.ltrim.php                                 30-May-2024 18:01                9730
function.lzf-compress.php                          30-May-2024 18:01                3011
function.lzf-decompress.php                        30-May-2024 18:01                3099
function.lzf-optimized-for.php                     30-May-2024 18:01                2291
function.mail.php                                  30-May-2024 18:01               27251
function.mailparse-determine-best-xfer-encoding..> 30-May-2024 18:01                4345
function.mailparse-msg-create.php                  30-May-2024 18:01                3438
function.mailparse-msg-extract-part-file.php       30-May-2024 18:01                5396
function.mailparse-msg-extract-part.php            30-May-2024 18:01                4190
function.mailparse-msg-extract-whole-part-file.php 30-May-2024 18:01                4205
function.mailparse-msg-free.php                    30-May-2024 18:01                3707
function.mailparse-msg-get-part-data.php           30-May-2024 18:01                2646
function.mailparse-msg-get-part.php                30-May-2024 18:01                2929
function.mailparse-msg-get-structure.php           30-May-2024 18:01                2666
function.mailparse-msg-parse-file.php              30-May-2024 18:01                4308
function.mailparse-msg-parse.php                   30-May-2024 18:01                3627
function.mailparse-rfc822-parse-addresses.php      30-May-2024 18:01                5748
function.mailparse-stream-encode.php               30-May-2024 18:01                6014
function.mailparse-uudecode-all.php                30-May-2024 18:01                6996
function.max.php                                   30-May-2024 18:01               12728
function.mb-check-encoding.php                     30-May-2024 18:01                5483
function.mb-chr.php                                30-May-2024 18:01                7178
function.mb-convert-case.php                       30-May-2024 18:01               12047
function.mb-convert-encoding.php                   30-May-2024 18:01               11671
function.mb-convert-kana.php                       30-May-2024 18:01               10288
function.mb-convert-variables.php                  30-May-2024 18:01                6747
function.mb-decode-mimeheader.php                  30-May-2024 18:01                3341
function.mb-decode-numericentity.php               30-May-2024 18:01               34115
function.mb-detect-encoding.php                    30-May-2024 18:01               16560
function.mb-detect-order.php                       30-May-2024 18:01                9105
function.mb-encode-mimeheader.php                  30-May-2024 18:01               10040
function.mb-encode-numericentity.php               30-May-2024 18:01               12844
function.mb-encoding-aliases.php                   30-May-2024 18:01                6462
function.mb-ereg-match.php                         30-May-2024 18:01                5690
function.mb-ereg-replace-callback.php              30-May-2024 18:01               12595
function.mb-ereg-replace.php                       30-May-2024 18:01                7439
function.mb-ereg-search-getpos.php                 30-May-2024 18:01                3949
function.mb-ereg-search-getregs.php                30-May-2024 18:01                4428
function.mb-ereg-search-init.php                   30-May-2024 18:01                6239
function.mb-ereg-search-pos.php                    30-May-2024 18:01                6084
function.mb-ereg-search-regs.php                   30-May-2024 18:01                5836
function.mb-ereg-search-setpos.php                 30-May-2024 18:01                4639
function.mb-ereg-search.php                        30-May-2024 18:01                5777
function.mb-ereg.php                               30-May-2024 18:01                6561
function.mb-eregi-replace.php                      30-May-2024 18:01                7323
function.mb-eregi.php                              30-May-2024 18:01                6605
function.mb-get-info.php                           30-May-2024 18:01                6379
function.mb-http-input.php                         30-May-2024 18:01                5084
function.mb-http-output.php                        30-May-2024 18:01                5147
function.mb-internal-encoding.php                  30-May-2024 18:01                7204
function.mb-language.php                           30-May-2024 18:01                6648
function.mb-list-encodings.php                     30-May-2024 18:01                5147
function.mb-ord.php                                30-May-2024 18:01                7003
function.mb-output-handler.php                     30-May-2024 18:01                5309
function.mb-parse-str.php                          30-May-2024 18:01                4754
function.mb-preferred-mime-name.php                30-May-2024 18:01                4605
function.mb-regex-encoding.php                     30-May-2024 18:01                4713
function.mb-regex-set-options.php                  30-May-2024 18:01                8693
function.mb-scrub.php                              30-May-2024 18:01                4260
function.mb-send-mail.php                          30-May-2024 18:01               10048
function.mb-split.php                              30-May-2024 18:01                4902
function.mb-str-pad.php                            30-May-2024 18:01                8594
function.mb-str-split.php                          30-May-2024 18:01                5477
function.mb-strcut.php                             30-May-2024 18:01                7695
function.mb-strimwidth.php                         30-May-2024 18:01                8158
function.mb-stripos.php                            30-May-2024 18:01                6708
function.mb-stristr.php                            30-May-2024 18:01                6993
function.mb-strlen.php                             30-May-2024 18:01                5286
function.mb-strpos.php                             30-May-2024 18:01                6699
function.mb-strrchr.php                            30-May-2024 18:01                6795
function.mb-strrichr.php                           30-May-2024 18:01                6844
function.mb-strripos.php                           30-May-2024 18:01                6603
function.mb-strrpos.php                            30-May-2024 18:01                7039
function.mb-strstr.php                             30-May-2024 18:01                6798
function.mb-strtolower.php                         30-May-2024 18:01                7178
function.mb-strtoupper.php                         30-May-2024 18:01                7204
function.mb-strwidth.php                           30-May-2024 18:01                9298
function.mb-substitute-character.php               30-May-2024 18:01                7514
function.mb-substr-count.php                       30-May-2024 18:01                6262
function.mb-substr.php                             30-May-2024 18:01                6721
function.mcrypt-create-iv.php                      30-May-2024 18:01                7039
function.mcrypt-decrypt.php                        30-May-2024 18:01                6093
function.mcrypt-enc-get-algorithms-name.php        30-May-2024 18:01                5475
function.mcrypt-enc-get-block-size.php             30-May-2024 18:01                3102
function.mcrypt-enc-get-iv-size.php                30-May-2024 18:01                3227
function.mcrypt-enc-get-key-size.php               30-May-2024 18:01                3106
function.mcrypt-enc-get-modes-name.php             30-May-2024 18:01                5350
function.mcrypt-enc-get-supported-key-sizes.php    30-May-2024 18:01                5132
function.mcrypt-enc-is-block-algorithm-mode.php    30-May-2024 18:01                3676
function.mcrypt-enc-is-block-algorithm.php         30-May-2024 18:01                3397
function.mcrypt-enc-is-block-mode.php              30-May-2024 18:01                3504
function.mcrypt-enc-self-test.php                  30-May-2024 18:01                3162
function.mcrypt-encrypt.php                        30-May-2024 18:01               14083
function.mcrypt-generic-deinit.php                 30-May-2024 18:01                4146
function.mcrypt-generic-init.php                   30-May-2024 18:01                5329
function.mcrypt-generic.php                        30-May-2024 18:01                5967
function.mcrypt-get-block-size.php                 30-May-2024 18:01                6801
function.mcrypt-get-cipher-name.php                30-May-2024 18:01                5181
function.mcrypt-get-iv-size.php                    30-May-2024 18:01                6599
function.mcrypt-get-key-size.php                   30-May-2024 18:01                6981
function.mcrypt-list-algorithms.php                30-May-2024 18:01                4899
function.mcrypt-list-modes.php                     30-May-2024 18:01                4749
function.mcrypt-module-close.php                   30-May-2024 18:01                3582
function.mcrypt-module-get-algo-block-size.php     30-May-2024 18:01                3618
function.mcrypt-module-get-algo-key-size.php       30-May-2024 18:01                3685
function.mcrypt-module-get-supported-key-sizes.php 30-May-2024 18:01                4755
function.mcrypt-module-is-block-algorithm-mode.php 30-May-2024 18:01                4611
function.mcrypt-module-is-block-algorithm.php      30-May-2024 18:01                4152
function.mcrypt-module-is-block-mode.php           30-May-2024 18:01                4648
function.mcrypt-module-open.php                    30-May-2024 18:01               14195
function.mcrypt-module-self-test.php               30-May-2024 18:01                5200
function.md5-file.php                              30-May-2024 18:01                5356
function.md5.php                                   30-May-2024 18:01                6148
function.mdecrypt-generic.php                      30-May-2024 18:01               10957
function.memcache-debug.php                        30-May-2024 18:01                3793
function.memory-get-peak-usage.php                 30-May-2024 18:01                3761
function.memory-get-usage.php                      30-May-2024 18:01                5638
function.memory-reset-peak-usage.php               30-May-2024 18:01                5068
function.metaphone.php                             30-May-2024 18:01                8538
function.method-exists.php                         30-May-2024 18:01                6845
function.mhash-count.php                           30-May-2024 18:01                4778
function.mhash-get-block-size.php                  30-May-2024 18:01                4716
function.mhash-get-hash-name.php                   30-May-2024 18:01                4662
function.mhash-keygen-s2k.php                      30-May-2024 18:01                5777
function.mhash.php                                 30-May-2024 18:01                5204
function.microtime.php                             30-May-2024 18:01                8315
function.mime-content-type.php                     30-May-2024 18:01                5244
function.min.php                                   30-May-2024 18:01               13258
function.mkdir.php                                 30-May-2024 18:01                9409
function.mktime.php                                30-May-2024 18:01               19891                          30-May-2024 18:01               19105
function.mongodb.bson-fromjson.php                 30-May-2024 18:01                5942
function.mongodb.bson-fromphp.php                  30-May-2024 18:01                6280
function.mongodb.bson-tocanonicalextendedjson.php  30-May-2024 18:01               13993
function.mongodb.bson-tojson.php                   30-May-2024 18:01               15070
function.mongodb.bson-tophp.php                    30-May-2024 18:01                9316
function.mongodb.bson-torelaxedextendedjson.php    30-May-2024 18:01               13690
function.mongodb.driver.monitoring.addsubscribe..> 30-May-2024 18:01                5161
function.mongodb.driver.monitoring.removesubscr..> 30-May-2024 18:01                5017
function.move-uploaded-file.php                    30-May-2024 18:01                8743
function.mqseries-back.php                         30-May-2024 18:01                6531
function.mqseries-begin.php                        30-May-2024 18:01                7492
function.mqseries-close.php                        30-May-2024 18:01                6704
function.mqseries-cmit.php                         30-May-2024 18:01                6457
function.mqseries-conn.php                         30-May-2024 18:01                6029
function.mqseries-connx.php                        30-May-2024 18:01               12732
function.mqseries-disc.php                         30-May-2024 18:01                5731
function.mqseries-get.php                          30-May-2024 18:01               12349
function.mqseries-inq.php                          30-May-2024 18:01                9407
function.mqseries-open.php                         30-May-2024 18:01                7340
function.mqseries-put.php                          30-May-2024 18:01               12628
function.mqseries-put1.php                         30-May-2024 18:01                6371
function.mqseries-set.php                          30-May-2024 18:01                6297
function.mqseries-strerror.php                     30-May-2024 18:01                4327
function.msg-get-queue.php                         30-May-2024 18:01                6008
function.msg-queue-exists.php                      30-May-2024 18:01                3591
function.msg-receive.php                           30-May-2024 18:01               12116
function.msg-remove-queue.php                      30-May-2024 18:01                4840
function.msg-send.php                              30-May-2024 18:01                9705
function.msg-set-queue.php                         30-May-2024 18:01                5538
function.msg-stat-queue.php                        30-May-2024 18:01                7172                         30-May-2024 18:01                3424                               30-May-2024 18:01               10883                              30-May-2024 18:01                8996
function.mysql-affected-rows.php                   30-May-2024 18:01               12663
function.mysql-client-encoding.php                 30-May-2024 18:01                6432
function.mysql-close.php                           30-May-2024 18:01                7668
function.mysql-connect.php                         30-May-2024 18:01               17771
function.mysql-create-db.php                       30-May-2024 18:01                8781
function.mysql-data-seek.php                       30-May-2024 18:01               12182
function.mysql-db-name.php                         30-May-2024 18:01                7962
function.mysql-db-query.php                        30-May-2024 18:01               10441
function.mysql-drop-db.php                         30-May-2024 18:01                8071
function.mysql-errno.php                           30-May-2024 18:01                8494
function.mysql-error.php                           30-May-2024 18:01                8485
function.mysql-escape-string.php                   30-May-2024 18:01                6814
function.mysql-fetch-array.php                     30-May-2024 18:01               16080
function.mysql-fetch-assoc.php                     30-May-2024 18:01               11879
function.mysql-fetch-field.php                     30-May-2024 18:01               13353
function.mysql-fetch-lengths.php                   30-May-2024 18:01                7781
function.mysql-fetch-object.php                    30-May-2024 18:01               12134
function.mysql-fetch-row.php                       30-May-2024 18:01                7898
function.mysql-field-flags.php                     30-May-2024 18:01                8793
function.mysql-field-len.php                       30-May-2024 18:01                7135
function.mysql-field-name.php                      30-May-2024 18:01                9322
function.mysql-field-seek.php                      30-May-2024 18:01                5220
function.mysql-field-table.php                     30-May-2024 18:01                7753
function.mysql-field-type.php                      30-May-2024 18:01               11788
function.mysql-free-result.php                     30-May-2024 18:01                7978
function.mysql-get-client-info.php                 30-May-2024 18:01                5306
function.mysql-get-host-info.php                   30-May-2024 18:01                7257
function.mysql-get-proto-info.php                  30-May-2024 18:01                6838
function.mysql-get-server-info.php                 30-May-2024 18:01                7341
function.mysql-info.php                            30-May-2024 18:01                6619
function.mysql-insert-id.php                       30-May-2024 18:01                8728
function.mysql-list-dbs.php                        30-May-2024 18:01                9028
function.mysql-list-fields.php                     30-May-2024 18:01                9159
function.mysql-list-processes.php                  30-May-2024 18:01                7838
function.mysql-list-tables.php                     30-May-2024 18:01                9953
function.mysql-num-fields.php                      30-May-2024 18:01                6636
function.mysql-num-rows.php                        30-May-2024 18:01                8302
function.mysql-pconnect.php                        30-May-2024 18:01                8778
function.mysql-ping.php                            30-May-2024 18:01                8584
function.mysql-query.php                           30-May-2024 18:01               14412
function.mysql-real-escape-string.php              30-May-2024 18:01               15830
function.mysql-result.php                          30-May-2024 18:01                9854
function.mysql-select-db.php                       30-May-2024 18:01                7930
function.mysql-set-charset.php                     30-May-2024 18:01                6122
function.mysql-stat.php                            30-May-2024 18:01                9593
function.mysql-tablename.php                       30-May-2024 18:01                8219
function.mysql-thread-id.php                       30-May-2024 18:01                6875
function.mysql-unbuffered-query.php                30-May-2024 18:01                7611
function.mysql-xdevapi-expression.php              30-May-2024 18:01                4913
function.mysql-xdevapi-getsession.php              30-May-2024 18:01               13923
function.mysqli-connect.php                        30-May-2024 18:01                2437
function.mysqli-escape-string.php                  30-May-2024 18:01                1977
function.mysqli-execute.php                        30-May-2024 18:01                2550
function.mysqli-get-client-stats.php               30-May-2024 18:01                8504
function.mysqli-get-links-stats.php                30-May-2024 18:01                3606
function.mysqli-report.php                         30-May-2024 18:01                1779
function.mysqli-set-opt.php                        30-May-2024 18:01                1866
function.natcasesort.php                           30-May-2024 18:01                8111
function.natsort.php                               30-May-2024 18:01               11358                    30-May-2024 18:01                4786                                  30-May-2024 18:01               10090
function.ngettext.php                              30-May-2024 18:01                5880                           30-May-2024 18:01               19329
function.nl2br.php                                 30-May-2024 18:01                7128
function.number-format.php                         30-May-2024 18:01                8861
function.oauth-get-sbs.php                         30-May-2024 18:01                3195
function.oauth-urlencode.php                       30-May-2024 18:01                2670
function.ob-clean.php                              30-May-2024 18:01                4704
function.ob-end-clean.php                          30-May-2024 18:01                5897
function.ob-end-flush.php                          30-May-2024 18:01                5788
function.ob-flush.php                              30-May-2024 18:01                4820
function.ob-get-clean.php                          30-May-2024 18:01                6909
function.ob-get-contents.php                       30-May-2024 18:01                4927
function.ob-get-flush.php                          30-May-2024 18:01                6723
function.ob-get-length.php                         30-May-2024 18:01                4798
function.ob-get-level.php                          30-May-2024 18:01                3824
function.ob-get-status.php                         30-May-2024 18:01               10097
function.ob-gzhandler.php                          30-May-2024 18:01                5981
function.ob-iconv-handler.php                      30-May-2024 18:01                5305
function.ob-implicit-flush.php                     30-May-2024 18:01                5442
function.ob-list-handlers.php                      30-May-2024 18:01               13959
function.ob-start.php                              30-May-2024 18:01               16075
function.ob-tidyhandler.php                        30-May-2024 18:01                4460
function.oci-bind-array-by-name.php                30-May-2024 18:01               14074
function.oci-bind-by-name.php                      30-May-2024 18:01               79412
function.oci-cancel.php                            30-May-2024 18:01                2795
function.oci-client-version.php                    30-May-2024 18:01                4036
function.oci-close.php                             30-May-2024 18:01               19297
function.oci-commit.php                            30-May-2024 18:01               11090
function.oci-connect.php                           30-May-2024 18:01               35882
function.oci-define-by-name.php                    30-May-2024 18:01               24060
function.oci-error.php                             30-May-2024 18:01               12253
function.oci-execute.php                           30-May-2024 18:01               21487
function.oci-fetch-all.php                         30-May-2024 18:01               25828
function.oci-fetch-array.php                       30-May-2024 18:01               66135
function.oci-fetch-assoc.php                       30-May-2024 18:01                9211
function.oci-fetch-object.php                      30-May-2024 18:01               18904
function.oci-fetch-row.php                         30-May-2024 18:01                9139
function.oci-fetch.php                             30-May-2024 18:01               13910
function.oci-field-is-null.php                     30-May-2024 18:01                7941
function.oci-field-name.php                        30-May-2024 18:01                9879
function.oci-field-precision.php                   30-May-2024 18:01                8737
function.oci-field-scale.php                       30-May-2024 18:01                8715
function.oci-field-size.php                        30-May-2024 18:01               10331
function.oci-field-type-raw.php                    30-May-2024 18:01                7994
function.oci-field-type.php                        30-May-2024 18:01               10674
function.oci-free-descriptor.php                   30-May-2024 18:01                3603
function.oci-free-statement.php                    30-May-2024 18:01                3096
function.oci-get-implicit-resultset.php            30-May-2024 18:01               28295
function.oci-internal-debug.php                    30-May-2024 18:01                3153
function.oci-lob-copy.php                          30-May-2024 18:01                4666
function.oci-lob-is-equal.php                      30-May-2024 18:01                3340
function.oci-new-collection.php                    30-May-2024 18:01                5166
function.oci-new-connect.php                       30-May-2024 18:01               17118
function.oci-new-cursor.php                        30-May-2024 18:01                7814
function.oci-new-descriptor.php                    30-May-2024 18:01               18303
function.oci-num-fields.php                        30-May-2024 18:01                6978
function.oci-num-rows.php                          30-May-2024 18:01                8016
function.oci-parse.php                             30-May-2024 18:01               12658
function.oci-password-change.php                   30-May-2024 18:01               13668
function.oci-pconnect.php                          30-May-2024 18:01               15539
function.oci-register-taf-callback.php             30-May-2024 18:01                5855
function.oci-result.php                            30-May-2024 18:01                8762
function.oci-rollback.php                          30-May-2024 18:01               14446
function.oci-server-version.php                    30-May-2024 18:01                4836
function.oci-set-action.php                        30-May-2024 18:01                8608
function.oci-set-call-timout.php                   30-May-2024 18:01                6066
function.oci-set-client-identifier.php             30-May-2024 18:01                8267
function.oci-set-client-info.php                   30-May-2024 18:01                8530
function.oci-set-db-operation.php                  30-May-2024 18:01                7938
function.oci-set-edition.php                       30-May-2024 18:01                9826
function.oci-set-module-name.php                   30-May-2024 18:01                8724
function.oci-set-prefetch-lob.php                  30-May-2024 18:01                8957
function.oci-set-prefetch.php                      30-May-2024 18:01               20806
function.oci-statement-type.php                    30-May-2024 18:01                7103
function.oci-unregister-taf-callback.php           30-May-2024 18:01                3706
function.ocibindbyname.php                         30-May-2024 18:01                2040
function.ocicancel.php                             30-May-2024 18:01                1982
function.ocicloselob.php                           30-May-2024 18:01                1982
function.ocicollappend.php                         30-May-2024 18:01                2046
function.ocicollassign.php                         30-May-2024 18:01                2051
function.ocicollassignelem.php                     30-May-2024 18:01                2096
function.ocicollgetelem.php                        30-May-2024 18:01                2063
function.ocicollmax.php                            30-May-2024 18:01                2015
function.ocicollsize.php                           30-May-2024 18:01                2018
function.ocicolltrim.php                           30-May-2024 18:01                2028
function.ocicolumnisnull.php                       30-May-2024 18:01                2052
function.ocicolumnname.php                         30-May-2024 18:01                2044
function.ocicolumnprecision.php                    30-May-2024 18:01                2087
function.ocicolumnscale.php                        30-May-2024 18:01                2051
function.ocicolumnsize.php                         30-May-2024 18:01                2032
function.ocicolumntype.php                         30-May-2024 18:01                2036
function.ocicolumntyperaw.php                      30-May-2024 18:01                2059
function.ocicommit.php                             30-May-2024 18:01                1996
function.ocidefinebyname.php                       30-May-2024 18:01                2042
function.ocierror.php                              30-May-2024 18:01                1973
function.ociexecute.php                            30-May-2024 18:01                1977
function.ocifetch.php                              30-May-2024 18:01                1967
function.ocifetchinto.php                          30-May-2024 18:01                2734
function.ocifetchstatement.php                     30-May-2024 18:01                2060
function.ocifreecollection.php                     30-May-2024 18:01                2078
function.ocifreecursor.php                         30-May-2024 18:01                2050
function.ocifreedesc.php                           30-May-2024 18:01                1994
function.ocifreestatement.php                      30-May-2024 18:01                2069
function.ociinternaldebug.php                      30-May-2024 18:01                2083
function.ociloadlob.php                            30-May-2024 18:01                1979
function.ocilogoff.php                             30-May-2024 18:01                1966
function.ocilogon.php                              30-May-2024 18:01                1981
function.ocinewcollection.php                      30-May-2024 18:01                2067
function.ocinewcursor.php                          30-May-2024 18:01                2035
function.ocinewdescriptor.php                      30-May-2024 18:01                2057
function.ocinlogon.php                             30-May-2024 18:01                2006
function.ocinumcols.php                            30-May-2024 18:01                1991
function.ociparse.php                              30-May-2024 18:01                1961
function.ociplogon.php                             30-May-2024 18:01                1976
function.ociresult.php                             30-May-2024 18:01                1974
function.ocirollback.php                           30-May-2024 18:01                1996
function.ocirowcount.php                           30-May-2024 18:01                1998
function.ocisavelob.php                            30-May-2024 18:01                1979
function.ocisavelobfile.php                        30-May-2024 18:01                2017
function.ociserverversion.php                      30-May-2024 18:01                2071
function.ocisetprefetch.php                        30-May-2024 18:01                2057
function.ocistatementtype.php                      30-May-2024 18:01                2077
function.ociwritelobtofile.php                     30-May-2024 18:01                2058
function.ociwritetemporarylob.php                  30-May-2024 18:01                2081
function.octdec.php                                30-May-2024 18:01                6138
function.odbc-autocommit.php                       30-May-2024 18:01                5910
function.odbc-binmode.php                          30-May-2024 18:01                7463
function.odbc-close-all.php                        30-May-2024 18:01                2693
function.odbc-close.php                            30-May-2024 18:01                2996
function.odbc-columnprivileges.php                 30-May-2024 18:01                9020
function.odbc-columns.php                          30-May-2024 18:01               11872
function.odbc-commit.php                           30-May-2024 18:01                2821
function.odbc-connect.php                          30-May-2024 18:01                9182
function.odbc-connection-string-is-quoted.php      30-May-2024 18:01                3744
function.odbc-connection-string-quote.php          30-May-2024 18:01                5811
function.odbc-connection-string-should-quote.php   30-May-2024 18:01                4008
function.odbc-cursor.php                           30-May-2024 18:01                2864
function.odbc-data-source.php                      30-May-2024 18:01                6273
function.odbc-do.php                               30-May-2024 18:01                1715
function.odbc-error.php                            30-May-2024 18:01                4234
function.odbc-errormsg.php                         30-May-2024 18:01                4287
function.odbc-exec.php                             30-May-2024 18:01                4196
function.odbc-execute.php                          30-May-2024 18:01                7511
function.odbc-fetch-array.php                      30-May-2024 18:01                4434
function.odbc-fetch-into.php                       30-May-2024 18:01                5430
function.odbc-fetch-object.php                     30-May-2024 18:01                4440
function.odbc-fetch-row.php                        30-May-2024 18:01                5085
function.odbc-field-len.php                        30-May-2024 18:01                3581
function.odbc-field-name.php                       30-May-2024 18:01                3171
function.odbc-field-num.php                        30-May-2024 18:01                3163
function.odbc-field-precision.php                  30-May-2024 18:01                2243
function.odbc-field-scale.php                      30-May-2024 18:01                3144
function.odbc-field-type.php                       30-May-2024 18:01                3169
function.odbc-foreignkeys.php                      30-May-2024 18:01                9210
function.odbc-free-result.php                      30-May-2024 18:01                3583
function.odbc-gettypeinfo.php                      30-May-2024 18:01                4648
function.odbc-longreadlen.php                      30-May-2024 18:01                4032
function.odbc-next-result.php                      30-May-2024 18:01                9058
function.odbc-num-fields.php                       30-May-2024 18:01                2726
function.odbc-num-rows.php                         30-May-2024 18:01                3459
function.odbc-pconnect.php                         30-May-2024 18:01                5013
function.odbc-prepare.php                          30-May-2024 18:01                6761
function.odbc-primarykeys.php                      30-May-2024 18:01                8058
function.odbc-procedurecolumns.php                 30-May-2024 18:01               12073
function.odbc-procedures.php                       30-May-2024 18:01                9836
function.odbc-result-all.php                       30-May-2024 18:01                4374
function.odbc-result.php                           30-May-2024 18:01                5910
function.odbc-rollback.php                         30-May-2024 18:01                2832
function.odbc-setoption.php                        30-May-2024 18:01                7515
function.odbc-specialcolumns.php                   30-May-2024 18:01                8076
function.odbc-statistics.php                       30-May-2024 18:01               10181
function.odbc-tableprivileges.php                  30-May-2024 18:01                8450
function.odbc-tables.php                           30-May-2024 18:01               12763
function.opcache-compile-file.php                  30-May-2024 18:01                3928
function.opcache-get-configuration.php             30-May-2024 18:01                3356
function.opcache-get-status.php                    30-May-2024 18:01                3982
function.opcache-invalidate.php                    30-May-2024 18:01                4438
function.opcache-is-script-cached.php              30-May-2024 18:01                3485
function.opcache-reset.php                         30-May-2024 18:01                3517
function.openal-buffer-create.php                  30-May-2024 18:01                2922
function.openal-buffer-data.php                    30-May-2024 18:01                5066
function.openal-buffer-destroy.php                 30-May-2024 18:01                3259
function.openal-buffer-get.php                     30-May-2024 18:01                4056
function.openal-buffer-loadwav.php                 30-May-2024 18:01                3800
function.openal-context-create.php                 30-May-2024 18:01                3437
function.openal-context-current.php                30-May-2024 18:01                3314
function.openal-context-destroy.php                30-May-2024 18:01                3300
function.openal-context-process.php                30-May-2024 18:01                3688
function.openal-context-suspend.php                30-May-2024 18:01                3682
function.openal-device-close.php                   30-May-2024 18:01                3266
function.openal-device-open.php                    30-May-2024 18:01                3430
function.openal-listener-get.php                   30-May-2024 18:01                3492
function.openal-listener-set.php                   30-May-2024 18:01                3897
function.openal-source-create.php                  30-May-2024 18:01                3114
function.openal-source-destroy.php                 30-May-2024 18:01                3267
function.openal-source-get.php                     30-May-2024 18:01                5681
function.openal-source-pause.php                   30-May-2024 18:01                3568
function.openal-source-play.php                    30-May-2024 18:01                3567
function.openal-source-rewind.php                  30-May-2024 18:01                3577
function.openal-source-set.php                     30-May-2024 18:01                6426
function.openal-source-stop.php                    30-May-2024 18:01                3549
function.openal-stream.php                         30-May-2024 18:01                4497
function.opendir.php                               30-May-2024 18:01                8283
function.openlog.php                               30-May-2024 18:01               10924
function.openssl-cipher-iv-length.php              30-May-2024 18:01                4581
function.openssl-cipher-key-length.php             30-May-2024 18:01                4514
function.openssl-cms-decrypt.php                   30-May-2024 18:01                5789
function.openssl-cms-encrypt.php                   30-May-2024 18:01                6769
function.openssl-cms-read.php                      30-May-2024 18:01                3366
function.openssl-cms-sign.php                      30-May-2024 18:01                8440
function.openssl-cms-verify.php                    30-May-2024 18:01                7530
function.openssl-csr-export-to-file.php            30-May-2024 18:01                8851
function.openssl-csr-export.php                    30-May-2024 18:01                8796
function.openssl-csr-get-public-key.php            30-May-2024 18:01                9154
function.openssl-csr-get-subject.php               30-May-2024 18:01                9862
function.openssl-csr-new.php                       30-May-2024 18:01               23284
function.openssl-csr-sign.php                      30-May-2024 18:01               14455
function.openssl-decrypt.php                       30-May-2024 18:01                8181
function.openssl-dh-compute-key.php                30-May-2024 18:01               16700
function.openssl-digest.php                        30-May-2024 18:01                4715
function.openssl-encrypt.php                       30-May-2024 18:01               18986
function.openssl-error-string.php                  30-May-2024 18:01                3961
function.openssl-free-key.php                      30-May-2024 18:01                3909
function.openssl-get-cert-locations.php            30-May-2024 18:01                4140
function.openssl-get-cipher-methods.php            30-May-2024 18:01               14201
function.openssl-get-curve-names.php               30-May-2024 18:01                7265
function.openssl-get-md-methods.php                30-May-2024 18:01                7139
function.openssl-get-privatekey.php                30-May-2024 18:01                1940
function.openssl-get-publickey.php                 30-May-2024 18:01                1911
function.openssl-open.php                          30-May-2024 18:01               10839
function.openssl-pbkdf2.php                        30-May-2024 18:01                7706
function.openssl-pkcs12-export-to-file.php         30-May-2024 18:01                8047
function.openssl-pkcs12-export.php                 30-May-2024 18:01                8075
function.openssl-pkcs12-read.php                   30-May-2024 18:01                5919
function.openssl-pkcs7-decrypt.php                 30-May-2024 18:01                8237
function.openssl-pkcs7-encrypt.php                 30-May-2024 18:01               11183
function.openssl-pkcs7-read.php                    30-May-2024 18:01                7069
function.openssl-pkcs7-sign.php                    30-May-2024 18:01               12661
function.openssl-pkcs7-verify.php                  30-May-2024 18:01                8801
function.openssl-pkey-derive.php                   30-May-2024 18:01                8293
function.openssl-pkey-export-to-file.php           30-May-2024 18:01                7079
function.openssl-pkey-export.php                   30-May-2024 18:01                6961
function.openssl-pkey-free.php                     30-May-2024 18:01                4185
function.openssl-pkey-get-details.php              30-May-2024 18:01               10110
function.openssl-pkey-get-private.php              30-May-2024 18:01                6626
function.openssl-pkey-get-public.php               30-May-2024 18:01                5903
function.openssl-pkey-new.php                      30-May-2024 18:01                7356
function.openssl-private-decrypt.php               30-May-2024 18:01                7358
function.openssl-private-encrypt.php               30-May-2024 18:01                7115
function.openssl-public-decrypt.php                30-May-2024 18:01                7024
function.openssl-public-encrypt.php                30-May-2024 18:01                7411
function.openssl-random-pseudo-bytes.php           30-May-2024 18:01                9407
function.openssl-seal.php                          30-May-2024 18:01               12117
function.openssl-sign.php                          30-May-2024 18:01               13314
function.openssl-spki-export-challenge.php         30-May-2024 18:01                7685
function.openssl-spki-export.php                   30-May-2024 18:01                8494
function.openssl-spki-new.php                      30-May-2024 18:01                9397
function.openssl-spki-verify.php                   30-May-2024 18:01                7881
function.openssl-verify.php                        30-May-2024 18:01               13804
function.openssl-x509-check-private-key.php        30-May-2024 18:01                6225
function.openssl-x509-checkpurpose.php             30-May-2024 18:01                8129
function.openssl-x509-export-to-file.php           30-May-2024 18:01                5310
function.openssl-x509-export.php                   30-May-2024 18:01                5269
function.openssl-x509-fingerprint.php              30-May-2024 18:01                5497
function.openssl-x509-free.php                     30-May-2024 18:01                4155
function.openssl-x509-parse.php                    30-May-2024 18:01                4976
function.openssl-x509-read.php                     30-May-2024 18:01                4709
function.openssl-x509-verify.php                   30-May-2024 18:01               12590
function.ord.php                                   30-May-2024 18:01                7371
function.output-add-rewrite-var.php                30-May-2024 18:01                9806
function.output-reset-rewrite-vars.php             30-May-2024 18:01                6768
function.pack.php                                  30-May-2024 18:01               14321
function.parse-ini-file.php                        30-May-2024 18:01               21439
function.parse-ini-string.php                      30-May-2024 18:01                7796
function.parse-str.php                             30-May-2024 18:01               10374
function.parse-url.php                             30-May-2024 18:01               17374
function.passthru.php                              30-May-2024 18:01                7860
function.password-algos.php                        30-May-2024 18:01                3381
function.password-get-info.php                     30-May-2024 18:01                3626
function.password-hash.php                         30-May-2024 18:01               24224
function.password-needs-rehash.php                 30-May-2024 18:01                8421
function.password-verify.php                       30-May-2024 18:01                7159
function.pathinfo.php                              30-May-2024 18:01               14844
function.pclose.php                                30-May-2024 18:01                5020
function.pcntl-alarm.php                           30-May-2024 18:01                3141
function.pcntl-async-signals.php                   30-May-2024 18:01                4272
function.pcntl-errno.php                           30-May-2024 18:01                1803
function.pcntl-exec.php                            30-May-2024 18:01                3957
function.pcntl-fork.php                            30-May-2024 18:01                5128
function.pcntl-get-last-error.php                  30-May-2024 18:01                2833
function.pcntl-getpriority.php                     30-May-2024 18:01                6191
function.pcntl-rfork.php                           30-May-2024 18:01                7777
function.pcntl-setpriority.php                     30-May-2024 18:01                6027
function.pcntl-signal-dispatch.php                 30-May-2024 18:01                5754
function.pcntl-signal-get-handler.php              30-May-2024 18:01                6848
function.pcntl-signal.php                          30-May-2024 18:01               11611
function.pcntl-sigprocmask.php                     30-May-2024 18:01                6184
function.pcntl-sigtimedwait.php                    30-May-2024 18:01                5229
function.pcntl-sigwaitinfo.php                     30-May-2024 18:01                7590
function.pcntl-strerror.php                        30-May-2024 18:01                3034
function.pcntl-unshare.php                         30-May-2024 18:01                4677
function.pcntl-wait.php                            30-May-2024 18:01                8440
function.pcntl-waitpid.php                         30-May-2024 18:01                9904
function.pcntl-wexitstatus.php                     30-May-2024 18:01                3944
function.pcntl-wifexited.php                       30-May-2024 18:01                3645
function.pcntl-wifsignaled.php                     30-May-2024 18:01                3688
function.pcntl-wifstopped.php                      30-May-2024 18:01                3731
function.pcntl-wstopsig.php                        30-May-2024 18:01                3952
function.pcntl-wtermsig.php                        30-May-2024 18:01                4180
function.pfsockopen.php                            30-May-2024 18:01                5993                      30-May-2024 18:01                7131                       30-May-2024 18:01                7756                    30-May-2024 18:01                7122                              30-May-2024 18:01                7123                       30-May-2024 18:01                4194                            30-May-2024 18:01               11781                    30-May-2024 18:01                5951                   30-May-2024 18:01                5979                  30-May-2024 18:01                5698                      30-May-2024 18:01                3734                            30-May-2024 18:01               10235                          30-May-2024 18:01                8521                            30-May-2024 18:01                7735                             30-May-2024 18:01                5461                             30-May-2024 18:01               10353                           30-May-2024 18:01                7722                       30-May-2024 18:01                8236                  30-May-2024 18:01                7938                     30-May-2024 18:01                8303                      30-May-2024 18:01                7901                            30-May-2024 18:01               10803                  30-May-2024 18:01                7309                          30-May-2024 18:01                9595                        30-May-2024 18:01               13473                        30-May-2024 18:01                9864                       30-May-2024 18:01               12446                       30-May-2024 18:01                9688                          30-May-2024 18:01               10368                      30-May-2024 18:01                8968                         30-May-2024 18:01                9202                          30-May-2024 18:01                6810                       30-May-2024 18:01               11382                         30-May-2024 18:01                9429                        30-May-2024 18:01                9065                     30-May-2024 18:01                7694                         30-May-2024 18:01                7414                              30-May-2024 18:01                3759                        30-May-2024 18:01                7704                         30-May-2024 18:01                7868                            30-May-2024 18:01                5239                         30-May-2024 18:01                8926                               30-May-2024 18:01                6527                             30-May-2024 18:01               12316                         30-May-2024 18:01                7705                        30-May-2024 18:01                8818                           30-May-2024 18:01                7973                           30-May-2024 18:01                7347                          30-May-2024 18:01                8914                          30-May-2024 18:01                8443                          30-May-2024 18:01                7713                            30-May-2024 18:01                9304                        30-May-2024 18:01                6571                            30-May-2024 18:01                7262                            30-May-2024 18:01                8329                            30-May-2024 18:01                7187                        30-May-2024 18:01                6769                          30-May-2024 18:01                7420                           30-May-2024 18:01                8556                          30-May-2024 18:01                7752                         30-May-2024 18:01                6211                           30-May-2024 18:01                6192                            30-May-2024 18:01                5925                   30-May-2024 18:01                8902                           30-May-2024 18:01               10505                               30-May-2024 18:01                6317                               30-May-2024 18:01                6082                            30-May-2024 18:01               10909                           30-May-2024 18:01                8995                       30-May-2024 18:01               11269                              30-May-2024 18:01               12778                 30-May-2024 18:01               10107                       30-May-2024 18:01                8425                        30-May-2024 18:01                7609                      30-May-2024 18:01                8980                             30-May-2024 18:01               12879                       30-May-2024 18:01               10854                       30-May-2024 18:01               11373                  30-May-2024 18:01                8409                         30-May-2024 18:01               10340                30-May-2024 18:01                9096       30-May-2024 18:01                7105                30-May-2024 18:01                9302                             30-May-2024 18:01                3916                              30-May-2024 18:01                9651                 30-May-2024 18:01                6921                                30-May-2024 18:01                6263                     30-May-2024 18:01                6629                            30-May-2024 18:01                6930                             30-May-2024 18:01               11350                            30-May-2024 18:01                6830
function.php-ini-loaded-file.php                   30-May-2024 18:01                4720
function.php-ini-scanned-files.php                 30-May-2024 18:01                6553
function.php-sapi-name.php                         30-May-2024 18:01                6137
function.php-strip-whitespace.php                  30-May-2024 18:01                4760
function.php-uname.php                             30-May-2024 18:01                9110
function.phpcredits.php                            30-May-2024 18:01                8297
function.phpdbg-break-file.php                     30-May-2024 18:01                3789
function.phpdbg-break-function.php                 30-May-2024 18:01                3524
function.phpdbg-break-method.php                   30-May-2024 18:01                3858
function.phpdbg-break-next.php                     30-May-2024 18:01                3168
function.phpdbg-clear.php                          30-May-2024 18:01                3449
function.phpdbg-color.php                          30-May-2024 18:01                3724
function.phpdbg-end-oplog.php                      30-May-2024 18:01                2683
function.phpdbg-exec.php                           30-May-2024 18:01                3173
function.phpdbg-get-executable.php                 30-May-2024 18:01                2626
function.phpdbg-prompt.php                         30-May-2024 18:01                2867
function.phpdbg-start-oplog.php                    30-May-2024 18:01                2343
function.phpinfo.php                               30-May-2024 18:01                9654
function.phpversion.php                            30-May-2024 18:01               11150
function.pi.php                                    30-May-2024 18:01                3221
function.png2wbmp.php                              30-May-2024 18:01                6766
function.popen.php                                 30-May-2024 18:01                8839
function.pos.php                                   30-May-2024 18:01                1648
function.posix-access.php                          30-May-2024 18:01                6873
function.posix-ctermid.php                         30-May-2024 18:01                4605
function.posix-eaccess.php                         30-May-2024 18:01                7602
function.posix-errno.php                           30-May-2024 18:01                1809
function.posix-fpathconf.php                       30-May-2024 18:01                7071
function.posix-get-last-error.php                  30-May-2024 18:01                4407
function.posix-getcwd.php                          30-May-2024 18:01                4501
function.posix-getegid.php                         30-May-2024 18:01                5425
function.posix-geteuid.php                         30-May-2024 18:01                5437
function.posix-getgid.php                          30-May-2024 18:01                4787
function.posix-getgrgid.php                        30-May-2024 18:01                6786
function.posix-getgrnam.php                        30-May-2024 18:01                6781
function.posix-getgroups.php                       30-May-2024 18:01                4303
function.posix-getlogin.php                        30-May-2024 18:01                3739
function.posix-getpgid.php                         30-May-2024 18:01                4938
function.posix-getpgrp.php                         30-May-2024 18:01                2673
function.posix-getpid.php                          30-May-2024 18:01                3382
function.posix-getppid.php                         30-May-2024 18:01                3059
function.posix-getpwnam.php                        30-May-2024 18:01                7210
function.posix-getpwuid.php                        30-May-2024 18:01                7178
function.posix-getrlimit.php                       30-May-2024 18:01                8781
function.posix-getsid.php                          30-May-2024 18:01                4801
function.posix-getuid.php                          30-May-2024 18:01                3464
function.posix-initgroups.php                      30-May-2024 18:01                3432
function.posix-isatty.php                          30-May-2024 18:01                4681
function.posix-kill.php                            30-May-2024 18:01                3508
function.posix-mkfifo.php                          30-May-2024 18:01                3795
function.posix-mknod.php                           30-May-2024 18:01                7676
function.posix-pathconf.php                        30-May-2024 18:01                6447
function.posix-setegid.php                         30-May-2024 18:01                5311
function.posix-seteuid.php                         30-May-2024 18:01                3672
function.posix-setgid.php                          30-May-2024 18:01                5556
function.posix-setpgid.php                         30-May-2024 18:01                3517
function.posix-setrlimit.php                       30-May-2024 18:01                4801
function.posix-setsid.php                          30-May-2024 18:01                2608
function.posix-setuid.php                          30-May-2024 18:01                5649
function.posix-strerror.php                        30-May-2024 18:01                5005
function.posix-sysconf.php                         30-May-2024 18:01                4135
function.posix-times.php                           30-May-2024 18:01                4969
function.posix-ttyname.php                         30-May-2024 18:01                5570
function.posix-uname.php                           30-May-2024 18:01                5112
function.pow.php                                   30-May-2024 18:01                6930
function.preg-filter.php                           30-May-2024 18:01               10456
function.preg-grep.php                             30-May-2024 18:01                6247
function.preg-last-error-msg.php                   30-May-2024 18:01                4118
function.preg-last-error.php                       30-May-2024 18:01                5194
function.preg-match-all.php                        30-May-2024 18:01               26711
function.preg-match.php                            30-May-2024 18:01               24673
function.preg-quote.php                            30-May-2024 18:01                8792
function.preg-replace-callback-array.php           30-May-2024 18:01               10646
function.preg-replace-callback.php                 30-May-2024 18:01               17866
function.preg-replace.php                          30-May-2024 18:01               25931
function.preg-split.php                            30-May-2024 18:01               13522
function.prev.php                                  30-May-2024 18:01                9562
function.print-r.php                               30-May-2024 18:01                9629
function.print.php                                 30-May-2024 18:01               12919
function.printf.php                                30-May-2024 18:01               29479
function.proc-close.php                            30-May-2024 18:01                3776
function.proc-get-status.php                       30-May-2024 18:01                7114
function.proc-nice.php                             30-May-2024 18:01                7980
function.proc-open.php                             30-May-2024 18:01               23472
function.proc-terminate.php                        30-May-2024 18:01                4988                       30-May-2024 18:01                8726                       30-May-2024 18:01                5192                     30-May-2024 18:01                5919                      30-May-2024 18:01                6703                           30-May-2024 18:01                7429                        30-May-2024 18:01                7076                        30-May-2024 18:01                6005                                30-May-2024 18:01                5382                               30-May-2024 18:01                5388                         30-May-2024 18:01                7046                      30-May-2024 18:01               13475                     30-May-2024 18:01               11463                             30-May-2024 18:01                4901                               30-May-2024 18:01                3180                        30-May-2024 18:01                4071                              30-May-2024 18:01                3818                   30-May-2024 18:01                3253                          30-May-2024 18:01                3414                      30-May-2024 18:01                4226                            30-May-2024 18:01                5257                             30-May-2024 18:01                3697                           30-May-2024 18:01                3423                        30-May-2024 18:01                3354                       30-May-2024 18:01                3361                        30-May-2024 18:01                3459                               30-May-2024 18:01                3392                           30-May-2024 18:01                7254                         30-May-2024 18:01                3314                      30-May-2024 18:01                8039                          30-May-2024 18:01                9537                          30-May-2024 18:01                7443                       30-May-2024 18:01                3281                             30-May-2024 18:01                8379                      30-May-2024 18:01               10274                             30-May-2024 18:01                3991                                30-May-2024 18:01                3115                          30-May-2024 18:01                3832                    30-May-2024 18:01                5029                         30-May-2024 18:01                7116                  30-May-2024 18:01                2944                        30-May-2024 18:01                5392                               30-May-2024 18:01                5112                            30-May-2024 18:01                3536                             30-May-2024 18:01               12250                               30-May-2024 18:01                3283                              30-May-2024 18:01                3900                   30-May-2024 18:01                5018                    30-May-2024 18:01                4606                   30-May-2024 18:01                4670                           30-May-2024 18:01                6145                      30-May-2024 18:01                4080                       30-May-2024 18:01                9456                          30-May-2024 18:01                4892                           30-May-2024 18:01                6101                            30-May-2024 18:01                3787                            30-May-2024 18:01                3268                            30-May-2024 18:01                4205                            30-May-2024 18:01                3460                         30-May-2024 18:01                3986                        30-May-2024 18:01                4004                       30-May-2024 18:01                3868                      30-May-2024 18:01                4288                   30-May-2024 18:01                3305                        30-May-2024 18:01                7875                    30-May-2024 18:01                4390                            30-May-2024 18:01                7325                             30-May-2024 18:01                4109                         30-May-2024 18:01               12857                            30-May-2024 18:01                4388                           30-May-2024 18:01                3273                               30-May-2024 18:01                5893                              30-May-2024 18:01                3455                    30-May-2024 18:01                4976                        30-May-2024 18:01                4453                             30-May-2024 18:01                3589                        30-May-2024 18:01                3981                       30-May-2024 18:01                4525                             30-May-2024 18:01                3855                          30-May-2024 18:01               14269
function.pspell-add-to-personal.php                30-May-2024 18:01                6587
function.pspell-add-to-session.php                 30-May-2024 18:01                4207
function.pspell-check.php                          30-May-2024 18:01                5141
function.pspell-clear-session.php                  30-May-2024 18:01                5952
function.pspell-config-create.php                  30-May-2024 18:01                8237
function.pspell-config-data-dir.php                30-May-2024 18:01                3500
function.pspell-config-dict-dir.php                30-May-2024 18:01                3476
function.pspell-config-ignore.php                  30-May-2024 18:01                5882
function.pspell-config-mode.php                    30-May-2024 18:01                6717
function.pspell-config-personal.php                30-May-2024 18:01                6758
function.pspell-config-repl.php                    30-May-2024 18:01                7071
function.pspell-config-runtogether.php             30-May-2024 18:01                6633
function.pspell-config-save-repl.php               30-May-2024 18:01                5494
function.pspell-new-config.php                     30-May-2024 18:01                6530
function.pspell-new-personal.php                   30-May-2024 18:01               11577
function.pspell-new.php                            30-May-2024 18:01                9877
function.pspell-save-wordlist.php                  30-May-2024 18:01                6162
function.pspell-store-replacement.php              30-May-2024 18:01                7910
function.pspell-suggest.php                        30-May-2024 18:01                5667
function.putenv.php                                30-May-2024 18:01                4170
function.quoted-printable-decode.php               30-May-2024 18:01                5283
function.quoted-printable-encode.php               30-May-2024 18:01                5221
function.quotemeta.php                             30-May-2024 18:01                6007
function.rad2deg.php                               30-May-2024 18:01                3637
function.radius-acct-open.php                      30-May-2024 18:01                3278
function.radius-add-server.php                     30-May-2024 18:01                7848
function.radius-auth-open.php                      30-May-2024 18:01                3287
function.radius-close.php                          30-May-2024 18:01                2735
function.radius-config.php                         30-May-2024 18:01                4149
function.radius-create-request.php                 30-May-2024 18:01                5402
function.radius-cvt-addr.php                       30-May-2024 18:01                6248
function.radius-cvt-int.php                        30-May-2024 18:01                5648
function.radius-cvt-string.php                     30-May-2024 18:01                5702
function.radius-demangle-mppe-key.php              30-May-2024 18:01                3282
function.radius-demangle.php                       30-May-2024 18:01                3013
function.radius-get-attr.php                       30-May-2024 18:01                6503
function.radius-get-tagged-attr-data.php           30-May-2024 18:01                6612
function.radius-get-tagged-attr-tag.php            30-May-2024 18:01                6665
function.radius-get-vendor-attr.php                30-May-2024 18:01                8243
function.radius-put-addr.php                       30-May-2024 18:01                5736
function.radius-put-attr.php                       30-May-2024 18:01                8972
function.radius-put-int.php                        30-May-2024 18:01                7709
function.radius-put-string.php                     30-May-2024 18:01                8089
function.radius-put-vendor-addr.php                30-May-2024 18:01                5687
function.radius-put-vendor-attr.php                30-May-2024 18:01                7953
function.radius-put-vendor-int.php                 30-May-2024 18:01                6463
function.radius-put-vendor-string.php              30-May-2024 18:01                6856
function.radius-request-authenticator.php          30-May-2024 18:01                3208
function.radius-salt-encrypt-attr.php              30-May-2024 18:01                4317
function.radius-send-request.php                   30-May-2024 18:01                4048
function.radius-server-secret.php                  30-May-2024 18:01                2741
function.radius-strerror.php                       30-May-2024 18:01                2640
function.rand.php                                  30-May-2024 18:01               10582
function.random-bytes.php                          30-May-2024 18:01                9681
function.random-int.php                            30-May-2024 18:01                9558
function.range.php                                 30-May-2024 18:01               17337
function.rar-wrapper-cache-stats.php               30-May-2024 18:01                2409
function.rawurldecode.php                          30-May-2024 18:01                4724
function.rawurlencode.php                          30-May-2024 18:01                6433                        30-May-2024 18:01                2524
function.readdir.php                               30-May-2024 18:01               10950
function.readfile.php                              30-May-2024 18:01               10290
function.readgzfile.php                            30-May-2024 18:01                4611
function.readline-add-history.php                  30-May-2024 18:01                2868
function.readline-callback-handler-install.php     30-May-2024 18:01                9755
function.readline-callback-handler-remove.php      30-May-2024 18:01                4152
function.readline-callback-read-char.php           30-May-2024 18:01                4009
function.readline-clear-history.php                30-May-2024 18:01                2581
function.readline-completion-function.php          30-May-2024 18:01                3220
function.readline-info.php                         30-May-2024 18:01                5052
function.readline-list-history.php                 30-May-2024 18:01                2430
function.readline-on-new-line.php                  30-May-2024 18:01                2798
function.readline-read-history.php                 30-May-2024 18:01                3574
function.readline-redisplay.php                    30-May-2024 18:01                2329
function.readline-write-history.php                30-May-2024 18:01                3551
function.readline.php                              30-May-2024 18:01                5359
function.readlink.php                              30-May-2024 18:01                4621
function.realpath-cache-get.php                    30-May-2024 18:01                4249
function.realpath-cache-size.php                   30-May-2024 18:01                3721
function.realpath.php                              30-May-2024 18:01                8900
function.recode-file.php                           30-May-2024 18:01                6041
function.recode-string.php                         30-May-2024 18:01                5339
function.recode.php                                30-May-2024 18:01                1754
function.register-shutdown-function.php            30-May-2024 18:01                7974
function.register-tick-function.php                30-May-2024 18:01                5501
function.rename.php                                30-May-2024 18:01                6179
function.require-once.php                          30-May-2024 18:01                1911
function.require.php                               30-May-2024 18:01                2029
function.reset.php                                 30-May-2024 18:01               10044
function.restore-error-handler.php                 30-May-2024 18:01                6025
function.restore-exception-handler.php             30-May-2024 18:01                6691
function.restore-include-path.php                  30-May-2024 18:01                5303
function.return.php                                30-May-2024 18:01                4463
function.rewind.php                                30-May-2024 18:01                6449
function.rewinddir.php                             30-May-2024 18:01                3837
function.rmdir.php                                 30-May-2024 18:01                5300
function.rnp-backend-string.php                    30-May-2024 18:01                2285
function.rnp-backend-version.php                   30-May-2024 18:01                2217
function.rnp-decrypt.php                           30-May-2024 18:01                3281
function.rnp-dump-packets-to-json.php              30-May-2024 18:01                3187
function.rnp-dump-packets.php                      30-May-2024 18:01                3141
function.rnp-ffi-create.php                        30-May-2024 18:01                3236
function.rnp-ffi-destroy.php                       30-May-2024 18:01                2468
function.rnp-ffi-set-pass-provider.php             30-May-2024 18:01                6792
function.rnp-import-keys.php                       30-May-2024 18:01                3533
function.rnp-import-signatures.php                 30-May-2024 18:01                3523
function.rnp-key-export-autocrypt.php              30-May-2024 18:01                4584
function.rnp-key-export-revocation.php             30-May-2024 18:01                5235
function.rnp-key-export.php                        30-May-2024 18:01                3503
function.rnp-key-get-info.php                      30-May-2024 18:01                8022
function.rnp-key-remove.php                        30-May-2024 18:01                3643
function.rnp-key-revoke.php                        30-May-2024 18:01                4881
function.rnp-list-keys.php                         30-May-2024 18:01                3186
function.rnp-load-keys-from-path.php               30-May-2024 18:01                3897
function.rnp-load-keys.php                         30-May-2024 18:01                3853
function.rnp-locate-key.php                        30-May-2024 18:01                3606
function.rnp-op-encrypt.php                        30-May-2024 18:01                7974
function.rnp-op-generate-key.php                   30-May-2024 18:01                7593
function.rnp-op-sign-cleartext.php                 30-May-2024 18:01                5243
function.rnp-op-sign-detached.php                  30-May-2024 18:01                5122
function.rnp-op-sign.php                           30-May-2024 18:01                6203
function.rnp-op-verify-detached.php                30-May-2024 18:01                7133
function.rnp-op-verify.php                         30-May-2024 18:01                6872
function.rnp-save-keys-to-path.php                 30-May-2024 18:01                3911
function.rnp-save-keys.php                         30-May-2024 18:01                3884
function.rnp-supported-features.php                30-May-2024 18:01                2955
function.rnp-version-string-full.php               30-May-2024 18:01                2302
function.rnp-version-string.php                    30-May-2024 18:01                2199
function.round.php                                 30-May-2024 18:01               24359
function.rpmaddtag.php                             30-May-2024 18:01                3366
function.rpmdbinfo.php                             30-May-2024 18:01                5261
function.rpmdbsearch.php                           30-May-2024 18:01                6161
function.rpmgetsymlink.php                         30-May-2024 18:01                2987
function.rpminfo.php                               30-May-2024 18:01                5443
function.rpmvercmp.php                             30-May-2024 18:01                4913
function.rrd-create.php                            30-May-2024 18:01                2989
function.rrd-error.php                             30-May-2024 18:01                2129
function.rrd-fetch.php                             30-May-2024 18:01                2965
function.rrd-first.php                             30-May-2024 18:01                2959
function.rrd-graph.php                             30-May-2024 18:01                3211
function.rrd-info.php                              30-May-2024 18:01                2544
function.rrd-last.php                              30-May-2024 18:01                2478
function.rrd-lastupdate.php                        30-May-2024 18:01                2674
function.rrd-restore.php                           30-May-2024 18:01                3374
function.rrd-tune.php                              30-May-2024 18:01                3056
function.rrd-update.php                            30-May-2024 18:01                3129
function.rrd-version.php                           30-May-2024 18:01                2223
function.rrd-xport.php                             30-May-2024 18:01                2718
function.rrdc-disconnect.php                       30-May-2024 18:01                2585
function.rsort.php                                 30-May-2024 18:01                9538
function.rtrim.php                                 30-May-2024 18:01                9760
function.runkit7-constant-add.php                  30-May-2024 18:01                4472
function.runkit7-constant-redefine.php             30-May-2024 18:01                4353
function.runkit7-constant-remove.php               30-May-2024 18:01                3678
function.runkit7-function-add.php                  30-May-2024 18:01                9805
function.runkit7-function-copy.php                 30-May-2024 18:01                5556
function.runkit7-function-redefine.php             30-May-2024 18:01               10228
function.runkit7-function-remove.php               30-May-2024 18:01                4157
function.runkit7-function-rename.php               30-May-2024 18:01                4434
function.runkit7-import.php                        30-May-2024 18:01                3867
function.runkit7-method-add.php                    30-May-2024 18:01               11815
function.runkit7-method-copy.php                   30-May-2024 18:01                7100
function.runkit7-method-redefine.php               30-May-2024 18:01               12251
function.runkit7-method-remove.php                 30-May-2024 18:01                6514
function.runkit7-method-rename.php                 30-May-2024 18:01                6676
function.runkit7-object-id.php                     30-May-2024 18:01                3779
function.runkit7-superglobals.php                  30-May-2024 18:01                2656
function.runkit7-zval-inspect.php                  30-May-2024 18:01                5147
function.sapi-windows-cp-conv.php                  30-May-2024 18:01                4768
function.sapi-windows-cp-get.php                   30-May-2024 18:01                3478
function.sapi-windows-cp-is-utf8.php               30-May-2024 18:01                2763
function.sapi-windows-cp-set.php                   30-May-2024 18:01                3108
function.sapi-windows-generate-ctrl-event.php      30-May-2024 18:01                7837
function.sapi-windows-set-ctrl-handler.php         30-May-2024 18:01                7618
function.sapi-windows-vt100-support.php            30-May-2024 18:01               11285
function.scandir.php                               30-May-2024 18:01                9464
function.scoutapm-get-calls.php                    30-May-2024 18:01                4496
function.scoutapm-list-instrumented-functions.php  30-May-2024 18:01                3832
function.seaslog-get-author.php                    30-May-2024 18:01                3153
function.seaslog-get-version.php                   30-May-2024 18:01                3150
function.sem-acquire.php                           30-May-2024 18:01                5413
function.sem-get.php                               30-May-2024 18:01                7434
function.sem-release.php                           30-May-2024 18:01                4454
function.sem-remove.php                            30-May-2024 18:01                4490
function.serialize.php                             30-May-2024 18:01               11011
function.session-abort.php                         30-May-2024 18:01                4308
function.session-cache-expire.php                  30-May-2024 18:01                7792
function.session-cache-limiter.php                 30-May-2024 18:01                9241
function.session-commit.php                        30-May-2024 18:01                1861
function.session-create-id.php                     30-May-2024 18:01               10403
function.session-decode.php                        30-May-2024 18:01                3947
function.session-destroy.php                       30-May-2024 18:01                9183
function.session-encode.php                        30-May-2024 18:01                4078
function.session-gc.php                            30-May-2024 18:01                8283
function.session-get-cookie-params.php             30-May-2024 18:01                5609
function.session-id.php                            30-May-2024 18:01                6345
function.session-module-name.php                   30-May-2024 18:01                4565
function.session-name.php                          30-May-2024 18:01                7935
function.session-regenerate-id.php                 30-May-2024 18:01               16762
function.session-register-shutdown.php             30-May-2024 18:01                2840
function.session-reset.php                         30-May-2024 18:01                4405
function.session-save-path.php                     30-May-2024 18:01                4959
function.session-set-cookie-params.php             30-May-2024 18:01               10908
function.session-set-save-handler.php              30-May-2024 18:01               25095
function.session-start.php                         30-May-2024 18:01               14957
function.session-status.php                        30-May-2024 18:01                3432
function.session-unset.php                         30-May-2024 18:01                5077
function.session-write-close.php                   30-May-2024 18:01                4270
function.set-error-handler.php                     30-May-2024 18:01               27402
function.set-exception-handler.php                 30-May-2024 18:01                7082
function.set-file-buffer.php                       30-May-2024 18:01                1808
function.set-include-path.php                      30-May-2024 18:01                6413
function.set-time-limit.php                        30-May-2024 18:01                4751
function.setcookie.php                             30-May-2024 18:01               28303
function.setlocale.php                             30-May-2024 18:01               15713
function.setrawcookie.php                          30-May-2024 18:01                6494
function.settype.php                               30-May-2024 18:01                6499
function.sha1-file.php                             30-May-2024 18:01                5820
function.sha1.php                                  30-May-2024 18:01                6016                            30-May-2024 18:01                5994
function.shm-attach.php                            30-May-2024 18:01                6467
function.shm-detach.php                            30-May-2024 18:01                4780
function.shm-get-var.php                           30-May-2024 18:01                4518
function.shm-has-var.php                           30-May-2024 18:01                4440
function.shm-put-var.php                           30-May-2024 18:01                5599
function.shm-remove-var.php                        30-May-2024 18:01                4434
function.shm-remove.php                            30-May-2024 18:01                4177
function.shmop-close.php                           30-May-2024 18:01                5048
function.shmop-delete.php                          30-May-2024 18:01                4403
function.shmop-open.php                            30-May-2024 18:01               10336
function.shmop-read.php                            30-May-2024 18:01                7041
function.shmop-size.php                            30-May-2024 18:01                4451
function.shmop-write.php                           30-May-2024 18:01                6655                           30-May-2024 18:01                1779
function.shuffle.php                               30-May-2024 18:01                7342
function.simdjson-decode.php                       30-May-2024 18:01               17037
function.simdjson-is-valid.php                     30-May-2024 18:01               10547
function.simdjson-key-count.php                    30-May-2024 18:01                4802
function.simdjson-key-exists.php                   30-May-2024 18:01                4627
function.simdjson-key-value.php                    30-May-2024 18:01                7307
function.similar-text.php                          30-May-2024 18:01                7690
function.simplexml-import-dom.php                  30-May-2024 18:01                6547
function.simplexml-load-file.php                   30-May-2024 18:01               10590
function.simplexml-load-string.php                 30-May-2024 18:01               10335
function.sin.php                                   30-May-2024 18:01                4615
function.sinh.php                                  30-May-2024 18:01                3260
function.sizeof.php                                30-May-2024 18:01                1668
function.sleep.php                                 30-May-2024 18:01                7523
function.snmp-get-quick-print.php                  30-May-2024 18:01                3776
function.snmp-get-valueretrieval.php               30-May-2024 18:01                4470
function.snmp-read-mib.php                         30-May-2024 18:01                4919
function.snmp-set-enum-print.php                   30-May-2024 18:01                5386
function.snmp-set-oid-numeric-print.php            30-May-2024 18:01                2351
function.snmp-set-oid-output-format.php            30-May-2024 18:01                7816
function.snmp-set-quick-print.php                  30-May-2024 18:01                7434
function.snmp-set-valueretrieval.php               30-May-2024 18:01                9527
function.snmp2-get.php                             30-May-2024 18:01                5818
function.snmp2-getnext.php                         30-May-2024 18:01                6186
function.snmp2-real-walk.php                       30-May-2024 18:01                6625
function.snmp2-set.php                             30-May-2024 18:01               11192
function.snmp2-walk.php                            30-May-2024 18:01                7110
function.snmp3-get.php                             30-May-2024 18:01                8915
function.snmp3-getnext.php                         30-May-2024 18:01                9243
function.snmp3-real-walk.php                       30-May-2024 18:01                9927
function.snmp3-set.php                             30-May-2024 18:01               13969
function.snmp3-walk.php                            30-May-2024 18:01               10388
function.snmpget.php                               30-May-2024 18:01                5909
function.snmpgetnext.php                           30-May-2024 18:01                6063
function.snmprealwalk.php                          30-May-2024 18:01                6494
function.snmpset.php                               30-May-2024 18:01               11361
function.snmpwalk.php                              30-May-2024 18:01                7256
function.snmpwalkoid.php                           30-May-2024 18:01                8185
function.socket-accept.php                         30-May-2024 18:01                7259
function.socket-addrinfo-bind.php                  30-May-2024 18:01                5468
function.socket-addrinfo-connect.php               30-May-2024 18:01                5257
function.socket-addrinfo-explain.php               30-May-2024 18:01                4497
function.socket-addrinfo-lookup.php                30-May-2024 18:01                6092
function.socket-atmark.php                         30-May-2024 18:01                5034
function.socket-bind.php                           30-May-2024 18:01               11477
function.socket-clear-error.php                    30-May-2024 18:01                4923
function.socket-close.php                          30-May-2024 18:01                4738
function.socket-cmsg-space.php                     30-May-2024 18:01                3803
function.socket-connect.php                        30-May-2024 18:01                8111
function.socket-create-listen.php                  30-May-2024 18:01                7563
function.socket-create-pair.php                    30-May-2024 18:01               20350
function.socket-create.php                         30-May-2024 18:01               13812
function.socket-export-stream.php                  30-May-2024 18:01                3587
function.socket-get-option.php                     30-May-2024 18:01               33955
function.socket-get-status.php                     30-May-2024 18:01                1853
function.socket-getopt.php                         30-May-2024 18:01                1833
function.socket-getpeername.php                    30-May-2024 18:01                8795
function.socket-getsockname.php                    30-May-2024 18:01                8168
function.socket-import-stream.php                  30-May-2024 18:01                5179
function.socket-last-error.php                     30-May-2024 18:01                7548
function.socket-listen.php                         30-May-2024 18:01                7932
function.socket-read.php                           30-May-2024 18:01                8440
function.socket-recv.php                           30-May-2024 18:01               16819
function.socket-recvfrom.php                       30-May-2024 18:01               14409
function.socket-recvmsg.php                        30-May-2024 18:01                4474
function.socket-select.php                         30-May-2024 18:01               16770
function.socket-send.php                           30-May-2024 18:01                7133
function.socket-sendmsg.php                        30-May-2024 18:01                4619
function.socket-sendto.php                         30-May-2024 18:01               10385
function.socket-set-block.php                      30-May-2024 18:01                6316
function.socket-set-blocking.php                   30-May-2024 18:01                1871
function.socket-set-nonblock.php                   30-May-2024 18:01                6769
function.socket-set-option.php                     30-May-2024 18:01               11761
function.socket-set-timeout.php                    30-May-2024 18:01                1840
function.socket-setopt.php                         30-May-2024 18:01                1827
function.socket-shutdown.php                       30-May-2024 18:01                5184
function.socket-strerror.php                       30-May-2024 18:01                7428
function.socket-write.php                          30-May-2024 18:01                7797
function.socket-wsaprotocol-info-export.php        30-May-2024 18:01                5116
function.socket-wsaprotocol-info-import.php        30-May-2024 18:01                4497
function.socket-wsaprotocol-info-release.php       30-May-2024 18:01                3684
function.sodium-add.php                            30-May-2024 18:01                3387
function.sodium-base642bin.php                     30-May-2024 18:01                4762
function.sodium-bin2base64.php                     30-May-2024 18:01                4265
function.sodium-bin2hex.php                        30-May-2024 18:01                2883
function.sodium-compare.php                        30-May-2024 18:01                3531
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-May-2024 18:01                4906
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-May-2024 18:01                4709
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-May-2024 18:01                2911
function.sodium-crypto-aead-aes256gcm-keygen.php   30-May-2024 18:01                2914
function.sodium-crypto-aead-chacha20poly1305-de..> 30-May-2024 18:01                4771
function.sodium-crypto-aead-chacha20poly1305-en..> 30-May-2024 18:01                4574
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-May-2024 18:01                5005
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-May-2024 18:01                4744
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-May-2024 18:01                3105
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-May-2024 18:01                3041
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-May-2024 18:01                5201
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-May-2024 18:01                4984
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-May-2024 18:01                3083
function.sodium-crypto-auth-keygen.php             30-May-2024 18:01                2676
function.sodium-crypto-auth-verify.php             30-May-2024 18:01                4021
function.sodium-crypto-auth.php                    30-May-2024 18:01                3472
function.sodium-crypto-box-keypair-from-secretk..> 30-May-2024 18:01                3551
function.sodium-crypto-box-keypair.php             30-May-2024 18:01                2957
function.sodium-crypto-box-open.php                30-May-2024 18:01                4131
function.sodium-crypto-box-publickey-from-secre..> 30-May-2024 18:01                3382
function.sodium-crypto-box-publickey.php           30-May-2024 18:01                3095
function.sodium-crypto-box-seal-open.php           30-May-2024 18:01                6192
function.sodium-crypto-box-seal.php                30-May-2024 18:01                7307
function.sodium-crypto-box-secretkey.php           30-May-2024 18:01                3062
function.sodium-crypto-box-seed-keypair.php        30-May-2024 18:01                3121
function.sodium-crypto-box.php                     30-May-2024 18:01                4438
function.sodium-crypto-core-ristretto255-add.php   30-May-2024 18:01                6161
function.sodium-crypto-core-ristretto255-from-h..> 30-May-2024 18:01                5537
function.sodium-crypto-core-ristretto255-is-val..> 30-May-2024 18:01                5719
function.sodium-crypto-core-ristretto255-random..> 30-May-2024 18:01                5673
function.sodium-crypto-core-ristretto255-scalar..> 30-May-2024 18:01                6428
function.sodium-crypto-core-ristretto255-scalar..> 30-May-2024 18:01                3645
function.sodium-crypto-core-ristretto255-scalar..> 30-May-2024 18:01                5520
function.sodium-crypto-core-ristretto255-scalar..> 30-May-2024 18:01                3904
function.sodium-crypto-core-ristretto255-scalar..> 30-May-2024 18:01                5504
function.sodium-crypto-core-ristretto255-scalar..> 30-May-2024 18:01                5832
function.sodium-crypto-core-ristretto255-scalar..> 30-May-2024 18:01                3589
function.sodium-crypto-core-ristretto255-scalar..> 30-May-2024 18:01                6419
function.sodium-crypto-core-ristretto255-sub.php   30-May-2024 18:01                6198
function.sodium-crypto-generichash-final.php       30-May-2024 18:01                6923
function.sodium-crypto-generichash-init.php        30-May-2024 18:01                6970
function.sodium-crypto-generichash-keygen.php      30-May-2024 18:01                2486
function.sodium-crypto-generichash-update.php      30-May-2024 18:01                6607
function.sodium-crypto-generichash.php             30-May-2024 18:01                3877
function.sodium-crypto-kdf-derive-from-key.php     30-May-2024 18:01                4088
function.sodium-crypto-kdf-keygen.php              30-May-2024 18:01                2588
function.sodium-crypto-kx-client-session-keys.php  30-May-2024 18:01                3504
function.sodium-crypto-kx-keypair.php              30-May-2024 18:01                5049
function.sodium-crypto-kx-publickey.php            30-May-2024 18:01                2914
function.sodium-crypto-kx-secretkey.php            30-May-2024 18:01                2925
function.sodium-crypto-kx-seed-keypair.php         30-May-2024 18:01                2877
function.sodium-crypto-kx-server-session-keys.php  30-May-2024 18:01                3570
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-May-2024 18:01                3482
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-May-2024 18:01                3685
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-May-2024 18:01                6570
function.sodium-crypto-pwhash-str-needs-rehash.php 30-May-2024 18:01                4047
function.sodium-crypto-pwhash-str-verify.php       30-May-2024 18:01                4952
function.sodium-crypto-pwhash-str.php              30-May-2024 18:01                8789
function.sodium-crypto-pwhash.php                  30-May-2024 18:01               10575
function.sodium-crypto-scalarmult-base.php         30-May-2024 18:01                2080
function.sodium-crypto-scalarmult-ristretto255-..> 30-May-2024 18:01                3558
function.sodium-crypto-scalarmult-ristretto255.php 30-May-2024 18:01                3907
function.sodium-crypto-scalarmult.php              30-May-2024 18:01                3096
function.sodium-crypto-secretbox-keygen.php        30-May-2024 18:01                6340
function.sodium-crypto-secretbox-open.php          30-May-2024 18:01                8947
function.sodium-crypto-secretbox.php               30-May-2024 18:01                8928
function.sodium-crypto-secretstream-xchacha20po..> 30-May-2024 18:01               11027
function.sodium-crypto-secretstream-xchacha20po..> 30-May-2024 18:01               10361
function.sodium-crypto-secretstream-xchacha20po..> 30-May-2024 18:01                2752
function.sodium-crypto-secretstream-xchacha20po..> 30-May-2024 18:01                5854
function.sodium-crypto-secretstream-xchacha20po..> 30-May-2024 18:01                5962
function.sodium-crypto-secretstream-xchacha20po..> 30-May-2024 18:01                3015
function.sodium-crypto-shorthash-keygen.php        30-May-2024 18:01                2750
function.sodium-crypto-shorthash.php               30-May-2024 18:01                3305
function.sodium-crypto-sign-detached.php           30-May-2024 18:01                3298
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-May-2024 18:01                2985
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-May-2024 18:01                3138
function.sodium-crypto-sign-keypair-from-secret..> 30-May-2024 18:01                3377
function.sodium-crypto-sign-keypair.php            30-May-2024 18:01                2474
function.sodium-crypto-sign-open.php               30-May-2024 18:01                3400
function.sodium-crypto-sign-publickey-from-secr..> 30-May-2024 18:01                2940
function.sodium-crypto-sign-publickey.php          30-May-2024 18:01                2950
function.sodium-crypto-sign-secretkey.php          30-May-2024 18:01                2926
function.sodium-crypto-sign-seed-keypair.php       30-May-2024 18:01                3159
function.sodium-crypto-sign-verify-detached.php    30-May-2024 18:01                3701
function.sodium-crypto-sign.php                    30-May-2024 18:01                3376
function.sodium-crypto-stream-keygen.php           30-May-2024 18:01                2657
function.sodium-crypto-stream-xchacha20-keygen.php 30-May-2024 18:01                2815
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-May-2024 18:01                9880
function.sodium-crypto-stream-xchacha20-xor.php    30-May-2024 18:01                4917
function.sodium-crypto-stream-xchacha20.php        30-May-2024 18:01                3832
function.sodium-crypto-stream-xor.php              30-May-2024 18:01                3715
function.sodium-crypto-stream.php                  30-May-2024 18:01                3551
function.sodium-hex2bin.php                        30-May-2024 18:01                3490
function.sodium-increment.php                      30-May-2024 18:01                2635
function.sodium-memcmp.php                         30-May-2024 18:01                3866
function.sodium-memzero.php                        30-May-2024 18:01                2667
function.sodium-pad.php                            30-May-2024 18:01                2975
function.sodium-unpad.php                          30-May-2024 18:01                2905
function.solr-get-version.php                      30-May-2024 18:01                3990
function.sort.php                                  30-May-2024 18:01               12804
function.soundex.php                               30-May-2024 18:01                7399
function.spl-autoload-call.php                     30-May-2024 18:01                2684
function.spl-autoload-extensions.php               30-May-2024 18:01                5120
function.spl-autoload-functions.php                30-May-2024 18:01                3336
function.spl-autoload-register.php                 30-May-2024 18:01               13569
function.spl-autoload-unregister.php               30-May-2024 18:01                3143
function.spl-autoload.php                          30-May-2024 18:01                4733
function.spl-classes.php                           30-May-2024 18:01                3846
function.spl-object-hash.php                       30-May-2024 18:01                5073
function.spl-object-id.php                         30-May-2024 18:01                4173
function.sprintf.php                               30-May-2024 18:01               30133
function.sqlsrv-begin-transaction.php              30-May-2024 18:01               11322
function.sqlsrv-cancel.php                         30-May-2024 18:01               10390
function.sqlsrv-client-info.php                    30-May-2024 18:01                6788
function.sqlsrv-close.php                          30-May-2024 18:01                5654
function.sqlsrv-commit.php                         30-May-2024 18:01               11169
function.sqlsrv-configure.php                      30-May-2024 18:01                4785
function.sqlsrv-connect.php                        30-May-2024 18:01               12244
function.sqlsrv-errors.php                         30-May-2024 18:01               10082
function.sqlsrv-execute.php                        30-May-2024 18:01               10213
function.sqlsrv-fetch-array.php                    30-May-2024 18:01               15663
function.sqlsrv-fetch-object.php                   30-May-2024 18:01               12419
function.sqlsrv-fetch.php                          30-May-2024 18:01               10861
function.sqlsrv-field-metadata.php                 30-May-2024 18:01                8899
function.sqlsrv-free-stmt.php                      30-May-2024 18:01                7791
function.sqlsrv-get-config.php                     30-May-2024 18:01                3372
function.sqlsrv-get-field.php                      30-May-2024 18:01               10233
function.sqlsrv-has-rows.php                       30-May-2024 18:01                6392
function.sqlsrv-next-result.php                    30-May-2024 18:01                9306
function.sqlsrv-num-fields.php                     30-May-2024 18:01                8226
function.sqlsrv-num-rows.php                       30-May-2024 18:01                7953
function.sqlsrv-prepare.php                        30-May-2024 18:01               14576
function.sqlsrv-query.php                          30-May-2024 18:01               11929
function.sqlsrv-rollback.php                       30-May-2024 18:01               10639
function.sqlsrv-rows-affected.php                  30-May-2024 18:01                8003
function.sqlsrv-send-stream-data.php               30-May-2024 18:01                8572
function.sqlsrv-server-info.php                    30-May-2024 18:01                6200
function.sqrt.php                                  30-May-2024 18:01                4683
function.srand.php                                 30-May-2024 18:01                7394
function.sscanf.php                                30-May-2024 18:01               11931
function.ssdeep-fuzzy-compare.php                  30-May-2024 18:01                3314
function.ssdeep-fuzzy-hash-filename.php            30-May-2024 18:01                3035
function.ssdeep-fuzzy-hash.php                     30-May-2024 18:01                2883
function.ssh2-auth-agent.php                       30-May-2024 18:01                4820
function.ssh2-auth-hostbased-file.php              30-May-2024 18:01                7801
function.ssh2-auth-none.php                        30-May-2024 18:01                4903
function.ssh2-auth-password.php                    30-May-2024 18:01                5078
function.ssh2-auth-pubkey-file.php                 30-May-2024 18:01                7302
function.ssh2-connect.php                          30-May-2024 18:01               15798
function.ssh2-disconnect.php                       30-May-2024 18:01                3156
function.ssh2-exec.php                             30-May-2024 18:01                7682
function.ssh2-fetch-stream.php                     30-May-2024 18:01                5579
function.ssh2-fingerprint.php                      30-May-2024 18:01                5574
function.ssh2-forward-accept.php                   30-May-2024 18:01                3142
function.ssh2-forward-listen.php                   30-May-2024 18:01                4585
function.ssh2-methods-negotiated.php               30-May-2024 18:01                8037
function.ssh2-poll.php                             30-May-2024 18:01                3610
function.ssh2-publickey-add.php                    30-May-2024 18:01                8543
function.ssh2-publickey-init.php                   30-May-2024 18:01                4792
function.ssh2-publickey-list.php                   30-May-2024 18:01                8953
function.ssh2-publickey-remove.php                 30-May-2024 18:01                4834
function.ssh2-scp-recv.php                         30-May-2024 18:01                5530
function.ssh2-scp-send.php                         30-May-2024 18:01                6141
function.ssh2-send-eof.php                         30-May-2024 18:01                3509
function.ssh2-sftp-chmod.php                       30-May-2024 18:01                6077
function.ssh2-sftp-lstat.php                       30-May-2024 18:01                7366
function.ssh2-sftp-mkdir.php                       30-May-2024 18:01                6919
function.ssh2-sftp-readlink.php                    30-May-2024 18:01                5386
function.ssh2-sftp-realpath.php                    30-May-2024 18:01                5626
function.ssh2-sftp-rename.php                      30-May-2024 18:01                5638
function.ssh2-sftp-rmdir.php                       30-May-2024 18:01                5625
function.ssh2-sftp-stat.php                        30-May-2024 18:01                7281
function.ssh2-sftp-symlink.php                     30-May-2024 18:01                5829
function.ssh2-sftp-unlink.php                      30-May-2024 18:01                5100
function.ssh2-sftp.php                             30-May-2024 18:01                5528
function.ssh2-shell.php                            30-May-2024 18:01                8144
function.ssh2-tunnel.php                           30-May-2024 18:01                5386
function.stat.php                                  30-May-2024 18:01               16738
function.stats-absolute-deviation.php              30-May-2024 18:01                2872
function.stats-cdf-beta.php                        30-May-2024 18:01                5235
function.stats-cdf-binomial.php                    30-May-2024 18:01                5220
function.stats-cdf-cauchy.php                      30-May-2024 18:01                5255
function.stats-cdf-chisquare.php                   30-May-2024 18:01                4574
function.stats-cdf-exponential.php                 30-May-2024 18:01                4605
function.stats-cdf-f.php                           30-May-2024 18:01                5160
function.stats-cdf-gamma.php                       30-May-2024 18:01                5219
function.stats-cdf-laplace.php                     30-May-2024 18:01                5240
function.stats-cdf-logistic.php                    30-May-2024 18:01                5275
function.stats-cdf-negative-binomial.php           30-May-2024 18:01                5363
function.stats-cdf-noncentral-chisquare.php        30-May-2024 18:01                5465
function.stats-cdf-noncentral-f.php                30-May-2024 18:01                6039
function.stats-cdf-noncentral-t.php                30-May-2024 18:01                5325
function.stats-cdf-normal.php                      30-May-2024 18:01                5257
function.stats-cdf-poisson.php                     30-May-2024 18:01                4539
function.stats-cdf-t.php                           30-May-2024 18:01                4467
function.stats-cdf-uniform.php                     30-May-2024 18:01                5220
function.stats-cdf-weibull.php                     30-May-2024 18:01                5257
function.stats-covariance.php                      30-May-2024 18:01                3068
function.stats-dens-beta.php                       30-May-2024 18:01                3554
function.stats-dens-cauchy.php                     30-May-2024 18:01                3612
function.stats-dens-chisquare.php                  30-May-2024 18:01                3282
function.stats-dens-exponential.php                30-May-2024 18:01                3272
function.stats-dens-f.php                          30-May-2024 18:01                3552
function.stats-dens-gamma.php                      30-May-2024 18:01                3605
function.stats-dens-laplace.php                    30-May-2024 18:01                3639
function.stats-dens-logistic.php                   30-May-2024 18:01                3651
function.stats-dens-normal.php                     30-May-2024 18:01                3622
function.stats-dens-pmf-binomial.php               30-May-2024 18:01                3676
function.stats-dens-pmf-hypergeometric.php         30-May-2024 18:01                4328
function.stats-dens-pmf-negative-binomial.php      30-May-2024 18:01                3805
function.stats-dens-pmf-poisson.php                30-May-2024 18:01                3273
function.stats-dens-t.php                          30-May-2024 18:01                3186
function.stats-dens-uniform.php                    30-May-2024 18:01                3587
function.stats-dens-weibull.php                    30-May-2024 18:01                3619
function.stats-harmonic-mean.php                   30-May-2024 18:01                2767
function.stats-kurtosis.php                        30-May-2024 18:01                2775
function.stats-rand-gen-beta.php                   30-May-2024 18:01                3081
function.stats-rand-gen-chisquare.php              30-May-2024 18:01                2754
function.stats-rand-gen-exponential.php            30-May-2024 18:01                2752
function.stats-rand-gen-f.php                      30-May-2024 18:01                3135
function.stats-rand-gen-funiform.php               30-May-2024 18:01                3062
function.stats-rand-gen-gamma.php                  30-May-2024 18:01                3148
function.stats-rand-gen-ibinomial-negative.php     30-May-2024 18:01                3228
function.stats-rand-gen-ibinomial.php              30-May-2024 18:01                3152
function.stats-rand-gen-int.php                    30-May-2024 18:01                2327
function.stats-rand-gen-ipoisson.php               30-May-2024 18:01                2727
function.stats-rand-gen-iuniform.php               30-May-2024 18:01                3129
function.stats-rand-gen-noncentral-chisquare.php   30-May-2024 18:01                3270
function.stats-rand-gen-noncentral-f.php           30-May-2024 18:01                3623
function.stats-rand-gen-noncentral-t.php           30-May-2024 18:01                3183
function.stats-rand-gen-normal.php                 30-May-2024 18:01                3096
function.stats-rand-gen-t.php                      30-May-2024 18:01                2646
function.stats-rand-get-seeds.php                  30-May-2024 18:01                2370
function.stats-rand-phrase-to-seeds.php            30-May-2024 18:01                2735
function.stats-rand-ranf.php                       30-May-2024 18:01                2371
function.stats-rand-setall.php                     30-May-2024 18:01                3004
function.stats-skew.php                            30-May-2024 18:01                2741
function.stats-standard-deviation.php              30-May-2024 18:01                3911
function.stats-stat-binomial-coef.php              30-May-2024 18:01                3041
function.stats-stat-correlation.php                30-May-2024 18:01                3248
function.stats-stat-factorial.php                  30-May-2024 18:01                2614
function.stats-stat-independent-t.php              30-May-2024 18:01                3380
function.stats-stat-innerproduct.php               30-May-2024 18:01                3190
function.stats-stat-paired-t.php                   30-May-2024 18:01                3127
function.stats-stat-percentile.php                 30-May-2024 18:01                2993
function.stats-stat-powersum.php                   30-May-2024 18:01                2985
function.stats-variance.php                        30-May-2024 18:01                3412
function.stomp-connect-error.php                   30-May-2024 18:01                3757
function.stomp-version.php                         30-May-2024 18:01                3184
function.str-contains.php                          30-May-2024 18:01                8496
function.str-decrement.php                         30-May-2024 18:01                6596
function.str-ends-with.php                         30-May-2024 18:01                8423
function.str-getcsv.php                            30-May-2024 18:01                9612
function.str-increment.php                         30-May-2024 18:01                6283
function.str-ireplace.php                          30-May-2024 18:01                9929
function.str-pad.php                               30-May-2024 18:01                8623
function.str-repeat.php                            30-May-2024 18:01                4882
function.str-replace.php                           30-May-2024 18:01               17505
function.str-rot13.php                             30-May-2024 18:01                3775
function.str-shuffle.php                           30-May-2024 18:01                6251
function.str-split.php                             30-May-2024 18:01                9021
function.str-starts-with.php                       30-May-2024 18:01                8451
function.str-word-count.php                        30-May-2024 18:01                9525
function.strcasecmp.php                            30-May-2024 18:01                6788
function.strchr.php                                30-May-2024 18:01                1689
function.strcmp.php                                30-May-2024 18:01                6340
function.strcoll.php                               30-May-2024 18:01                5447
function.strcspn.php                               30-May-2024 18:01               11855                  30-May-2024 18:01                2337          30-May-2024 18:01                4447                     30-May-2024 18:01                2367                 30-May-2024 18:01                6366                 30-May-2024 18:01                7828            30-May-2024 18:01                8907            30-May-2024 18:01                4543             30-May-2024 18:01                5583            30-May-2024 18:01                6275             30-May-2024 18:01                5589            30-May-2024 18:01                6473             30-May-2024 18:01                4743                 30-May-2024 18:01                7785                  30-May-2024 18:01               10945                 30-May-2024 18:01                8261                30-May-2024 18:01               18500                  30-May-2024 18:01                6746                   30-May-2024 18:01                9103                    30-May-2024 18:01                4103                       30-May-2024 18:01                5094                  30-May-2024 18:01               14758                 30-May-2024 18:01                4089                   30-May-2024 18:01                4854                       30-May-2024 18:01                4337                         30-May-2024 18:01                4081          30-May-2024 18:01               22397               30-May-2024 18:01                1955           30-May-2024 18:01                4436                         30-May-2024 18:01               16408                   30-May-2024 18:01                4890                 30-May-2024 18:01                4330                30-May-2024 18:01                3781                    30-May-2024 18:01                8168               30-May-2024 18:01                5895                  30-May-2024 18:01                7694                  30-May-2024 18:01               17821           30-May-2024 18:01               13444                30-May-2024 18:01                3954                    30-May-2024 18:01                9940                30-May-2024 18:01               10877                  30-May-2024 18:01                7559                  30-May-2024 18:01               15497                30-May-2024 18:01                6703                  30-May-2024 18:01                3307               30-May-2024 18:01                9441                30-May-2024 18:01                2988             30-May-2024 18:01                3189
function.strftime.php                              30-May-2024 18:01               59571
function.strip-tags.php                            30-May-2024 18:01                9785
function.stripcslashes.php                         30-May-2024 18:01                4133
function.stripos.php                               30-May-2024 18:01               12590
function.stripslashes.php                          30-May-2024 18:01                7795
function.stristr.php                               30-May-2024 18:01               10919
function.strlen.php                                30-May-2024 18:01                5073
function.strnatcasecmp.php                         30-May-2024 18:01                8030
function.strnatcmp.php                             30-May-2024 18:01                9294
function.strncasecmp.php                           30-May-2024 18:01                7270
function.strncmp.php                               30-May-2024 18:01                7183
function.strpbrk.php                               30-May-2024 18:01                5557
function.strpos.php                                30-May-2024 18:01               14588
function.strptime.php                              30-May-2024 18:01               12173
function.strrchr.php                               30-May-2024 18:01                8763
function.strrev.php                                30-May-2024 18:01                3262
function.strripos.php                              30-May-2024 18:01               11439
function.strrpos.php                               30-May-2024 18:01               14009
function.strspn.php                                30-May-2024 18:01               11190
function.strstr.php                                30-May-2024 18:01                9261
function.strtok.php                                30-May-2024 18:01               14228
function.strtolower.php                            30-May-2024 18:01                6196
function.strtotime.php                             30-May-2024 18:01               13590
function.strtoupper.php                            30-May-2024 18:01                6193
function.strtr.php                                 30-May-2024 18:01               12514
function.strval.php                                30-May-2024 18:01                6638
function.substr-compare.php                        30-May-2024 18:01               11522
function.substr-count.php                          30-May-2024 18:01               10045
function.substr-replace.php                        30-May-2024 18:01               16995
function.substr.php                                30-May-2024 18:01               23200
function.svn-add.php                               30-May-2024 18:01                6580
function.svn-auth-get-parameter.php                30-May-2024 18:01                4046
function.svn-auth-set-parameter.php                30-May-2024 18:01                5499
function.svn-blame.php                             30-May-2024 18:01                5044
function.svn-cat.php                               30-May-2024 18:01                4912
function.svn-checkout.php                          30-May-2024 18:01                7580
function.svn-cleanup.php                           30-May-2024 18:01                5350
function.svn-client-version.php                    30-May-2024 18:01                3583
function.svn-commit.php                            30-May-2024 18:01                8277
function.svn-delete.php                            30-May-2024 18:01                4908
function.svn-diff.php                              30-May-2024 18:01               13574
function.svn-export.php                            30-May-2024 18:01                5426
function.svn-fs-abort-txn.php                      30-May-2024 18:01                3320
function.svn-fs-apply-text.php                     30-May-2024 18:01                2880
function.svn-fs-begin-txn2.php                     30-May-2024 18:01                2823
function.svn-fs-change-node-prop.php               30-May-2024 18:01                3351
function.svn-fs-check-path.php                     30-May-2024 18:01                2925
function.svn-fs-contents-changed.php               30-May-2024 18:01                3356
function.svn-fs-copy.php                           30-May-2024 18:01                4313
function.svn-fs-delete.php                         30-May-2024 18:01                3598
function.svn-fs-dir-entries.php                    30-May-2024 18:01                2938
function.svn-fs-file-contents.php                  30-May-2024 18:01                2961
function.svn-fs-file-length.php                    30-May-2024 18:01                2884
function.svn-fs-is-dir.php                         30-May-2024 18:01                3629
function.svn-fs-is-file.php                        30-May-2024 18:01                3617
function.svn-fs-make-dir.php                       30-May-2024 18:01                3622
function.svn-fs-make-file.php                      30-May-2024 18:01                3639
function.svn-fs-node-created-rev.php               30-May-2024 18:01                2927
function.svn-fs-node-prop.php                      30-May-2024 18:01                3025
function.svn-fs-props-changed.php                  30-May-2024 18:01                3343
function.svn-fs-revision-prop.php                  30-May-2024 18:01                3038
function.svn-fs-revision-root.php                  30-May-2024 18:01                2906
function.svn-fs-txn-root.php                       30-May-2024 18:01                2671
function.svn-fs-youngest-rev.php                   30-May-2024 18:01                2713
function.svn-import.php                            30-May-2024 18:01                6240
function.svn-log.php                               30-May-2024 18:01                9188
function.svn-ls.php                                30-May-2024 18:01                7442
function.svn-mkdir.php                             30-May-2024 18:01                3338
function.svn-repos-create.php                      30-May-2024 18:01                3091
function.svn-repos-fs-begin-txn-for-commit.php     30-May-2024 18:01                3411
function.svn-repos-fs-commit-txn.php               30-May-2024 18:01                2768
function.svn-repos-fs.php                          30-May-2024 18:01                2668
function.svn-repos-hotcopy.php                     30-May-2024 18:01                3037
function.svn-repos-open.php                        30-May-2024 18:01                2640
function.svn-repos-recover.php                     30-May-2024 18:01                2684
function.svn-revert.php                            30-May-2024 18:01                3675
function.svn-status.php                            30-May-2024 18:01               14911
function.svn-update.php                            30-May-2024 18:01                6379
function.swoole-async-dns-lookup.php               30-May-2024 18:01                3922
function.swoole-async-read.php                     30-May-2024 18:01                4513
function.swoole-async-readfile.php                 30-May-2024 18:01                3943
function.swoole-async-set.php                      30-May-2024 18:01                2472
function.swoole-async-write.php                    30-May-2024 18:01                3823
function.swoole-async-writefile.php                30-May-2024 18:01                3851
function.swoole-clear-error.php                    30-May-2024 18:01                2337
function.swoole-client-select.php                  30-May-2024 18:01                3545
function.swoole-cpu-num.php                        30-May-2024 18:01                2179
function.swoole-errno.php                          30-May-2024 18:01                2156
function.swoole-error-log.php                      30-May-2024 18:01                3623
function.swoole-event-add.php                      30-May-2024 18:01                3552
function.swoole-event-defer.php                    30-May-2024 18:01                2706
function.swoole-event-del.php                      30-May-2024 18:01                2672
function.swoole-event-exit.php                     30-May-2024 18:01                2222
function.swoole-event-set.php                      30-May-2024 18:01                3540
function.swoole-event-wait.php                     30-May-2024 18:01                2193
function.swoole-event-write.php                    30-May-2024 18:01                2944
function.swoole-get-local-ip.php                   30-May-2024 18:01                2250
function.swoole-last-error.php                     30-May-2024 18:01                2205
function.swoole-load-module.php                    30-May-2024 18:01                2363
function.swoole-select.php                         30-May-2024 18:01                3512
function.swoole-set-process-name.php               30-May-2024 18:01                2685
function.swoole-strerror.php                       30-May-2024 18:01                2639
function.swoole-timer-after.php                    30-May-2024 18:01                3063
function.swoole-timer-exists.php                   30-May-2024 18:01                2476
function.swoole-timer-tick.php                     30-May-2024 18:01                2940
function.swoole-version.php                        30-May-2024 18:01                2184
function.symlink.php                               30-May-2024 18:01                5724
function.sys-get-temp-dir.php                      30-May-2024 18:01                4231
function.sys-getloadavg.php                        30-May-2024 18:01                4289
function.syslog.php                                30-May-2024 18:01                9703
function.system.php                                30-May-2024 18:01                8017
function.taint.php                                 30-May-2024 18:01                2720
function.tan.php                                   30-May-2024 18:01                4317
function.tanh.php                                  30-May-2024 18:01                3269
function.tcpwrap-check.php                         30-May-2024 18:01                5868
function.tempnam.php                               30-May-2024 18:01                7333
function.textdomain.php                            30-May-2024 18:01                3376
function.tidy-access-count.php                     30-May-2024 18:01                6450
function.tidy-config-count.php                     30-May-2024 18:01                4356
function.tidy-error-count.php                      30-May-2024 18:01                5390
function.tidy-get-output.php                       30-May-2024 18:01                4339
function.tidy-warning-count.php                    30-May-2024 18:01                4929
function.time-nanosleep.php                        30-May-2024 18:01                8891
function.time-sleep-until.php                      30-May-2024 18:01                6071
function.time.php                                  30-May-2024 18:01                4758
function.timezone-abbreviations-list.php           30-May-2024 18:01                1958
function.timezone-identifiers-list.php             30-May-2024 18:01                1974
function.timezone-location-get.php                 30-May-2024 18:01                1930
function.timezone-name-from-abbr.php               30-May-2024 18:01                6454
function.timezone-name-get.php                     30-May-2024 18:01                1874
function.timezone-offset-get.php                   30-May-2024 18:01                1872
function.timezone-open.php                         30-May-2024 18:01                1860
function.timezone-transitions-get.php              30-May-2024 18:01                1933
function.timezone-version-get.php                  30-May-2024 18:01                4533
function.tmpfile.php                               30-May-2024 18:01                5617
function.token-get-all.php                         30-May-2024 18:01               12179
function.token-name.php                            30-May-2024 18:01                4214
function.touch.php                                 30-May-2024 18:01                8392
function.trader-acos.php                           30-May-2024 18:01                2520
function.trader-ad.php                             30-May-2024 18:01                3433
function.trader-add.php                            30-May-2024 18:01                2850
function.trader-adosc.php                          30-May-2024 18:01                4293
function.trader-adx.php                            30-May-2024 18:01                3519
function.trader-adxr.php                           30-May-2024 18:01                3530
function.trader-apo.php                            30-May-2024 18:01                3719
function.trader-aroon.php                          30-May-2024 18:01                3087
function.trader-aroonosc.php                       30-May-2024 18:01                3124
function.trader-asin.php                           30-May-2024 18:01                2534
function.trader-atan.php                           30-May-2024 18:01                2527
function.trader-atr.php                            30-May-2024 18:01                3509
function.trader-avgprice.php                       30-May-2024 18:01                3490
function.trader-bbands.php                         30-May-2024 18:01                4478
function.trader-beta.php                           30-May-2024 18:01                3055
function.trader-bop.php                            30-May-2024 18:01                3439
function.trader-cci.php                            30-May-2024 18:01                3514
function.trader-cdl2crows.php                      30-May-2024 18:01                3512
function.trader-cdl3blackcrows.php                 30-May-2024 18:01                3574
function.trader-cdl3inside.php                     30-May-2024 18:01                3555
function.trader-cdl3linestrike.php                 30-May-2024 18:01                3578
function.trader-cdl3outside.php                    30-May-2024 18:01                3570
function.trader-cdl3starsinsouth.php               30-May-2024 18:01                3619
function.trader-cdl3whitesoldiers.php              30-May-2024 18:01                3643
function.trader-cdlabandonedbaby.php               30-May-2024 18:01                4031
function.trader-cdladvanceblock.php                30-May-2024 18:01                3596
function.trader-cdlbelthold.php                    30-May-2024 18:01                3552
function.trader-cdlbreakaway.php                   30-May-2024 18:01                3566
function.trader-cdlclosingmarubozu.php             30-May-2024 18:01                3637
function.trader-cdlconcealbabyswall.php            30-May-2024 18:01                3660
function.trader-cdlcounterattack.php               30-May-2024 18:01                3624
function.trader-cdldarkcloudcover.php              30-May-2024 18:01                4025
function.trader-cdldoji.php                        30-May-2024 18:01                3509
function.trader-cdldojistar.php                    30-May-2024 18:01                3544
function.trader-cdldragonflydoji.php               30-May-2024 18:01                3599
function.trader-cdlengulfing.php                   30-May-2024 18:01                3584
function.trader-cdleveningdojistar.php             30-May-2024 18:01                4042
function.trader-cdleveningstar.php                 30-May-2024 18:01                4019
function.trader-cdlgapsidesidewhite.php            30-May-2024 18:01                3667
function.trader-cdlgravestonedoji.php              30-May-2024 18:01                3620
function.trader-cdlhammer.php                      30-May-2024 18:01                3535
function.trader-cdlhangingman.php                  30-May-2024 18:01                3556
function.trader-cdlharami.php                      30-May-2024 18:01                3537
function.trader-cdlharamicross.php                 30-May-2024 18:01                3579
function.trader-cdlhighwave.php                    30-May-2024 18:01                3553
function.trader-cdlhikkake.php                     30-May-2024 18:01                3542
function.trader-cdlhikkakemod.php                  30-May-2024 18:01                3583
function.trader-cdlhomingpigeon.php                30-May-2024 18:01                3604
function.trader-cdlidentical3crows.php             30-May-2024 18:01                3628
function.trader-cdlinneck.php                      30-May-2024 18:01                3554
function.trader-cdlinvertedhammer.php              30-May-2024 18:01                3602
function.trader-cdlkicking.php                     30-May-2024 18:01                3556
function.trader-cdlkickingbylength.php             30-May-2024 18:01                3662
function.trader-cdlladderbottom.php                30-May-2024 18:01                3612
function.trader-cdllongleggeddoji.php              30-May-2024 18:01                3617
function.trader-cdllongline.php                    30-May-2024 18:01                3561
function.trader-cdlmarubozu.php                    30-May-2024 18:01                3547
function.trader-cdlmatchinglow.php                 30-May-2024 18:01                3573
function.trader-cdlmathold.php                     30-May-2024 18:01                3965
function.trader-cdlmorningdojistar.php             30-May-2024 18:01                4038
function.trader-cdlmorningstar.php                 30-May-2024 18:01                3999
function.trader-cdlonneck.php                      30-May-2024 18:01                3534
function.trader-cdlpiercing.php                    30-May-2024 18:01                3551
function.trader-cdlrickshawman.php                 30-May-2024 18:01                3591
function.trader-cdlrisefall3methods.php            30-May-2024 18:01                3661
function.trader-cdlseparatinglines.php             30-May-2024 18:01                3643
function.trader-cdlshootingstar.php                30-May-2024 18:01                3602
function.trader-cdlshortline.php                   30-May-2024 18:01                3574
function.trader-cdlspinningtop.php                 30-May-2024 18:01                3589
function.trader-cdlstalledpattern.php              30-May-2024 18:01                3624
function.trader-cdlsticksandwich.php               30-May-2024 18:01                3605
function.trader-cdltakuri.php                      30-May-2024 18:01                3576
function.trader-cdltasukigap.php                   30-May-2024 18:01                3551
function.trader-cdlthrusting.php                   30-May-2024 18:01                3560
function.trader-cdltristar.php                     30-May-2024 18:01                3548
function.trader-cdlunique3river.php                30-May-2024 18:01                3599
function.trader-cdlupsidegap2crows.php             30-May-2024 18:01                3647
function.trader-cdlxsidegap3methods.php            30-May-2024 18:01                3646
function.trader-ceil.php                           30-May-2024 18:01                2551
function.trader-cmo.php                            30-May-2024 18:01                2768
function.trader-correl.php                         30-May-2024 18:01                3107
function.trader-cos.php                            30-May-2024 18:01                2517
function.trader-cosh.php                           30-May-2024 18:01                2533
function.trader-dema.php                           30-May-2024 18:01                2779
function.trader-div.php                            30-May-2024 18:01                2866
function.trader-dx.php                             30-May-2024 18:01                3495
function.trader-ema.php                            30-May-2024 18:01                2762
function.trader-errno.php                          30-May-2024 18:01                2249
function.trader-exp.php                            30-May-2024 18:01                2561
function.trader-floor.php                          30-May-2024 18:01                2543
function.trader-get-compat.php                     30-May-2024 18:01                2439
function.trader-get-unstable-period.php            30-May-2024 18:01                2765
function.trader-ht-dcperiod.php                    30-May-2024 18:01                2531
function.trader-ht-dcphase.php                     30-May-2024 18:01                2502
function.trader-ht-phasor.php                      30-May-2024 18:01                2483
function.trader-ht-sine.php                        30-May-2024 18:01                2462
function.trader-ht-trendline.php                   30-May-2024 18:01                2523
function.trader-ht-trendmode.php                   30-May-2024 18:01                2513
function.trader-kama.php                           30-May-2024 18:01                2817
function.trader-linearreg-angle.php                30-May-2024 18:01                2911
function.trader-linearreg-intercept.php            30-May-2024 18:01                2969
function.trader-linearreg-slope.php                30-May-2024 18:01                2921
function.trader-linearreg.php                      30-May-2024 18:01                2833
function.trader-ln.php                             30-May-2024 18:01                2519
function.trader-log10.php                          30-May-2024 18:01                2523
function.trader-ma.php                             30-May-2024 18:01                3183
function.trader-macd.php                           30-May-2024 18:01                3704
function.trader-macdext.php                        30-May-2024 18:01                5197
function.trader-macdfix.php                        30-May-2024 18:01                2863
function.trader-mama.php                           30-May-2024 18:01                3204
function.trader-mavp.php                           30-May-2024 18:01                4111
function.trader-max.php                            30-May-2024 18:01                2783
function.trader-maxindex.php                       30-May-2024 18:01                2840
function.trader-medprice.php                       30-May-2024 18:01                2754
function.trader-mfi.php                            30-May-2024 18:01                3858
function.trader-midpoint.php                       30-May-2024 18:01                2814
function.trader-midprice.php                       30-May-2024 18:01                3138
function.trader-min.php                            30-May-2024 18:01                2790
function.trader-minindex.php                       30-May-2024 18:01                2835
function.trader-minmax.php                         30-May-2024 18:01                2839
function.trader-minmaxindex.php                    30-May-2024 18:01                2890
function.trader-minus-di.php                       30-May-2024 18:01                3582
function.trader-minus-dm.php                       30-May-2024 18:01                3138
function.trader-mom.php                            30-May-2024 18:01                2754
function.trader-mult.php                           30-May-2024 18:01                2866
function.trader-natr.php                           30-May-2024 18:01                3520
function.trader-obv.php                            30-May-2024 18:01                2707
function.trader-plus-di.php                        30-May-2024 18:01                3553
function.trader-plus-dm.php                        30-May-2024 18:01                3125
function.trader-ppo.php                            30-May-2024 18:01                3723
function.trader-roc.php                            30-May-2024 18:01                2778
function.trader-rocp.php                           30-May-2024 18:01                2806
function.trader-rocr.php                           30-May-2024 18:01                2791
function.trader-rocr100.php                        30-May-2024 18:01                2831
function.trader-rsi.php                            30-May-2024 18:01                2759
function.trader-sar.php                            30-May-2024 18:01                3769
function.trader-sarext.php                         30-May-2024 18:01                7181
function.trader-set-compat.php                     30-May-2024 18:01                2681
function.trader-set-unstable-period.php            30-May-2024 18:01                3269
function.trader-sin.php                            30-May-2024 18:01                2541
function.trader-sinh.php                           30-May-2024 18:01                2529
function.trader-sma.php                            30-May-2024 18:01                2759
function.trader-sqrt.php                           30-May-2024 18:01                2522
function.trader-stddev.php                         30-May-2024 18:01                3103
function.trader-stoch.php                          30-May-2024 18:01                5387
function.trader-stochf.php                         30-May-2024 18:01                4494
function.trader-stochrsi.php                       30-May-2024 18:01                4236
function.trader-sub.php                            30-May-2024 18:01                2871
function.trader-sum.php                            30-May-2024 18:01                2741
function.trader-t3.php                             30-May-2024 18:01                3120
function.trader-tan.php                            30-May-2024 18:01                2510
function.trader-tanh.php                           30-May-2024 18:01                2534
function.trader-tema.php                           30-May-2024 18:01                2785
function.trader-trange.php                         30-May-2024 18:01                3042
function.trader-trima.php                          30-May-2024 18:01                2787
function.trader-trix.php                           30-May-2024 18:01                2797
function.trader-tsf.php                            30-May-2024 18:01                2766
function.trader-typprice.php                       30-May-2024 18:01                3065
function.trader-ultosc.php                         30-May-2024 18:01                4377
function.trader-var.php                            30-May-2024 18:01                3073
function.trader-wclprice.php                       30-May-2024 18:01                3070
function.trader-willr.php                          30-May-2024 18:01                3526
function.trader-wma.php                            30-May-2024 18:01                2775
function.trait-exists.php                          30-May-2024 18:01                3201
function.trigger-error.php                         30-May-2024 18:01                8162
function.trim.php                                  30-May-2024 18:01               14076
function.uasort.php                                30-May-2024 18:01               10679
function.ucfirst.php                               30-May-2024 18:01                6308
function.ucwords.php                               30-May-2024 18:01               10068
function.ui-draw-text-font-fontfamilies.php        30-May-2024 18:01                2421
function.ui-quit.php                               30-May-2024 18:01                2093
function.ui-run.php                                30-May-2024 18:01                2465
function.uksort.php                                30-May-2024 18:01               10072
function.umask.php                                 30-May-2024 18:01                5806
function.uniqid.php                                30-May-2024 18:01                8633
function.unixtojd.php                              30-May-2024 18:01                4123
function.unlink.php                                30-May-2024 18:01                6223
function.unpack.php                                30-May-2024 18:01               11020
function.unregister-tick-function.php              30-May-2024 18:01                3214
function.unserialize.php                           30-May-2024 18:01               18340
function.unset.php                                 30-May-2024 18:01               15518
function.untaint.php                               30-May-2024 18:01                2576
function.uopz-add-function.php                     30-May-2024 18:01                7222
function.uopz-allow-exit.php                       30-May-2024 18:01                4700
function.uopz-backup.php                           30-May-2024 18:01                4651
function.uopz-compose.php                          30-May-2024 18:01                6923
function.uopz-copy.php                             30-May-2024 18:01                5238
function.uopz-del-function.php                     30-May-2024 18:01                6658
function.uopz-delete.php                           30-May-2024 18:01                6064
function.uopz-extend.php                           30-May-2024 18:01                5112
function.uopz-flags.php                            30-May-2024 18:01               11038
function.uopz-function.php                         30-May-2024 18:01                7412
function.uopz-get-exit-status.php                  30-May-2024 18:01                4249
function.uopz-get-hook.php                         30-May-2024 18:01                5392
function.uopz-get-mock.php                         30-May-2024 18:01                5018
function.uopz-get-property.php                     30-May-2024 18:01                6255
function.uopz-get-return.php                       30-May-2024 18:01                4507
function.uopz-get-static.php                       30-May-2024 18:01                5218
function.uopz-implement.php                        30-May-2024 18:01                5137
function.uopz-overload.php                         30-May-2024 18:01                4004
function.uopz-redefine.php                         30-May-2024 18:01                5221
function.uopz-rename.php                           30-May-2024 18:01                6868
function.uopz-restore.php                          30-May-2024 18:01                5010
function.uopz-set-hook.php                         30-May-2024 18:01                5741
function.uopz-set-mock.php                         30-May-2024 18:01               10918
function.uopz-set-property.php                     30-May-2024 18:01                7573
function.uopz-set-return.php                       30-May-2024 18:01                9746
function.uopz-set-static.php                       30-May-2024 18:01                5826
function.uopz-undefine.php                         30-May-2024 18:01                4779
function.uopz-unset-hook.php                       30-May-2024 18:01                5632
function.uopz-unset-mock.php                       30-May-2024 18:01                5386
function.uopz-unset-return.php                     30-May-2024 18:01                4983
function.urldecode.php                             30-May-2024 18:01                6397
function.urlencode.php                             30-May-2024 18:01               10142
function.use-soap-error-handler.php                30-May-2024 18:01                4120
function.user-error.php                            30-May-2024 18:01                1749
function.usleep.php                                30-May-2024 18:01                7193
function.usort.php                                 30-May-2024 18:01               27637
function.utf8-decode.php                           30-May-2024 18:01               19181
function.utf8-encode.php                           30-May-2024 18:01               15749
function.var-dump.php                              30-May-2024 18:01                7169
function.var-export.php                            30-May-2024 18:01               16997
function.var-representation.php                    30-May-2024 18:01               13461
function.variant-abs.php                           30-May-2024 18:01                4217
function.variant-add.php                           30-May-2024 18:01                5536
function.variant-and.php                           30-May-2024 18:01                7628
function.variant-cast.php                          30-May-2024 18:01                3570
function.variant-cat.php                           30-May-2024 18:01                4749
function.variant-cmp.php                           30-May-2024 18:01                8041
function.variant-date-from-timestamp.php           30-May-2024 18:01                3712
function.variant-date-to-timestamp.php             30-May-2024 18:01                3835
function.variant-div.php                           30-May-2024 18:01                6447
function.variant-eqv.php                           30-May-2024 18:01                4477
function.variant-fix.php                           30-May-2024 18:01                5544
function.variant-get-type.php                      30-May-2024 18:01                3560
function.variant-idiv.php                          30-May-2024 18:01                5813
function.variant-imp.php                           30-May-2024 18:01                7178
function.variant-int.php                           30-May-2024 18:01                5036
function.variant-mod.php                           30-May-2024 18:01                4816
function.variant-mul.php                           30-May-2024 18:01                5928
function.variant-neg.php                           30-May-2024 18:01                3879
function.variant-not.php                           30-May-2024 18:01                4145
function.variant-or.php                            30-May-2024 18:01                7784
function.variant-pow.php                           30-May-2024 18:01                4653
function.variant-round.php                         30-May-2024 18:01                4554
function.variant-set-type.php                      30-May-2024 18:01                3711
function.variant-set.php                           30-May-2024 18:01                2943
function.variant-sub.php                           30-May-2024 18:01                5498
function.variant-xor.php                           30-May-2024 18:01                6523
function.version-compare.php                       30-May-2024 18:01               11868
function.vfprintf.php                              30-May-2024 18:01               21432
function.virtual.php                               30-May-2024 18:01                5593
function.vprintf.php                               30-May-2024 18:01               20878
function.vsprintf.php                              30-May-2024 18:01               20860
function.wddx-add-vars.php                         30-May-2024 18:01                3936
function.wddx-deserialize.php                      30-May-2024 18:01                3807
function.wddx-packet-end.php                       30-May-2024 18:01                2945
function.wddx-packet-start.php                     30-May-2024 18:01                3126
function.wddx-serialize-value.php                  30-May-2024 18:01                3342
function.wddx-serialize-vars.php                   30-May-2024 18:01                6045
function.win32-continue-service.php                30-May-2024 18:01                6793
function.win32-create-service.php                  30-May-2024 18:01               28885
function.win32-delete-service.php                  30-May-2024 18:01                7253
function.win32-get-last-control-message.php        30-May-2024 18:01                8591
function.win32-pause-service.php                   30-May-2024 18:01                6790
function.win32-query-service-status.php            30-May-2024 18:01                8848
function.win32-send-custom-control.php             30-May-2024 18:01                7454
function.win32-set-service-exit-code.php           30-May-2024 18:01                5912
function.win32-set-service-exit-mode.php           30-May-2024 18:01                6060
function.win32-set-service-status.php              30-May-2024 18:01                9392
function.win32-start-service-ctrl-dispatcher.php   30-May-2024 18:01               11428
function.win32-start-service.php                   30-May-2024 18:01                6794
function.win32-stop-service.php                    30-May-2024 18:01                6715
function.wincache-fcache-fileinfo.php              30-May-2024 18:01                9356
function.wincache-fcache-meminfo.php               30-May-2024 18:01                7182
function.wincache-lock.php                         30-May-2024 18:01                8597
function.wincache-ocache-fileinfo.php              30-May-2024 18:01               10021
function.wincache-ocache-meminfo.php               30-May-2024 18:01                7373
function.wincache-refresh-if-changed.php           30-May-2024 18:01                7899
function.wincache-rplist-fileinfo.php              30-May-2024 18:01                7722
function.wincache-rplist-meminfo.php               30-May-2024 18:01                7297
function.wincache-scache-info.php                  30-May-2024 18:01                9640
function.wincache-scache-meminfo.php               30-May-2024 18:01                6784
function.wincache-ucache-add.php                   30-May-2024 18:01               13671
function.wincache-ucache-cas.php                   30-May-2024 18:01                6579
function.wincache-ucache-clear.php                 30-May-2024 18:01                7680
function.wincache-ucache-dec.php                   30-May-2024 18:01                6502
function.wincache-ucache-delete.php                30-May-2024 18:01               11532
function.wincache-ucache-exists.php                30-May-2024 18:01                6256
function.wincache-ucache-get.php                   30-May-2024 18:01               10674
function.wincache-ucache-inc.php                   30-May-2024 18:01                6494
function.wincache-ucache-info.php                  30-May-2024 18:01               11461
function.wincache-ucache-meminfo.php               30-May-2024 18:01                6973
function.wincache-ucache-set.php                   30-May-2024 18:01               13737
function.wincache-unlock.php                       30-May-2024 18:01                7859
function.wordwrap.php                              30-May-2024 18:01                8234
function.xattr-get.php                             30-May-2024 18:01                6155
function.xattr-list.php                            30-May-2024 18:01                6605
function.xattr-remove.php                          30-May-2024 18:01                6416
function.xattr-set.php                             30-May-2024 18:01                8161
function.xattr-supported.php                       30-May-2024 18:01                5382
function.xdiff-file-bdiff-size.php                 30-May-2024 18:01                4894
function.xdiff-file-bdiff.php                      30-May-2024 18:01                6028
function.xdiff-file-bpatch.php                     30-May-2024 18:01                6585
function.xdiff-file-diff-binary.php                30-May-2024 18:01                6451
function.xdiff-file-diff.php                       30-May-2024 18:01                7465
function.xdiff-file-merge3.php                     30-May-2024 18:01                6855
function.xdiff-file-patch-binary.php               30-May-2024 18:01                6740
function.xdiff-file-patch.php                      30-May-2024 18:01                8964
function.xdiff-file-rabdiff.php                    30-May-2024 18:01                6584
function.xdiff-string-bdiff-size.php               30-May-2024 18:01                5208
function.xdiff-string-bdiff.php                    30-May-2024 18:01                3907
function.xdiff-string-bpatch.php                   30-May-2024 18:01                4005
function.xdiff-string-diff-binary.php              30-May-2024 18:01                4398
function.xdiff-string-diff.php                     30-May-2024 18:01                7688
function.xdiff-string-merge3.php                   30-May-2024 18:01                4854
function.xdiff-string-patch-binary.php             30-May-2024 18:01                4540
function.xdiff-string-patch.php                    30-May-2024 18:01                8329
function.xdiff-string-rabdiff.php                  30-May-2024 18:01                4524
function.xhprof-disable.php                        30-May-2024 18:01                4047
function.xhprof-enable.php                         30-May-2024 18:01                7179
function.xhprof-sample-disable.php                 30-May-2024 18:01                4728
function.xhprof-sample-enable.php                  30-May-2024 18:01                3544
function.xml-error-string.php                      30-May-2024 18:01                3388
function.xml-get-current-byte-index.php            30-May-2024 18:01                4405
function.xml-get-current-column-number.php         30-May-2024 18:01                4245
function.xml-get-current-line-number.php           30-May-2024 18:01                4047
function.xml-get-error-code.php                    30-May-2024 18:01                3704
function.xml-parse-into-struct.php                 30-May-2024 18:01               19409
function.xml-parse.php                             30-May-2024 18:01                8255
function.xml-parser-create-ns.php                  30-May-2024 18:01                5502
function.xml-parser-create.php                     30-May-2024 18:01                5054
function.xml-parser-free.php                       30-May-2024 18:01                4111
function.xml-parser-get-option.php                 30-May-2024 18:01                5947
function.xml-parser-set-option.php                 30-May-2024 18:01                7906
function.xml-set-character-data-handler.php        30-May-2024 18:01                5738
function.xml-set-default-handler.php               30-May-2024 18:01                5645
function.xml-set-element-handler.php               30-May-2024 18:01                9163
function.xml-set-end-namespace-decl-handler.php    30-May-2024 18:01                6572
function.xml-set-external-entity-ref-handler.php   30-May-2024 18:01                8605
function.xml-set-notation-decl-handler.php         30-May-2024 18:01                7835
function.xml-set-object.php                        30-May-2024 18:01                9232
function.xml-set-processing-instruction-handler..> 30-May-2024 18:01                6760
function.xml-set-start-namespace-decl-handler.php  30-May-2024 18:01                6908
function.xml-set-unparsed-entity-decl-handler.php  30-May-2024 18:01                8673
function.xmlrpc-decode-request.php                 30-May-2024 18:01                2868
function.xmlrpc-decode.php                         30-May-2024 18:01                4147
function.xmlrpc-encode-request.php                 30-May-2024 18:01                8571
function.xmlrpc-encode.php                         30-May-2024 18:01                2447
function.xmlrpc-get-type.php                       30-May-2024 18:01                6352
function.xmlrpc-is-fault.php                       30-May-2024 18:01                3952
function.xmlrpc-parse-method-descriptions.php      30-May-2024 18:01                2644
function.xmlrpc-server-add-introspection-data.php  30-May-2024 18:01                2842
function.xmlrpc-server-call-method.php             30-May-2024 18:01                3250
function.xmlrpc-server-create.php                  30-May-2024 18:01                2364
function.xmlrpc-server-destroy.php                 30-May-2024 18:01                2572
function.xmlrpc-server-register-introspection-c..> 30-May-2024 18:01                2926
function.xmlrpc-server-register-method.php         30-May-2024 18:01                3003
function.xmlrpc-set-type.php                       30-May-2024 18:01                5565
function.yaml-emit-file.php                        30-May-2024 18:01                6777
function.yaml-emit.php                             30-May-2024 18:01               12377
function.yaml-parse-file.php                       30-May-2024 18:01                6128
function.yaml-parse-url.php                        30-May-2024 18:01                6453
function.yaml-parse.php                            30-May-2024 18:01                9996
function.yaz-addinfo.php                           30-May-2024 18:01                3440
function.yaz-ccl-conf.php                          30-May-2024 18:01                5744
function.yaz-ccl-parse.php                         30-May-2024 18:01                6811
function.yaz-close.php                             30-May-2024 18:01                3613
function.yaz-connect.php                           30-May-2024 18:01                9160
function.yaz-database.php                          30-May-2024 18:01                3496
function.yaz-element.php                           30-May-2024 18:01                3931
function.yaz-errno.php                             30-May-2024 18:01                3674
function.yaz-error.php                             30-May-2024 18:01                3429
function.yaz-es-result.php                         30-May-2024 18:01                3347
function.yaz-es.php                                30-May-2024 18:01                7205
function.yaz-get-option.php                        30-May-2024 18:01                3424
function.yaz-hits.php                              30-May-2024 18:01                4916
function.yaz-itemorder.php                         30-May-2024 18:01                7108
function.yaz-present.php                           30-May-2024 18:01                3072
function.yaz-range.php                             30-May-2024 18:01                3669
function.yaz-record.php                            30-May-2024 18:01               14270
function.yaz-scan-result.php                       30-May-2024 18:01                4061
function.yaz-scan.php                              30-May-2024 18:01                9406
function.yaz-schema.php                            30-May-2024 18:01                3505
function.yaz-search.php                            30-May-2024 18:01                8761
function.yaz-set-option.php                        30-May-2024 18:01                7068
function.yaz-sort.php                              30-May-2024 18:01                5630
function.yaz-syntax.php                            30-May-2024 18:01                3463
function.yaz-wait.php                              30-May-2024 18:01                4222
function.zend-thread-id.php                        30-May-2024 18:01                3847
function.zend-version.php                          30-May-2024 18:01                3987                             30-May-2024 18:01                4031                       30-May-2024 18:01                4316              30-May-2024 18:01                4586           30-May-2024 18:01                4680                    30-May-2024 18:01                4510                        30-May-2024 18:01                4423                        30-May-2024 18:01                6064                        30-May-2024 18:01                5280                              30-May-2024 18:01                4603                              30-May-2024 18:01                4891
function.zlib-decode.php                           30-May-2024 18:01                3540
function.zlib-encode.php                           30-May-2024 18:01                5476
function.zlib-get-coding-type.php                  30-May-2024 18:01                2946
function.zookeeper-dispatch.php                    30-May-2024 18:01                8368
functional.parallel.php                            30-May-2024 18:01                2612
functions.anonymous.php                            30-May-2024 18:01               24591
functions.arguments.php                            30-May-2024 18:01               44053
functions.arrow.php                                30-May-2024 18:01               10385
functions.first_class_callable_syntax.php          30-May-2024 18:01               11609
functions.internal.php                             30-May-2024 18:01                8109
functions.returning-values.php                     30-May-2024 18:01                6392
functions.user-defined.php                         30-May-2024 18:01                9710
functions.variable-functions.php                   30-May-2024 18:01               11598
gearman.configuration.php                          30-May-2024 18:01                1298
gearman.constants.php                              30-May-2024 18:01               23904
gearman.examples-reverse-bg.php                    30-May-2024 18:01               10731
gearman.examples-reverse-task.php                  30-May-2024 18:01               17380
gearman.examples-reverse.php                       30-May-2024 18:01               12807
gearman.examples.php                               30-May-2024 18:01                1636
gearman.installation.php                           30-May-2024 18:01                1600
gearman.requirements.php                           30-May-2024 18:01                1541
gearman.resources.php                              30-May-2024 18:01                1271
gearman.setup.php                                  30-May-2024 18:01                1652
gearmanclient.addoptions.php                       30-May-2024 18:01                3376
gearmanclient.addserver.php                        30-May-2024 18:01                5519
gearmanclient.addservers.php                       30-May-2024 18:01                4964
gearmanclient.addtask.php                          30-May-2024 18:01               15241
gearmanclient.addtaskbackground.php                30-May-2024 18:01               20982
gearmanclient.addtaskhigh.php                      30-May-2024 18:01               11738
gearmanclient.addtaskhighbackground.php            30-May-2024 18:01                6640
gearmanclient.addtasklow.php                       30-May-2024 18:01               11720
gearmanclient.addtasklowbackground.php             30-May-2024 18:01                6633
gearmanclient.addtaskstatus.php                    30-May-2024 18:01                9862
gearmanclient.clearcallbacks.php                   30-May-2024 18:01                4391
gearmanclient.clone.php                            30-May-2024 18:01                2690
gearmanclient.construct.php                        30-May-2024 18:01                2865
gearmanclient.context.php                          30-May-2024 18:01                2933                             30-May-2024 18:01                3201                               30-May-2024 18:01               22248
gearmanclient.dobackground.php                     30-May-2024 18:01                9727
gearmanclient.dohigh.php                           30-May-2024 18:01                5172
gearmanclient.dohighbackground.php                 30-May-2024 18:01                4999
gearmanclient.dojobhandle.php                      30-May-2024 18:01                2990
gearmanclient.dolow.php                            30-May-2024 18:01                5158
gearmanclient.dolowbackground.php                  30-May-2024 18:01                4981
gearmanclient.donormal.php                         30-May-2024 18:01               22816
gearmanclient.dostatus.php                         30-May-2024 18:01                8180
gearmanclient.echo.php                             30-May-2024 18:01                3039
gearmanclient.error.php                            30-May-2024 18:01                2925
gearmanclient.geterrno.php                         30-May-2024 18:01                2700
gearmanclient.jobstatus.php                        30-May-2024 18:01                8363                             30-May-2024 18:01                3012
gearmanclient.removeoptions.php                    30-May-2024 18:01                2724
gearmanclient.returncode.php                       30-May-2024 18:01                2346
gearmanclient.runtasks.php                         30-May-2024 18:01                3767
gearmanclient.setclientcallback.php                30-May-2024 18:01                5415
gearmanclient.setcompletecallback.php              30-May-2024 18:01                5298
gearmanclient.setcontext.php                       30-May-2024 18:01                3266
gearmanclient.setcreatedcallback.php               30-May-2024 18:01                4837
gearmanclient.setdata.php                          30-May-2024 18:01                3467
gearmanclient.setdatacallback.php                  30-May-2024 18:01                4822
gearmanclient.setexceptioncallback.php             30-May-2024 18:01                4742
gearmanclient.setfailcallback.php                  30-May-2024 18:01                4828
gearmanclient.setoptions.php                       30-May-2024 18:01                2710
gearmanclient.setstatuscallback.php                30-May-2024 18:01                4828
gearmanclient.settimeout.php                       30-May-2024 18:01                2754
gearmanclient.setwarningcallback.php               30-May-2024 18:01                4831
gearmanclient.setworkloadcallback.php              30-May-2024 18:01                4985
gearmanclient.timeout.php                          30-May-2024 18:01                2795
gearmanclient.wait.php                             30-May-2024 18:01                2842
gearmanjob.complete.php                            30-May-2024 18:01                3638
gearmanjob.construct.php                           30-May-2024 18:01                2380                                30-May-2024 18:01                3598
gearmanjob.exception.php                           30-May-2024 18:01                3805                                30-May-2024 18:01                3731
gearmanjob.functionname.php                        30-May-2024 18:01                2971
gearmanjob.handle.php                              30-May-2024 18:01                2858
gearmanjob.returncode.php                          30-May-2024 18:01                2655
gearmanjob.sendcomplete.php                        30-May-2024 18:01                3356
gearmanjob.senddata.php                            30-May-2024 18:01                3323
gearmanjob.sendexception.php                       30-May-2024 18:01                3536
gearmanjob.sendfail.php                            30-May-2024 18:01                3447
gearmanjob.sendstatus.php                          30-May-2024 18:01                4051
gearmanjob.sendwarning.php                         30-May-2024 18:01                3532
gearmanjob.setreturn.php                           30-May-2024 18:01                2596
gearmanjob.status.php                              30-May-2024 18:01                4335
gearmanjob.unique.php                              30-May-2024 18:01                3095
gearmanjob.warning.php                             30-May-2024 18:01                3816
gearmanjob.workload.php                            30-May-2024 18:01                2853
gearmanjob.workloadsize.php                        30-May-2024 18:01                2671
gearmantask.construct.php                          30-May-2024 18:01                2405
gearmantask.create.php                             30-May-2024 18:01                2855                               30-May-2024 18:01                2832
gearmantask.datasize.php                           30-May-2024 18:01                2855
gearmantask.function.php                           30-May-2024 18:01                2693
gearmantask.functionname.php                       30-May-2024 18:01                2627
gearmantask.isknown.php                            30-May-2024 18:01                2503
gearmantask.isrunning.php                          30-May-2024 18:01                2503
gearmantask.jobhandle.php                          30-May-2024 18:01                3004
gearmantask.recvdata.php                           30-May-2024 18:01                3554
gearmantask.returncode.php                         30-May-2024 18:01                2682
gearmantask.senddata.php                           30-May-2024 18:01                3367
gearmantask.sendworkload.php                       30-May-2024 18:01                3516
gearmantask.taskdenominator.php                    30-May-2024 18:01                3048
gearmantask.tasknumerator.php                      30-May-2024 18:01                3020
gearmantask.unique.php                             30-May-2024 18:01                3265
gearmantask.uuid.php                               30-May-2024 18:01                3441
gearmanworker.addfunction.php                      30-May-2024 18:01                7950
gearmanworker.addoptions.php                       30-May-2024 18:01                3428
gearmanworker.addserver.php                        30-May-2024 18:01                5246
gearmanworker.addservers.php                       30-May-2024 18:01                4686
gearmanworker.clone.php                            30-May-2024 18:01                2361
gearmanworker.construct.php                        30-May-2024 18:01                2838
gearmanworker.echo.php                             30-May-2024 18:01                3060
gearmanworker.error.php                            30-May-2024 18:01                2892
gearmanworker.geterrno.php                         30-May-2024 18:01                2667
gearmanworker.options.php                          30-May-2024 18:01                2674
gearmanworker.register.php                         30-May-2024 18:01                3817
gearmanworker.removeoptions.php                    30-May-2024 18:01                3450
gearmanworker.returncode.php                       30-May-2024 18:01                2862
gearmanworker.setid.php                            30-May-2024 18:01                4151
gearmanworker.setoptions.php                       30-May-2024 18:01                3583
gearmanworker.settimeout.php                       30-May-2024 18:01                7832
gearmanworker.timeout.php                          30-May-2024 18:01                2774
gearmanworker.unregister.php                       30-May-2024 18:01                3381
gearmanworker.unregisterall.php                    30-May-2024 18:01                3038
gearmanworker.wait.php                             30-May-2024 18:01                7928                             30-May-2024 18:01                5630
gender-gender.connect.php                          30-May-2024 18:01                2594
gender-gender.construct.php                        30-May-2024 18:01                2448                          30-May-2024 18:01                3879
gender-gender.get.php                              30-May-2024 18:01                2910
gender-gender.isnick.php                           30-May-2024 18:01                3530
gender-gender.similarnames.php                     30-May-2024 18:01                3023
gender.example.admin.php                           30-May-2024 18:01                8130
gender.examples.php                                30-May-2024 18:01                1399
gender.installation.php                            30-May-2024 18:01                2008
gender.setup.php                                   30-May-2024 18:01                1432
generator.current.php                              30-May-2024 18:01                2177
generator.getreturn.php                            30-May-2024 18:01                3920
generator.key.php                                  30-May-2024 18:01                4006                                 30-May-2024 18:01                2514
generator.rewind.php                               30-May-2024 18:01                2252
generator.send.php                                 30-May-2024 18:01                5689
generator.throw.php                                30-May-2024 18:01                5221
generator.valid.php                                30-May-2024 18:01                2369
generator.wakeup.php                               30-May-2024 18:01                2250
geoip.configuration.php                            30-May-2024 18:01                2505
geoip.constants.php                                30-May-2024 18:01                6354
geoip.installation.php                             30-May-2024 18:01                1730
geoip.requirements.php                             30-May-2024 18:01                1744
geoip.resources.php                                30-May-2024 18:01                1227
geoip.setup.php                                    30-May-2024 18:01                1613
gettext.configuration.php                          30-May-2024 18:01                1298
gettext.constants.php                              30-May-2024 18:01                1214
gettext.installation.php                           30-May-2024 18:01                1503
gettext.requirements.php                           30-May-2024 18:01                1443
gettext.resources.php                              30-May-2024 18:01                1241
gettext.setup.php                                  30-May-2024 18:01                1657
getting-started.php                                30-May-2024 18:01                1964
globiterator.construct.php                         30-May-2024 18:01                7754
globiterator.count.php                             30-May-2024 18:01                4513
gmagick.addimage.php                               30-May-2024 18:01                2897
gmagick.addnoiseimage.php                          30-May-2024 18:01                2952
gmagick.annotateimage.php                          30-May-2024 18:01                4487
gmagick.blurimage.php                              30-May-2024 18:01                3348
gmagick.borderimage.php                            30-May-2024 18:01                3797
gmagick.charcoalimage.php                          30-May-2024 18:01                3298
gmagick.chopimage.php                              30-May-2024 18:01                3950
gmagick.clear.php                                  30-May-2024 18:01                2646
gmagick.commentimage.php                           30-May-2024 18:01                2899
gmagick.compositeimage.php                         30-May-2024 18:01                4113
gmagick.configuration.php                          30-May-2024 18:01                1307
gmagick.constants.php                              30-May-2024 18:01              103214
gmagick.construct.php                              30-May-2024 18:01                2656
gmagick.cropimage.php                              30-May-2024 18:01                4085
gmagick.cropthumbnailimage.php                     30-May-2024 18:01                3335
gmagick.current.php                                30-May-2024 18:01                2547
gmagick.cyclecolormapimage.php                     30-May-2024 18:01                3025
gmagick.deconstructimages.php                      30-May-2024 18:01                2795
gmagick.despeckleimage.php                         30-May-2024 18:01                3500
gmagick.destroy.php                                30-May-2024 18:01                2794
gmagick.drawimage.php                              30-May-2024 18:01                3021
gmagick.edgeimage.php                              30-May-2024 18:01                2968
gmagick.embossimage.php                            30-May-2024 18:01                3476
gmagick.enhanceimage.php                           30-May-2024 18:01                2657
gmagick.equalizeimage.php                          30-May-2024 18:01                2616
gmagick.examples.php                               30-May-2024 18:01                3446
gmagick.flipimage.php                              30-May-2024 18:01                2952
gmagick.flopimage.php                              30-May-2024 18:01                2949
gmagick.frameimage.php                             30-May-2024 18:01                4622
gmagick.gammaimage.php                             30-May-2024 18:01                3179
gmagick.getcopyright.php                           30-May-2024 18:01                2638
gmagick.getfilename.php                            30-May-2024 18:01                2588
gmagick.getimagebackgroundcolor.php                30-May-2024 18:01                2725
gmagick.getimageblueprimary.php                    30-May-2024 18:01                3027
gmagick.getimagebordercolor.php                    30-May-2024 18:01                2769
gmagick.getimagechanneldepth.php                   30-May-2024 18:01                2830
gmagick.getimagecolors.php                         30-May-2024 18:01                2624
gmagick.getimagecolorspace.php                     30-May-2024 18:01                2582
gmagick.getimagecompose.php                        30-May-2024 18:01                2662
gmagick.getimagedelay.php                          30-May-2024 18:01                2559
gmagick.getimagedepth.php                          30-May-2024 18:01                2529
gmagick.getimagedispose.php                        30-May-2024 18:01                2583
gmagick.getimageextrema.php                        30-May-2024 18:01                2798
gmagick.getimagefilename.php                       30-May-2024 18:01                2667
gmagick.getimageformat.php                         30-May-2024 18:01                2650
gmagick.getimagegamma.php                          30-May-2024 18:01                2550
gmagick.getimagegreenprimary.php                   30-May-2024 18:01                2769
gmagick.getimageheight.php                         30-May-2024 18:01                2581
gmagick.getimagehistogram.php                      30-May-2024 18:01                2942
gmagick.getimageindex.php                          30-May-2024 18:01                2712
gmagick.getimageinterlacescheme.php                30-May-2024 18:01                2700
gmagick.getimageiterations.php                     30-May-2024 18:01                2627
gmagick.getimagematte.php                          30-May-2024 18:01                2967
gmagick.getimagemattecolor.php                     30-May-2024 18:01                2675
gmagick.getimageprofile.php                        30-May-2024 18:01                2782
gmagick.getimageredprimary.php                     30-May-2024 18:01                2790
gmagick.getimagerenderingintent.php                30-May-2024 18:01                2711
gmagick.getimageresolution.php                     30-May-2024 18:01                2643
gmagick.getimagescene.php                          30-May-2024 18:01                2546
gmagick.getimagesignature.php                      30-May-2024 18:01                2661
gmagick.getimagetype.php                           30-May-2024 18:01                2553
gmagick.getimageunits.php                          30-May-2024 18:01                2311
gmagick.getimagewhitepoint.php                     30-May-2024 18:01                2766
gmagick.getimagewidth.php                          30-May-2024 18:01                2560
gmagick.getpackagename.php                         30-May-2024 18:01                2614
gmagick.getquantumdepth.php                        30-May-2024 18:01                2791
gmagick.getreleasedate.php                         30-May-2024 18:01                2648
gmagick.getsamplingfactors.php                     30-May-2024 18:01                2701
gmagick.getsize.php                                30-May-2024 18:01                2850
gmagick.getversion.php                             30-May-2024 18:01                2591
gmagick.hasnextimage.php                           30-May-2024 18:01                2948
gmagick.haspreviousimage.php                       30-May-2024 18:01                2992
gmagick.implodeimage.php                           30-May-2024 18:01                3008
gmagick.installation.php                           30-May-2024 18:01                1958
gmagick.labelimage.php                             30-May-2024 18:01                2777
gmagick.levelimage.php                             30-May-2024 18:01                4728
gmagick.magnifyimage.php                           30-May-2024 18:01                2642
gmagick.mapimage.php                               30-May-2024 18:01                3313
gmagick.medianfilterimage.php                      30-May-2024 18:01                3097
gmagick.minifyimage.php                            30-May-2024 18:01                2676
gmagick.modulateimage.php                          30-May-2024 18:01                3926
gmagick.motionblurimage.php                        30-May-2024 18:01                3951
gmagick.newimage.php                               30-May-2024 18:01                3973
gmagick.nextimage.php                              30-May-2024 18:01                2815
gmagick.normalizeimage.php                         30-May-2024 18:01                3053
gmagick.oilpaintimage.php                          30-May-2024 18:01                3069
gmagick.previousimage.php                          30-May-2024 18:01                2810
gmagick.profileimage.php                           30-May-2024 18:01                3627
gmagick.quantizeimage.php                          30-May-2024 18:01                5396
gmagick.quantizeimages.php                         30-May-2024 18:01                5399
gmagick.queryfontmetrics.php                       30-May-2024 18:01                2969
gmagick.queryfonts.php                             30-May-2024 18:01                2745
gmagick.queryformats.php                           30-May-2024 18:01                3147
gmagick.radialblurimage.php                        30-May-2024 18:01                3273
gmagick.raiseimage.php                             30-May-2024 18:01                4464                                   30-May-2024 18:01                2792
gmagick.readimage.php                              30-May-2024 18:01                2842
gmagick.readimageblob.php                          30-May-2024 18:01                3265
gmagick.readimagefile.php                          30-May-2024 18:01                3142
gmagick.reducenoiseimage.php                       30-May-2024 18:01                3247
gmagick.removeimage.php                            30-May-2024 18:01                2624
gmagick.removeimageprofile.php                     30-May-2024 18:01                2954
gmagick.requirements.php                           30-May-2024 18:01                1704
gmagick.resampleimage.php                          30-May-2024 18:01                3976
gmagick.resizeimage.php                            30-May-2024 18:01                4313
gmagick.rollimage.php                              30-May-2024 18:01                3052
gmagick.rotateimage.php                            30-May-2024 18:01                3227
gmagick.scaleimage.php                             30-May-2024 18:01                3595
gmagick.separateimagechannel.php                   30-May-2024 18:01                3239
gmagick.setcompressionquality.php                  30-May-2024 18:01                4248
gmagick.setfilename.php                            30-May-2024 18:01                2972
gmagick.setimagebackgroundcolor.php                30-May-2024 18:01                3041
gmagick.setimageblueprimary.php                    30-May-2024 18:01                3335
gmagick.setimagebordercolor.php                    30-May-2024 18:01                3003
gmagick.setimagechanneldepth.php                   30-May-2024 18:01                3482
gmagick.setimagecolorspace.php                     30-May-2024 18:01                3124
gmagick.setimagecompose.php                        30-May-2024 18:01                2890
gmagick.setimagedelay.php                          30-May-2024 18:01                2904
gmagick.setimagedepth.php                          30-May-2024 18:01                2902
gmagick.setimagedispose.php                        30-May-2024 18:01                2946
gmagick.setimagefilename.php                       30-May-2024 18:01                2996
gmagick.setimageformat.php                         30-May-2024 18:01                2959
gmagick.setimagegamma.php                          30-May-2024 18:01                2896
gmagick.setimagegreenprimary.php                   30-May-2024 18:01                3343
gmagick.setimageindex.php                          30-May-2024 18:01                3043
gmagick.setimageinterlacescheme.php                30-May-2024 18:01                3190
gmagick.setimageiterations.php                     30-May-2024 18:01                2999
gmagick.setimageprofile.php                        30-May-2024 18:01                3432
gmagick.setimageredprimary.php                     30-May-2024 18:01                3246
gmagick.setimagerenderingintent.php                30-May-2024 18:01                3221
gmagick.setimageresolution.php                     30-May-2024 18:01                3240
gmagick.setimagescene.php                          30-May-2024 18:01                2892
gmagick.setimagetype.php                           30-May-2024 18:01                3017
gmagick.setimageunits.php                          30-May-2024 18:01                3076
gmagick.setimagewhitepoint.php                     30-May-2024 18:01                3272
gmagick.setsamplingfactors.php                     30-May-2024 18:01                3118
gmagick.setsize.php                                30-May-2024 18:01                3588
gmagick.setup.php                                  30-May-2024 18:01                1579
gmagick.shearimage.php                             30-May-2024 18:01                3970
gmagick.solarizeimage.php                          30-May-2024 18:01                3150
gmagick.spreadimage.php                            30-May-2024 18:01                2994
gmagick.stripimage.php                             30-May-2024 18:01                2604
gmagick.swirlimage.php                             30-May-2024 18:01                3075
gmagick.thumbnailimage.php                         30-May-2024 18:01                3906
gmagick.trimimage.php                              30-May-2024 18:01                3139
gmagick.write.php                                  30-May-2024 18:01                1758
gmagick.writeimage.php                             30-May-2024 18:01                3551
gmagickdraw.annotate.php                           30-May-2024 18:01                3224
gmagickdraw.arc.php                                30-May-2024 18:01                4384
gmagickdraw.bezier.php                             30-May-2024 18:01                2663
gmagickdraw.ellipse.php                            30-May-2024 18:01                4305
gmagickdraw.getfillcolor.php                       30-May-2024 18:01                2481
gmagickdraw.getfillopacity.php                     30-May-2024 18:01                2432
gmagickdraw.getfont.php                            30-May-2024 18:01                2423
gmagickdraw.getfontsize.php                        30-May-2024 18:01                2474
gmagickdraw.getfontstyle.php                       30-May-2024 18:01                2550
gmagickdraw.getfontweight.php                      30-May-2024 18:01                2395
gmagickdraw.getstrokecolor.php                     30-May-2024 18:01                2536
gmagickdraw.getstrokeopacity.php                   30-May-2024 18:01                2509
gmagickdraw.getstrokewidth.php                     30-May-2024 18:01                2528
gmagickdraw.gettextdecoration.php                  30-May-2024 18:01                2462
gmagickdraw.gettextencoding.php                    30-May-2024 18:01                2551
gmagickdraw.line.php                               30-May-2024 18:01                3668
gmagickdraw.point.php                              30-May-2024 18:01                2955
gmagickdraw.polygon.php                            30-May-2024 18:01                2730
gmagickdraw.polyline.php                           30-May-2024 18:01                2765
gmagickdraw.rectangle.php                          30-May-2024 18:01                3772
gmagickdraw.rotate.php                             30-May-2024 18:01                2721
gmagickdraw.roundrectangle.php                     30-May-2024 18:01                4549
gmagickdraw.scale.php                              30-May-2024 18:01                3019
gmagickdraw.setfillcolor.php                       30-May-2024 18:01                2981
gmagickdraw.setfillopacity.php                     30-May-2024 18:01                2819
gmagickdraw.setfont.php                            30-May-2024 18:01                2719
gmagickdraw.setfontsize.php                        30-May-2024 18:01                2749
gmagickdraw.setfontstyle.php                       30-May-2024 18:01                2880
gmagickdraw.setfontweight.php                      30-May-2024 18:01                2751
gmagickdraw.setstrokecolor.php                     30-May-2024 18:01                3005
gmagickdraw.setstrokeopacity.php                   30-May-2024 18:01                2837
gmagickdraw.setstrokewidth.php                     30-May-2024 18:01                2797
gmagickdraw.settextdecoration.php                  30-May-2024 18:01                2883
gmagickdraw.settextencoding.php                    30-May-2024 18:01                3091
gmagickpixel.construct.php                         30-May-2024 18:01                2603
gmagickpixel.getcolor.php                          30-May-2024 18:01                4457
gmagickpixel.getcolorcount.php                     30-May-2024 18:01                2523
gmagickpixel.getcolorvalue.php                     30-May-2024 18:01                2927
gmagickpixel.setcolor.php                          30-May-2024 18:01                3058
gmagickpixel.setcolorvalue.php                     30-May-2024 18:01                3337
gmp.configuration.php                              30-May-2024 18:01                1279
gmp.constants.php                                  30-May-2024 18:01                4542
gmp.construct.php                                  30-May-2024 18:01                3775
gmp.examples.php                                   30-May-2024 18:01                3111
gmp.installation.php                               30-May-2024 18:01                1371
gmp.requirements.php                               30-May-2024 18:01                1835
gmp.serialize.php                                  30-May-2024 18:01                2321
gmp.setup.php                                      30-May-2024 18:01                1543
gmp.unserialize.php                                30-May-2024 18:01                2629
gnupg.configuration.php                            30-May-2024 18:01                1282
gnupg.constants.php                                30-May-2024 18:01                9436
gnupg.examples-clearsign.php                       30-May-2024 18:01                6394
gnupg.examples.php                                 30-May-2024 18:01                1476
gnupg.installation.php                             30-May-2024 18:01                1581
gnupg.requirements.php                             30-May-2024 18:01                1313
gnupg.resources.php                                30-May-2024 18:01                1227
gnupg.setup.php                                    30-May-2024 18:01                1633
hash.configuration.php                             30-May-2024 18:01                1277
hash.constants.php                                 30-May-2024 18:01                1891
hash.installation.php                              30-May-2024 18:01                1704
hash.requirements.php                              30-May-2024 18:01                1258
hash.resources.php                                 30-May-2024 18:01                1370
hash.setup.php                                     30-May-2024 18:01                1612
hashcontext.construct.php                          30-May-2024 18:01                1951
hashcontext.serialize.php                          30-May-2024 18:01                2450
hashcontext.unserialize.php                        30-May-2024 18:01                2756
history.php                                        30-May-2024 18:01                2141
history.php.books.php                              30-May-2024 18:01                2743
history.php.php                                    30-May-2024 18:01               11094
history.php.publications.php                       30-May-2024 18:01                1930
history.php.related.php                            30-May-2024 18:01                6463
hrtime-performancecounter.getfrequency.php         30-May-2024 18:01                2753
hrtime-performancecounter.getticks.php             30-May-2024 18:01                2630
hrtime-performancecounter.gettickssince.php        30-May-2024 18:01                2934
hrtime-stopwatch.getelapsedticks.php               30-May-2024 18:01                2528
hrtime-stopwatch.getelapsedtime.php                30-May-2024 18:01                2923
hrtime-stopwatch.getlastelapsedticks.php           30-May-2024 18:01                2600
hrtime-stopwatch.getlastelapsedtime.php            30-May-2024 18:01                2947
hrtime-stopwatch.isrunning.php                     30-May-2024 18:01                2491
hrtime-stopwatch.start.php                         30-May-2024 18:01                2420
hrtime-stopwatch.stop.php                          30-May-2024 18:01                2295
hrtime.example.basic.php                           30-May-2024 18:01                5482
hrtime.examples.php                                30-May-2024 18:01                1403
hrtime.installation.php                            30-May-2024 18:01                1989
hrtime.setup.php                                   30-May-2024 18:01                1429
ibase.configuration.php                            30-May-2024 18:01                8020
ibase.constants.php                                30-May-2024 18:01               21399
ibase.installation.php                             30-May-2024 18:01                3305
ibase.requirements.php                             30-May-2024 18:01                1244
ibase.resources.php                                30-May-2024 18:01                1227
ibase.setup.php                                    30-May-2024 18:01                1649
ibm-db2.configuration.php                          30-May-2024 18:01               20846
ibm-db2.constants.php                              30-May-2024 18:01                9142
ibm-db2.installation.php                           30-May-2024 18:01                3537
ibm-db2.requirements.php                           30-May-2024 18:01                3247
ibm-db2.resources.php                              30-May-2024 18:01                1299
ibm-db2.setup.php                                  30-May-2024 18:01                1661
iconv.configuration.php                            30-May-2024 18:01                4817
iconv.constants.php                                30-May-2024 18:01                3712
iconv.installation.php                             30-May-2024 18:01                1578
iconv.requirements.php                             30-May-2024 18:01                1524
iconv.resources.php                                30-May-2024 18:01                1227
iconv.setup.php                                    30-May-2024 18:01                1637
igbinary.configuration.php                         30-May-2024 18:01                3499
igbinary.installation.php                          30-May-2024 18:01                1988
igbinary.requirements.php                          30-May-2024 18:01                1265
igbinary.setup.php                                 30-May-2024 18:01                1586
image.configuration.php                            30-May-2024 18:01                3478
image.constants.php                                30-May-2024 18:01               55525
image.examples-png.php                             30-May-2024 18:01                4915
image.examples-watermark.php                       30-May-2024 18:01                5849
image.examples.merged-watermark.php                30-May-2024 18:01                8606
image.examples.php                                 30-May-2024 18:01                1652
image.installation.php                             30-May-2024 18:01                5994
image.requirements.php                             30-May-2024 18:01                4653
image.resources.php                                30-May-2024 18:01                2149
image.setup.php                                    30-May-2024 18:01                1634
imagick.adaptiveblurimage.php                      30-May-2024 18:01                7057
imagick.adaptiveresizeimage.php                    30-May-2024 18:01                9194
imagick.adaptivesharpenimage.php                   30-May-2024 18:01                6566
imagick.adaptivethresholdimage.php                 30-May-2024 18:01                6265
imagick.addimage.php                               30-May-2024 18:01                2941
imagick.addnoiseimage.php                          30-May-2024 18:01                5682
imagick.affinetransformimage.php                   30-May-2024 18:01                6661
imagick.animateimages.php                          30-May-2024 18:01                3210
imagick.annotateimage.php                          30-May-2024 18:01                8700
imagick.appendimages.php                           30-May-2024 18:01                6734
imagick.autolevelimage.php                         30-May-2024 18:01                4492
imagick.averageimages.php                          30-May-2024 18:01                2751
imagick.blackthresholdimage.php                    30-May-2024 18:01                5323
imagick.blueshiftimage.php                         30-May-2024 18:01                4537
imagick.blurimage.php                              30-May-2024 18:01                5781
imagick.borderimage.php                            30-May-2024 18:01                6073
imagick.brightnesscontrastimage.php                30-May-2024 18:01                5697
imagick.charcoalimage.php                          30-May-2024 18:01                5030
imagick.chopimage.php                              30-May-2024 18:01                7036
imagick.clampimage.php                             30-May-2024 18:01                2775
imagick.clear.php                                  30-May-2024 18:01                2304
imagick.clipimage.php                              30-May-2024 18:01                2541
imagick.clipimagepath.php                          30-May-2024 18:01                3195
imagick.clippathimage.php                          30-May-2024 18:01                3543
imagick.clone.php                                  30-May-2024 18:01                4169
imagick.clutimage.php                              30-May-2024 18:01                6072
imagick.coalesceimages.php                         30-May-2024 18:01                2841
imagick.colorfloodfillimage.php                    30-May-2024 18:01                5461
imagick.colorizeimage.php                          30-May-2024 18:01                6893
imagick.colormatriximage.php                       30-May-2024 18:01                7660
imagick.combineimages.php                          30-May-2024 18:01                3385
imagick.commentimage.php                           30-May-2024 18:01                4999
imagick.compareimagechannels.php                   30-May-2024 18:01                3980
imagick.compareimagelayers.php                     30-May-2024 18:01                5508
imagick.compareimages.php                          30-May-2024 18:01                5677
imagick.compositeimage.php                         30-May-2024 18:01                8038
imagick.configuration.php                          30-May-2024 18:01                4486
imagick.constants.php                              30-May-2024 18:01              161678
imagick.construct.php                              30-May-2024 18:01                2617
imagick.contrastimage.php                          30-May-2024 18:01                5060
imagick.contraststretchimage.php                   30-May-2024 18:01                4000
imagick.convolveimage.php                          30-May-2024 18:01                5976
imagick.count.php                                  30-May-2024 18:01                2748
imagick.cropimage.php                              30-May-2024 18:01                6177
imagick.cropthumbnailimage.php                     30-May-2024 18:01                3555
imagick.current.php                                30-May-2024 18:01                2502
imagick.cyclecolormapimage.php                     30-May-2024 18:01                3024
imagick.decipherimage.php                          30-May-2024 18:01                3302
imagick.deconstructimages.php                      30-May-2024 18:01                2657
imagick.deleteimageartifact.php                    30-May-2024 18:01                3700
imagick.deleteimageproperty.php                    30-May-2024 18:01                2682
imagick.deskewimage.php                            30-May-2024 18:01               11070
imagick.despeckleimage.php                         30-May-2024 18:01                4286
imagick.destroy.php                                30-May-2024 18:01                2442
imagick.displayimage.php                           30-May-2024 18:01                2825
imagick.displayimages.php                          30-May-2024 18:01                2869
imagick.distortimage.php                           30-May-2024 18:01               11898
imagick.drawimage.php                              30-May-2024 18:01                2670
imagick.edgeimage.php                              30-May-2024 18:01                4698
imagick.embossimage.php                            30-May-2024 18:01                5395
imagick.encipherimage.php                          30-May-2024 18:01                3298
imagick.enhanceimage.php                           30-May-2024 18:01                4253
imagick.equalizeimage.php                          30-May-2024 18:01                4220
imagick.evaluateimage.php                          30-May-2024 18:01                5952
imagick.examples-1.php                             30-May-2024 18:01               29962
imagick.examples.php                               30-May-2024 18:01                1420
imagick.exportimagepixels.php                      30-May-2024 18:01                7997
imagick.extentimage.php                            30-May-2024 18:01                5298
imagick.filter.php                                 30-May-2024 18:01                7700
imagick.flattenimages.php                          30-May-2024 18:01                2856
imagick.flipimage.php                              30-May-2024 18:01                4551
imagick.floodfillpaintimage.php                    30-May-2024 18:01               11709
imagick.flopimage.php                              30-May-2024 18:01                4583
imagick.forwardfouriertransformimage.php           30-May-2024 18:01               12124
imagick.frameimage.php                             30-May-2024 18:01                8345
imagick.functionimage.php                          30-May-2024 18:01               13801
imagick.fximage.php                                30-May-2024 18:01                6076
imagick.gammaimage.php                             30-May-2024 18:01                5737
imagick.gaussianblurimage.php                      30-May-2024 18:01                6273
imagick.getcolorspace.php                          30-May-2024 18:01                2500
imagick.getcompression.php                         30-May-2024 18:01                2317
imagick.getcompressionquality.php                  30-May-2024 18:01                2391
imagick.getcopyright.php                           30-May-2024 18:01                2420
imagick.getfilename.php                            30-May-2024 18:01                2479
imagick.getfont.php                                30-May-2024 18:01                3130
imagick.getformat.php                              30-May-2024 18:01                2441
imagick.getgravity.php                             30-May-2024 18:01                2479
imagick.gethomeurl.php                             30-May-2024 18:01                2297
imagick.getimage.php                               30-May-2024 18:01                2483
imagick.getimagealphachannel.php                   30-May-2024 18:01                3516
imagick.getimageartifact.php                       30-May-2024 18:01                3599
imagick.getimageattribute.php                      30-May-2024 18:01                2848
imagick.getimagebackgroundcolor.php                30-May-2024 18:01                2649
imagick.getimageblob.php                           30-May-2024 18:01                2735
imagick.getimageblueprimary.php                    30-May-2024 18:01                2926
imagick.getimagebordercolor.php                    30-May-2024 18:01                2657
imagick.getimagechanneldepth.php                   30-May-2024 18:01                3317
imagick.getimagechanneldistortion.php              30-May-2024 18:01                4115
imagick.getimagechanneldistortions.php             30-May-2024 18:01                4594
imagick.getimagechannelextrema.php                 30-May-2024 18:01                3665
imagick.getimagechannelkurtosis.php                30-May-2024 18:01                3729
imagick.getimagechannelmean.php                    30-May-2024 18:01                3292
imagick.getimagechannelrange.php                   30-May-2024 18:01                3582
imagick.getimagechannelstatistics.php              30-May-2024 18:01                2647
imagick.getimageclipmask.php                       30-May-2024 18:01                3012
imagick.getimagecolormapcolor.php                  30-May-2024 18:01                2992
imagick.getimagecolors.php                         30-May-2024 18:01                2461
imagick.getimagecolorspace.php                     30-May-2024 18:01                2444
imagick.getimagecompose.php                        30-May-2024 18:01                2453
imagick.getimagecompression.php                    30-May-2024 18:01                2405
imagick.getimagecompressionquality.php             30-May-2024 18:01                2499
imagick.getimagedelay.php                          30-May-2024 18:01                2472
imagick.getimagedepth.php                          30-May-2024 18:01                2250
imagick.getimagedispose.php                        30-May-2024 18:01                2512
imagick.getimagedistortion.php                     30-May-2024 18:01                3297
imagick.getimageextrema.php                        30-May-2024 18:01                2914
imagick.getimagefilename.php                       30-May-2024 18:01                2586
imagick.getimageformat.php                         30-May-2024 18:01                2568
imagick.getimagegamma.php                          30-May-2024 18:01                2467
imagick.getimagegeometry.php                       30-May-2024 18:01                4207
imagick.getimagegravity.php                        30-May-2024 18:01                2772
imagick.getimagegreenprimary.php                   30-May-2024 18:01                2737
imagick.getimageheight.php                         30-May-2024 18:01                2498
imagick.getimagehistogram.php                      30-May-2024 18:01               17231
imagick.getimageindex.php                          30-May-2024 18:01                3021
imagick.getimageinterlacescheme.php                30-May-2024 18:01                2551
imagick.getimageinterpolatemethod.php              30-May-2024 18:01                2771
imagick.getimageiterations.php                     30-May-2024 18:01                2560
imagick.getimagelength.php                         30-May-2024 18:01                3423
imagick.getimagematte.php                          30-May-2024 18:01                2874
imagick.getimagemattecolor.php                     30-May-2024 18:01                2829
imagick.getimagemimetype.php                       30-May-2024 18:01                2315
imagick.getimageorientation.php                    30-May-2024 18:01                2664
imagick.getimagepage.php                           30-May-2024 18:01                2729
imagick.getimagepixelcolor.php                     30-May-2024 18:01                3192
imagick.getimageprofile.php                        30-May-2024 18:01                2836
imagick.getimageprofiles.php                       30-May-2024 18:01                3600
imagick.getimageproperties.php                     30-May-2024 18:01                5846
imagick.getimageproperty.php                       30-May-2024 18:01                4992
imagick.getimageredprimary.php                     30-May-2024 18:01                2814
imagick.getimageregion.php                         30-May-2024 18:01                3992
imagick.getimagerenderingintent.php                30-May-2024 18:01                2688
imagick.getimageresolution.php                     30-May-2024 18:01                2564
imagick.getimagesblob.php                          30-May-2024 18:01                2575
imagick.getimagescene.php                          30-May-2024 18:01                2454
imagick.getimagesignature.php                      30-May-2024 18:01                2583
imagick.getimagesize.php                           30-May-2024 18:01                2697
imagick.getimagetickspersecond.php                 30-May-2024 18:01                2600
imagick.getimagetotalinkdensity.php                30-May-2024 18:01                2537
imagick.getimagetype.php                           30-May-2024 18:01                4907
imagick.getimageunits.php                          30-May-2024 18:01                2516
imagick.getimagevirtualpixelmethod.php             30-May-2024 18:01                2667
imagick.getimagewhitepoint.php                     30-May-2024 18:01                2717
imagick.getimagewidth.php                          30-May-2024 18:01                2472
imagick.getinterlacescheme.php                     30-May-2024 18:01                2618
imagick.getiteratorindex.php                       30-May-2024 18:01                6131
imagick.getnumberimages.php                        30-May-2024 18:01                2567
imagick.getoption.php                              30-May-2024 18:01                2810
imagick.getpackagename.php                         30-May-2024 18:01                2540
imagick.getpage.php                                30-May-2024 18:01                2551
imagick.getpixeliterator.php                       30-May-2024 18:01                6017
imagick.getpixelregioniterator.php                 30-May-2024 18:01                6764
imagick.getpointsize.php                           30-May-2024 18:01                2814
imagick.getquantum.php                             30-May-2024 18:01                2343
imagick.getquantumdepth.php                        30-May-2024 18:01                2651
imagick.getquantumrange.php                        30-May-2024 18:01                2913
imagick.getregistry.php                            30-May-2024 18:01                2557
imagick.getreleasedate.php                         30-May-2024 18:01                2564
imagick.getresource.php                            30-May-2024 18:01                2967
imagick.getresourcelimit.php                       30-May-2024 18:01                3382
imagick.getsamplingfactors.php                     30-May-2024 18:01                2628
imagick.getsize.php                                30-May-2024 18:01                5902
imagick.getsizeoffset.php                          30-May-2024 18:01                2622
imagick.getversion.php                             30-May-2024 18:01                2550
imagick.haldclutimage.php                          30-May-2024 18:01                6199
imagick.hasnextimage.php                           30-May-2024 18:01                2693
imagick.haspreviousimage.php                       30-May-2024 18:01                2731
imagick.identifyformat.php                         30-May-2024 18:01                4523
imagick.identifyimage.php                          30-May-2024 18:01                4134
imagick.implodeimage.php                           30-May-2024 18:01                4688
imagick.importimagepixels.php                      30-May-2024 18:01               11447
imagick.installation.php                           30-May-2024 18:01                2988
imagick.inversefouriertransformimage.php           30-May-2024 18:01                3545
imagick.labelimage.php                             30-May-2024 18:01                2626
imagick.levelimage.php                             30-May-2024 18:01                7803
imagick.linearstretchimage.php                     30-May-2024 18:01                5713
imagick.liquidrescaleimage.php                     30-May-2024 18:01                4561
imagick.listregistry.php                           30-May-2024 18:01                2402
imagick.magnifyimage.php                           30-May-2024 18:01                4252
imagick.mapimage.php                               30-May-2024 18:01                3272
imagick.mattefloodfillimage.php                    30-May-2024 18:01                5798
imagick.medianfilterimage.php                      30-May-2024 18:01                5164
imagick.mergeimagelayers.php                       30-May-2024 18:01                6491
imagick.minifyimage.php                            30-May-2024 18:01                2422
imagick.modulateimage.php                          30-May-2024 18:01                5661
imagick.montageimage.php                           30-May-2024 18:01                4603
imagick.morphimages.php                            30-May-2024 18:01                2844
imagick.morphology.php                             30-May-2024 18:01               66617
imagick.mosaicimages.php                           30-May-2024 18:01                2759
imagick.motionblurimage.php                        30-May-2024 18:01                6832
imagick.negateimage.php                            30-May-2024 18:01                5587
imagick.newimage.php                               30-May-2024 18:01                6313
imagick.newpseudoimage.php                         30-May-2024 18:01                5845
imagick.nextimage.php                              30-May-2024 18:01                2354
imagick.normalizeimage.php                         30-May-2024 18:01                6434
imagick.oilpaintimage.php                          30-May-2024 18:01                4639
imagick.opaquepaintimage.php                       30-May-2024 18:01                5132
imagick.optimizeimagelayers.php                    30-May-2024 18:01                5355
imagick.orderedposterizeimage.php                  30-May-2024 18:01                6846
imagick.paintfloodfillimage.php                    30-May-2024 18:01                5866
imagick.paintopaqueimage.php                       30-May-2024 18:01                5409
imagick.painttransparentimage.php                  30-May-2024 18:01                4674
imagick.pingimage.php                              30-May-2024 18:01                2776
imagick.pingimageblob.php                          30-May-2024 18:01                6008
imagick.pingimagefile.php                          30-May-2024 18:01                5840
imagick.polaroidimage.php                          30-May-2024 18:01                4795
imagick.posterizeimage.php                         30-May-2024 18:01                5672
imagick.previewimages.php                          30-May-2024 18:01                3147
imagick.previousimage.php                          30-May-2024 18:01                2409
imagick.profileimage.php                           30-May-2024 18:01                3235
imagick.quantizeimage.php                          30-May-2024 18:01                6727
imagick.quantizeimages.php                         30-May-2024 18:01                4064
imagick.queryfontmetrics.php                       30-May-2024 18:01                5615
imagick.queryfonts.php                             30-May-2024 18:01                4761
imagick.queryformats.php                           30-May-2024 18:01                7136
imagick.radialblurimage.php                        30-May-2024 18:01                5569
imagick.raiseimage.php                             30-May-2024 18:01                6556
imagick.randomthresholdimage.php                   30-May-2024 18:01                6477
imagick.readimage.php                              30-May-2024 18:01                2590
imagick.readimageblob.php                          30-May-2024 18:01                5466
imagick.readimagefile.php                          30-May-2024 18:01                3233
imagick.readimages.php                             30-May-2024 18:01                2637
imagick.recolorimage.php                           30-May-2024 18:01                6378
imagick.reducenoiseimage.php                       30-May-2024 18:01                5214
imagick.remapimage.php                             30-May-2024 18:01                3488
imagick.removeimage.php                            30-May-2024 18:01                2547
imagick.removeimageprofile.php                     30-May-2024 18:01                2831
imagick.render.php                                 30-May-2024 18:01                2317
imagick.requirements.php                           30-May-2024 18:01                1587
imagick.resampleimage.php                          30-May-2024 18:01                5665
imagick.resetimagepage.php                         30-May-2024 18:01                2854
imagick.resizeimage.php                            30-May-2024 18:01               11409
imagick.resources.php                              30-May-2024 18:01                1241
imagick.rollimage.php                              30-May-2024 18:01                4837
imagick.rotateimage.php                            30-May-2024 18:01                5713
imagick.rotationalblurimage.php                    30-May-2024 18:01                5852
imagick.roundcorners.php                           30-May-2024 18:01                6769
imagick.sampleimage.php                            30-May-2024 18:01                3013
imagick.scaleimage.php                             30-May-2024 18:01                7079
imagick.segmentimage.php                           30-May-2024 18:01                6816
imagick.selectiveblurimage.php                     30-May-2024 18:01                6715
imagick.separateimagechannel.php                   30-May-2024 18:01                5423
imagick.sepiatoneimage.php                         30-May-2024 18:01                4919
imagick.setbackgroundcolor.php                     30-May-2024 18:01                3293
imagick.setcolorspace.php                          30-May-2024 18:01                3045
imagick.setcompression.php                         30-May-2024 18:01                2807
imagick.setcompressionquality.php                  30-May-2024 18:01                6932
imagick.setfilename.php                            30-May-2024 18:01                2677
imagick.setfirstiterator.php                       30-May-2024 18:01                2403
imagick.setfont.php                                30-May-2024 18:01                5565
imagick.setformat.php                              30-May-2024 18:01                2579
imagick.setgravity.php                             30-May-2024 18:01                2789
imagick.setimage.php                               30-May-2024 18:01                4730
imagick.setimagealphachannel.php                   30-May-2024 18:01                3707
imagick.setimageartifact.php                       30-May-2024 18:01                7360
imagick.setimageattribute.php                      30-May-2024 18:01                3194
imagick.setimagebackgroundcolor.php                30-May-2024 18:01                3524
imagick.setimagebias.php                           30-May-2024 18:01                6777
imagick.setimagebiasquantum.php                    30-May-2024 18:01                2923
imagick.setimageblueprimary.php                    30-May-2024 18:01                3194
imagick.setimagebordercolor.php                    30-May-2024 18:01                3502
imagick.setimagechanneldepth.php                   30-May-2024 18:01                3211
imagick.setimageclipmask.php                       30-May-2024 18:01                8745
imagick.setimagecolormapcolor.php                  30-May-2024 18:01                3234
imagick.setimagecolorspace.php                     30-May-2024 18:01                3255
imagick.setimagecompose.php                        30-May-2024 18:01                2974
imagick.setimagecompression.php                    30-May-2024 18:01                2946
imagick.setimagecompressionquality.php             30-May-2024 18:01                4911
imagick.setimagedelay.php                          30-May-2024 18:01                6192
imagick.setimagedepth.php                          30-May-2024 18:01                2792
imagick.setimagedispose.php                        30-May-2024 18:01                2836
imagick.setimageextent.php                         30-May-2024 18:01                3111
imagick.setimagefilename.php                       30-May-2024 18:01                2888
imagick.setimageformat.php                         30-May-2024 18:01                2778
imagick.setimagegamma.php                          30-May-2024 18:01                2796
imagick.setimagegravity.php                        30-May-2024 18:01                2954
imagick.setimagegreenprimary.php                   30-May-2024 18:01                3187
imagick.setimageindex.php                          30-May-2024 18:01                3392
imagick.setimageinterlacescheme.php                30-May-2024 18:01                2956
imagick.setimageinterpolatemethod.php              30-May-2024 18:01                2881
imagick.setimageiterations.php                     30-May-2024 18:01                5038
imagick.setimagematte.php                          30-May-2024 18:01                2812
imagick.setimagemattecolor.php                     30-May-2024 18:01                3713
imagick.setimageopacity.php                        30-May-2024 18:01                5071
imagick.setimageorientation.php                    30-May-2024 18:01                4748
imagick.setimagepage.php                           30-May-2024 18:01                3750
imagick.setimageprofile.php                        30-May-2024 18:01                3330
imagick.setimageproperty.php                       30-May-2024 18:01                5210
imagick.setimageredprimary.php                     30-May-2024 18:01                3183
imagick.setimagerenderingintent.php                30-May-2024 18:01                2962
imagick.setimageresolution.php                     30-May-2024 18:01                5032
imagick.setimagescene.php                          30-May-2024 18:01                2816
imagick.setimagetickspersecond.php                 30-May-2024 18:01                7774
imagick.setimagetype.php                           30-May-2024 18:01                2612
imagick.setimageunits.php                          30-May-2024 18:01                2648
imagick.setimagevirtualpixelmethod.php             30-May-2024 18:01                2768
imagick.setimagewhitepoint.php                     30-May-2024 18:01                3181
imagick.setinterlacescheme.php                     30-May-2024 18:01                2696
imagick.setiteratorindex.php                       30-May-2024 18:01                6287
imagick.setlastiterator.php                        30-May-2024 18:01                2417
imagick.setoption.php                              30-May-2024 18:01               11564
imagick.setpage.php                                30-May-2024 18:01                3501
imagick.setpointsize.php                           30-May-2024 18:01                5268
imagick.setprogressmonitor.php                     30-May-2024 18:01               10270
imagick.setregistry.php                            30-May-2024 18:01                3094
imagick.setresolution.php                          30-May-2024 18:01                3797
imagick.setresourcelimit.php                       30-May-2024 18:01                3711
imagick.setsamplingfactors.php                     30-May-2024 18:01                6802
imagick.setsize.php                                30-May-2024 18:01                2927
imagick.setsizeoffset.php                          30-May-2024 18:01                3448
imagick.settype.php                                30-May-2024 18:01                2558
imagick.setup.php                                  30-May-2024 18:01                1656
imagick.shadeimage.php                             30-May-2024 18:01                5690
imagick.shadowimage.php                            30-May-2024 18:01                5476
imagick.sharpenimage.php                           30-May-2024 18:01                5646
imagick.shaveimage.php                             30-May-2024 18:01                4779
imagick.shearimage.php                             30-May-2024 18:01                6493
imagick.sigmoidalcontrastimage.php                 30-May-2024 18:01                8009
imagick.sketchimage.php                            30-May-2024 18:01                5892
imagick.smushimages.php                            30-May-2024 18:01                5829
imagick.solarizeimage.php                          30-May-2024 18:01                4882
imagick.sparsecolorimage.php                       30-May-2024 18:01               26779
imagick.spliceimage.php                            30-May-2024 18:01                5844
imagick.spreadimage.php                            30-May-2024 18:01                4694
imagick.statisticimage.php                         30-May-2024 18:01                6766
imagick.steganoimage.php                           30-May-2024 18:01                3079
imagick.stereoimage.php                            30-May-2024 18:01                2867
imagick.stripimage.php                             30-May-2024 18:01                2544
imagick.subimagematch.php                          30-May-2024 18:01                7543
imagick.swirlimage.php                             30-May-2024 18:01                4746
imagick.textureimage.php                           30-May-2024 18:01                6160
imagick.thresholdimage.php                         30-May-2024 18:01                5298
imagick.thumbnailimage.php                         30-May-2024 18:01                7646
imagick.tintimage.php                              30-May-2024 18:01                7832
imagick.tostring.php                               30-May-2024 18:01                2973
imagick.transformimage.php                         30-May-2024 18:01                6063
imagick.transformimagecolorspace.php               30-May-2024 18:01                5754
imagick.transparentpaintimage.php                  30-May-2024 18:01                7295
imagick.transposeimage.php                         30-May-2024 18:01                4636
imagick.transverseimage.php                        30-May-2024 18:01                4624
imagick.trimimage.php                              30-May-2024 18:01                5756
imagick.uniqueimagecolors.php                      30-May-2024 18:01                5570
imagick.unsharpmaskimage.php                       30-May-2024 18:01                6736
imagick.valid.php                                  30-May-2024 18:01                2297
imagick.vignetteimage.php                          30-May-2024 18:01                6641
imagick.waveimage.php                              30-May-2024 18:01                6364
imagick.whitethresholdimage.php                    30-May-2024 18:01                5235
imagick.writeimage.php                             30-May-2024 18:01                3057
imagick.writeimagefile.php                         30-May-2024 18:01                3811
imagick.writeimages.php                            30-May-2024 18:01                2911
imagick.writeimagesfile.php                        30-May-2024 18:01                3861
imagickdraw.affine.php                             30-May-2024 18:01               16987
imagickdraw.annotation.php                         30-May-2024 18:01                3383
imagickdraw.arc.php                                30-May-2024 18:01                9704
imagickdraw.bezier.php                             30-May-2024 18:01               16877                             30-May-2024 18:01                9099
imagickdraw.clear.php                              30-May-2024 18:01                2396
imagickdraw.clone.php                              30-May-2024 18:01                2489
imagickdraw.color.php                              30-May-2024 18:01                3543
imagickdraw.comment.php                            30-May-2024 18:01                2769
imagickdraw.composite.php                          30-May-2024 18:01               11965
imagickdraw.construct.php                          30-May-2024 18:01                2279
imagickdraw.destroy.php                            30-May-2024 18:01                2380
imagickdraw.ellipse.php                            30-May-2024 18:01               12285
imagickdraw.getclippath.php                        30-May-2024 18:01                2364
imagickdraw.getcliprule.php                        30-May-2024 18:01                2485
imagickdraw.getclipunits.php                       30-May-2024 18:01                2403
imagickdraw.getfillcolor.php                       30-May-2024 18:01                2442
imagickdraw.getfillopacity.php                     30-May-2024 18:01                2398
imagickdraw.getfillrule.php                        30-May-2024 18:01                2447
imagickdraw.getfont.php                            30-May-2024 18:01                2331
imagickdraw.getfontfamily.php                      30-May-2024 18:01                2391
imagickdraw.getfontsize.php                        30-May-2024 18:01                2467
imagickdraw.getfontstretch.php                     30-May-2024 18:01                2410
imagickdraw.getfontstyle.php                       30-May-2024 18:01                2610
imagickdraw.getfontweight.php                      30-May-2024 18:01                2423
imagickdraw.getgravity.php                         30-May-2024 18:01                2519
imagickdraw.getstrokeantialias.php                 30-May-2024 18:01                2787
imagickdraw.getstrokecolor.php                     30-May-2024 18:01                2836
imagickdraw.getstrokedasharray.php                 30-May-2024 18:01                2525
imagickdraw.getstrokedashoffset.php                30-May-2024 18:01                2499
imagickdraw.getstrokelinecap.php                   30-May-2024 18:01                2640
imagickdraw.getstrokelinejoin.php                  30-May-2024 18:01                2669
imagickdraw.getstrokemiterlimit.php                30-May-2024 18:01                2761
imagickdraw.getstrokeopacity.php                   30-May-2024 18:01                2502
imagickdraw.getstrokewidth.php                     30-May-2024 18:01                2511
imagickdraw.gettextalignment.php                   30-May-2024 18:01                2531
imagickdraw.gettextantialias.php                   30-May-2024 18:01                2668
imagickdraw.gettextdecoration.php                  30-May-2024 18:01                2568
imagickdraw.gettextencoding.php                    30-May-2024 18:01                2493
imagickdraw.gettextinterlinespacing.php            30-May-2024 18:01                2447
imagickdraw.gettextinterwordspacing.php            30-May-2024 18:01                2471
imagickdraw.gettextkerning.php                     30-May-2024 18:01                2366
imagickdraw.gettextundercolor.php                  30-May-2024 18:01                2541
imagickdraw.getvectorgraphics.php                  30-May-2024 18:01                2591
imagickdraw.line.php                               30-May-2024 18:01                8398
imagickdraw.matte.php                              30-May-2024 18:01                8427
imagickdraw.pathclose.php                          30-May-2024 18:01                2503
imagickdraw.pathcurvetoabsolute.php                30-May-2024 18:01                4967
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-May-2024 18:01               11218
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-May-2024 18:01                4348
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-May-2024 18:01               10356
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-May-2024 18:01               10509
imagickdraw.pathcurvetorelative.php                30-May-2024 18:01                4983
imagickdraw.pathcurvetosmoothabsolute.php          30-May-2024 18:01                4720
imagickdraw.pathcurvetosmoothrelative.php          30-May-2024 18:01                4727
imagickdraw.pathellipticarcabsolute.php            30-May-2024 18:01                5740
imagickdraw.pathellipticarcrelative.php            30-May-2024 18:01                5710
imagickdraw.pathfinish.php                         30-May-2024 18:01                2336
imagickdraw.pathlinetoabsolute.php                 30-May-2024 18:01                3273
imagickdraw.pathlinetohorizontalabsolute.php       30-May-2024 18:01                3123
imagickdraw.pathlinetohorizontalrelative.php       30-May-2024 18:01                3118
imagickdraw.pathlinetorelative.php                 30-May-2024 18:01                3323
imagickdraw.pathlinetoverticalabsolute.php         30-May-2024 18:01                3087
imagickdraw.pathlinetoverticalrelative.php         30-May-2024 18:01                3092
imagickdraw.pathmovetoabsolute.php                 30-May-2024 18:01                3320
imagickdraw.pathmovetorelative.php                 30-May-2024 18:01                3256
imagickdraw.pathstart.php                          30-May-2024 18:01               11838
imagickdraw.point.php                              30-May-2024 18:01                6932
imagickdraw.polygon.php                            30-May-2024 18:01                9001
imagickdraw.polyline.php                           30-May-2024 18:01                9005
imagickdraw.pop.php                                30-May-2024 18:01                2754
imagickdraw.popclippath.php                        30-May-2024 18:01                2295
imagickdraw.popdefs.php                            30-May-2024 18:01                7778
imagickdraw.poppattern.php                         30-May-2024 18:01                2487
imagickdraw.push.php                               30-May-2024 18:01                8505
imagickdraw.pushclippath.php                       30-May-2024 18:01                2996
imagickdraw.pushdefs.php                           30-May-2024 18:01                2594
imagickdraw.pushpattern.php                        30-May-2024 18:01               14680
imagickdraw.rectangle.php                          30-May-2024 18:01                8604
imagickdraw.render.php                             30-May-2024 18:01                2529
imagickdraw.resetvectorgraphics.php                30-May-2024 18:01                2455
imagickdraw.rotate.php                             30-May-2024 18:01                7799
imagickdraw.roundrectangle.php                     30-May-2024 18:01                9454
imagickdraw.scale.php                              30-May-2024 18:01                8145
imagickdraw.setclippath.php                        30-May-2024 18:01                8476
imagickdraw.setcliprule.php                        30-May-2024 18:01                9487
imagickdraw.setclipunits.php                       30-May-2024 18:01                8864
imagickdraw.setfillalpha.php                       30-May-2024 18:01                7820
imagickdraw.setfillcolor.php                       30-May-2024 18:01                7822
imagickdraw.setfillopacity.php                     30-May-2024 18:01                7878
imagickdraw.setfillpatternurl.php                  30-May-2024 18:01                3325
imagickdraw.setfillrule.php                        30-May-2024 18:01               13024
imagickdraw.setfont.php                            30-May-2024 18:01                9316
imagickdraw.setfontfamily.php                      30-May-2024 18:01                9928
imagickdraw.setfontsize.php                        30-May-2024 18:01                8326
imagickdraw.setfontstretch.php                     30-May-2024 18:01                9753
imagickdraw.setfontstyle.php                       30-May-2024 18:01                9043
imagickdraw.setfontweight.php                      30-May-2024 18:01                9179
imagickdraw.setgravity.php                         30-May-2024 18:01               10610
imagickdraw.setresolution.php                      30-May-2024 18:01                2936
imagickdraw.setstrokealpha.php                     30-May-2024 18:01                8480
imagickdraw.setstrokeantialias.php                 30-May-2024 18:01                9019
imagickdraw.setstrokecolor.php                     30-May-2024 18:01                8539
imagickdraw.setstrokedasharray.php                 30-May-2024 18:01               13446
imagickdraw.setstrokedashoffset.php                30-May-2024 18:01                9911
imagickdraw.setstrokelinecap.php                   30-May-2024 18:01                8627
imagickdraw.setstrokelinejoin.php                  30-May-2024 18:01               11513
imagickdraw.setstrokemiterlimit.php                30-May-2024 18:01               11330
imagickdraw.setstrokeopacity.php                   30-May-2024 18:01               10276
imagickdraw.setstrokepatternurl.php                30-May-2024 18:01                3006
imagickdraw.setstrokewidth.php                     30-May-2024 18:01                8511
imagickdraw.settextalignment.php                   30-May-2024 18:01                9492
imagickdraw.settextantialias.php                   30-May-2024 18:01                8906
imagickdraw.settextdecoration.php                  30-May-2024 18:01                7528
imagickdraw.settextencoding.php                    30-May-2024 18:01                3203
imagickdraw.settextinterlinespacing.php            30-May-2024 18:01                2981
imagickdraw.settextinterwordspacing.php            30-May-2024 18:01                2800
imagickdraw.settextkerning.php                     30-May-2024 18:01                2890
imagickdraw.settextundercolor.php                  30-May-2024 18:01                7844
imagickdraw.setvectorgraphics.php                  30-May-2024 18:01                9014
imagickdraw.setviewbox.php                         30-May-2024 18:01               10389
imagickdraw.skewx.php                              30-May-2024 18:01                8210
imagickdraw.skewy.php                              30-May-2024 18:01                8199
imagickdraw.translate.php                          30-May-2024 18:01                8537
imagickkernel.addkernel.php                        30-May-2024 18:01                7059
imagickkernel.addunitykernel.php                   30-May-2024 18:01               13712
imagickkernel.frombuiltin.php                      30-May-2024 18:01               26264
imagickkernel.frommatrix.php                       30-May-2024 18:01               23196
imagickkernel.getmatrix.php                        30-May-2024 18:01                7119
imagickkernel.scale.php                            30-May-2024 18:01               13226
imagickkernel.separate.php                         30-May-2024 18:01                9746
imagickpixel.clear.php                             30-May-2024 18:01                2427
imagickpixel.construct.php                         30-May-2024 18:01               11863
imagickpixel.destroy.php                           30-May-2024 18:01                2516
imagickpixel.getcolor.php                          30-May-2024 18:01                7924
imagickpixel.getcolorasstring.php                  30-May-2024 18:01                4914
imagickpixel.getcolorcount.php                     30-May-2024 18:01                4948
imagickpixel.getcolorquantum.php                   30-May-2024 18:01                2941
imagickpixel.getcolorvalue.php                     30-May-2024 18:01                8695
imagickpixel.getcolorvaluequantum.php              30-May-2024 18:01                6135
imagickpixel.gethsl.php                            30-May-2024 18:01                4417
imagickpixel.getindex.php                          30-May-2024 18:01                2313
imagickpixel.ispixelsimilar.php                    30-May-2024 18:01                3657
imagickpixel.ispixelsimilarquantum.php             30-May-2024 18:01                3262
imagickpixel.issimilar.php                         30-May-2024 18:01               16573
imagickpixel.setcolor.php                          30-May-2024 18:01                7541
imagickpixel.setcolorcount.php                     30-May-2024 18:01                2709
imagickpixel.setcolorvalue.php                     30-May-2024 18:01                5214
imagickpixel.setcolorvaluequantum.php              30-May-2024 18:01                8501
imagickpixel.sethsl.php                            30-May-2024 18:01                7576
imagickpixel.setindex.php                          30-May-2024 18:01                2638
imagickpixeliterator.clear.php                     30-May-2024 18:01                6343
imagickpixeliterator.construct.php                 30-May-2024 18:01                6016
imagickpixeliterator.destroy.php                   30-May-2024 18:01                2557
imagickpixeliterator.getcurrentiteratorrow.php     30-May-2024 18:01                2664
imagickpixeliterator.getiteratorrow.php            30-May-2024 18:01                2589
imagickpixeliterator.getnextiteratorrow.php        30-May-2024 18:01                6774
imagickpixeliterator.getpreviousiteratorrow.php    30-May-2024 18:01                2733
imagickpixeliterator.newpixeliterator.php          30-May-2024 18:01                2810
imagickpixeliterator.newpixelregioniterator.php    30-May-2024 18:01                4331
imagickpixeliterator.resetiterator.php             30-May-2024 18:01                8751
imagickpixeliterator.setiteratorfirstrow.php       30-May-2024 18:01                2651
imagickpixeliterator.setiteratorlastrow.php        30-May-2024 18:01                2644
imagickpixeliterator.setiteratorrow.php            30-May-2024 18:01                7163
imagickpixeliterator.synciterator.php              30-May-2024 18:01                2499
imap.configuration.php                             30-May-2024 18:01                3285
imap.constants.php                                 30-May-2024 18:01               25149
imap.installation.php                              30-May-2024 18:01                2772
imap.requirements.php                              30-May-2024 18:01                3170
imap.resources.php                                 30-May-2024 18:01                1449
imap.setup.php                                     30-May-2024 18:01                1625
index.php                                          30-May-2024 18:01               14840
indexes.examples.php                               30-May-2024 18:01              727030
indexes.functions.php                              30-May-2024 18:01             1180012
indexes.php                                        30-May-2024 18:01                1541
infiniteiterator.construct.php                     30-May-2024 18:01                5094                          30-May-2024 18:01                3337
info.configuration.php                             30-May-2024 18:01               14126
info.constants.php                                 30-May-2024 18:01               24414
info.installation.php                              30-May-2024 18:01                1261
info.requirements.php                              30-May-2024 18:01                1237
info.resources.php                                 30-May-2024 18:01                1220
info.setup.php                                     30-May-2024 18:01                1625
ini.core.php                                       30-May-2024 18:01               75091
ini.list.php                                       30-May-2024 18:01              105330
ini.php                                            30-May-2024 18:01                1621
ini.sections.php                                   30-May-2024 18:01                4145
inotify.configuration.php                          30-May-2024 18:01                1307
inotify.constants.php                              30-May-2024 18:01               10450
inotify.install.php                                30-May-2024 18:01                1766
inotify.requirements.php                           30-May-2024 18:01                1261
inotify.resources.php                              30-May-2024 18:01                1356
inotify.setup.php                                  30-May-2024 18:01                1660                            30-May-2024 18:01                4317                     30-May-2024 18:01                3210                              30-May-2024 18:01                1460                                  30-May-2024 18:01                1744
install.fpm.configuration.php                      30-May-2024 18:01               36690
install.fpm.install.php                            30-May-2024 18:01                3410
install.fpm.php                                    30-May-2024 18:01                3967
install.general.php                                30-May-2024 18:01                4743
install.macosx.bundled.php                         30-May-2024 18:01               10780
install.macosx.compile.php                         30-May-2024 18:01                1402
install.macosx.packages.php                        30-May-2024 18:01                3125
install.macosx.php                                 30-May-2024 18:01                2013
install.pecl.downloads.php                         30-May-2024 18:01                3759
install.pecl.intro.php                             30-May-2024 18:01                3256
install.pecl.pear.php                              30-May-2024 18:01                3145
install.pecl.php                                   30-May-2024 18:01                2076
install.pecl.php-config.php                        30-May-2024 18:01                4387
install.pecl.phpize.php                            30-May-2024 18:01                3171
install.pecl.static.php                            30-May-2024 18:01                3513                           30-May-2024 18:01               10119
install.php                                        30-May-2024 18:01                5748
install.problems.bugs.php                          30-May-2024 18:01                1896
install.problems.faq.php                           30-May-2024 18:01                1337
install.problems.php                               30-May-2024 18:01                1636                       30-May-2024 18:01                2354
install.unix.apache2.php                           30-May-2024 18:01               13509
install.unix.commandline.php                       30-May-2024 18:01                3935
install.unix.debian.php                            30-May-2024 18:01                7092
install.unix.lighttpd-14.php                       30-May-2024 18:01                6213
install.unix.litespeed.php                         30-May-2024 18:01                9733
install.unix.nginx.php                             30-May-2024 18:01                9029
install.unix.openbsd.php                           30-May-2024 18:01                6147
install.unix.php                                   30-May-2024 18:01                8392
install.unix.solaris.php                           30-May-2024 18:01                4072                        30-May-2024 18:01                7359                       30-May-2024 18:01                1741                    30-May-2024 18:01                8641                         30-May-2024 18:01                5575                           30-May-2024 18:01                1689                                30-May-2024 18:01                3384                    30-May-2024 18:01                5224                   30-May-2024 18:01                2444                          30-May-2024 18:01                1917                30-May-2024 18:01                2023
internaliterator.construct.php                     30-May-2024 18:01                2025
internaliterator.current.php                       30-May-2024 18:01                2331
internaliterator.key.php                           30-May-2024 18:01                2338                          30-May-2024 18:01                2314
internaliterator.rewind.php                        30-May-2024 18:01                2347
internaliterator.valid.php                         30-May-2024 18:01                2356
intl.configuration.php                             30-May-2024 18:01                5341
intl.constants.php                                 30-May-2024 18:01               69501
intl.examples.basic.php                            30-May-2024 18:01                4357
intl.examples.php                                  30-May-2024 18:01                1432
intl.installation.php                              30-May-2024 18:01                1775
intl.requirements.php                              30-May-2024 18:01                1391
intl.resources.php                                 30-May-2024 18:01                1220
intl.setup.php                                     30-May-2024 18:01                1624
intlbreakiterator.construct.php                    30-May-2024 18:01                4089
intlbreakiterator.createcharacterinstance.php      30-May-2024 18:01                3384
intlbreakiterator.createcodepointinstance.php      30-May-2024 18:01                2829
intlbreakiterator.createlineinstance.php           30-May-2024 18:01                3345
intlbreakiterator.createsentenceinstance.php       30-May-2024 18:01                3347
intlbreakiterator.createtitleinstance.php          30-May-2024 18:01                3327
intlbreakiterator.createwordinstance.php           30-May-2024 18:01                3281
intlbreakiterator.current.php                      30-May-2024 18:01                2518
intlbreakiterator.first.php                        30-May-2024 18:01                2502
intlbreakiterator.following.php                    30-May-2024 18:01                2802
intlbreakiterator.geterrorcode.php                 30-May-2024 18:01                3048
intlbreakiterator.geterrormessage.php              30-May-2024 18:01                3097
intlbreakiterator.getlocale.php                    30-May-2024 18:01                2912
intlbreakiterator.getpartsiterator.php             30-May-2024 18:01                3739
intlbreakiterator.gettext.php                      30-May-2024 18:01                2635
intlbreakiterator.isboundary.php                   30-May-2024 18:01                2772
intlbreakiterator.last.php                         30-May-2024 18:01                2501                         30-May-2024 18:01                2936
intlbreakiterator.preceding.php                    30-May-2024 18:01                2780
intlbreakiterator.previous.php                     30-May-2024 18:01                2557
intlbreakiterator.settext.php                      30-May-2024 18:01                3651
intlcalendar.add.php                               30-May-2024 18:01                8892
intlcalendar.after.php                             30-May-2024 18:01                6934
intlcalendar.before.php                            30-May-2024 18:01                4317
intlcalendar.clear.php                             30-May-2024 18:01               19139
intlcalendar.construct.php                         30-May-2024 18:01                2368
intlcalendar.createinstance.php                    30-May-2024 18:01               13622
intlcalendar.equals.php                            30-May-2024 18:01               11029
intlcalendar.fielddifference.php                   30-May-2024 18:01               11418
intlcalendar.fromdatetime.php                      30-May-2024 18:01                8094
intlcalendar.get.php                               30-May-2024 18:01                8904
intlcalendar.getactualmaximum.php                  30-May-2024 18:01                8821
intlcalendar.getactualminimum.php                  30-May-2024 18:01                5984
intlcalendar.getavailablelocales.php               30-May-2024 18:01                4502
intlcalendar.getdayofweektype.php                  30-May-2024 18:01               10741
intlcalendar.geterrorcode.php                      30-May-2024 18:01                9195
intlcalendar.geterrormessage.php                   30-May-2024 18:01                6240
intlcalendar.getfirstdayofweek.php                 30-May-2024 18:01                8834
intlcalendar.getgreatestminimum.php                30-May-2024 18:01                4869
intlcalendar.getkeywordvaluesforlocale.php         30-May-2024 18:01                7588
intlcalendar.getleastmaximum.php                   30-May-2024 18:01                8468
intlcalendar.getlocale.php                         30-May-2024 18:01                6421
intlcalendar.getmaximum.php                        30-May-2024 18:01                5517
intlcalendar.getminimaldaysinfirstweek.php         30-May-2024 18:01                9129
intlcalendar.getminimum.php                        30-May-2024 18:01                4813
intlcalendar.getnow.php                            30-May-2024 18:01                5419
intlcalendar.getrepeatedwalltimeoption.php         30-May-2024 18:01               10395
intlcalendar.getskippedwalltimeoption.php          30-May-2024 18:01               12734
intlcalendar.gettime.php                           30-May-2024 18:01                6687
intlcalendar.gettimezone.php                       30-May-2024 18:01                7632
intlcalendar.gettype.php                           30-May-2024 18:01                5813
intlcalendar.getweekendtransition.php              30-May-2024 18:01                5478
intlcalendar.indaylighttime.php                    30-May-2024 18:01                8858
intlcalendar.isequivalentto.php                    30-May-2024 18:01                8556
intlcalendar.islenient.php                         30-May-2024 18:01                8459
intlcalendar.isset.php                             30-May-2024 18:01                4900
intlcalendar.isweekend.php                         30-May-2024 18:01                9104
intlcalendar.roll.php                              30-May-2024 18:01                9592
intlcalendar.set.php                               30-May-2024 18:01               16112
intlcalendar.setdate.php                           30-May-2024 18:01                4904
intlcalendar.setdatetime.php                       30-May-2024 18:01                6827
intlcalendar.setfirstdayofweek.php                 30-May-2024 18:01                8965
intlcalendar.setlenient.php                        30-May-2024 18:01                5135
intlcalendar.setminimaldaysinfirstweek.php         30-May-2024 18:01                5474
intlcalendar.setrepeatedwalltimeoption.php         30-May-2024 18:01                6601
intlcalendar.setskippedwalltimeoption.php          30-May-2024 18:01                7468
intlcalendar.settime.php                           30-May-2024 18:01                8791
intlcalendar.settimezone.php                       30-May-2024 18:01               11362
intlcalendar.todatetime.php                        30-May-2024 18:01                7246
intlchar.charage.php                               30-May-2024 18:01                5982
intlchar.chardigitvalue.php                        30-May-2024 18:01                5643
intlchar.chardirection.php                         30-May-2024 18:01               10801
intlchar.charfromname.php                          30-May-2024 18:01                7335
intlchar.charmirror.php                            30-May-2024 18:01                6721
intlchar.charname.php                              30-May-2024 18:01                7754
intlchar.chartype.php                              30-May-2024 18:01               11691
intlchar.chr.php                                   30-May-2024 18:01                5739
intlchar.digit.php                                 30-May-2024 18:01                8577
intlchar.enumcharnames.php                         30-May-2024 18:01                9156
intlchar.enumchartypes.php                         30-May-2024 18:01                5900
intlchar.foldcase.php                              30-May-2024 18:01                4154
intlchar.fordigit.php                              30-May-2024 18:01                7162
intlchar.getbidipairedbracket.php                  30-May-2024 18:01                6481
intlchar.getblockcode.php                          30-May-2024 18:01                5704
intlchar.getcombiningclass.php                     30-May-2024 18:01                5048
intlchar.getfc-nfkc-closure.php                    30-May-2024 18:01                5069
intlchar.getintpropertymaxvalue.php                30-May-2024 18:01                6464
intlchar.getintpropertyminvalue.php                30-May-2024 18:01                6457
intlchar.getintpropertyvalue.php                   30-May-2024 18:01                8201
intlchar.getnumericvalue.php                       30-May-2024 18:01                5754
intlchar.getpropertyenum.php                       30-May-2024 18:01                6790
intlchar.getpropertyname.php                       30-May-2024 18:01                9162
intlchar.getpropertyvalueenum.php                  30-May-2024 18:01                8065
intlchar.getpropertyvaluename.php                  30-May-2024 18:01               10980
intlchar.getunicodeversion.php                     30-May-2024 18:01                4033
intlchar.hasbinaryproperty.php                     30-May-2024 18:01                9162
intlchar.isalnum.php                               30-May-2024 18:01                6078
intlchar.isalpha.php                               30-May-2024 18:01                5955
intlchar.isbase.php                                30-May-2024 18:01                6273
intlchar.isblank.php                               30-May-2024 18:01                6938
intlchar.iscntrl.php                               30-May-2024 18:01                7028
intlchar.isdefined.php                             30-May-2024 18:01                6950
intlchar.isdigit.php                               30-May-2024 18:01                6273
intlchar.isgraph.php                               30-May-2024 18:01                6225
intlchar.isidignorable.php                         30-May-2024 18:01                6482
intlchar.isidpart.php                              30-May-2024 18:01                7123
intlchar.isidstart.php                             30-May-2024 18:01                6551
intlchar.isisocontrol.php                          30-May-2024 18:01                5758
intlchar.isjavaidpart.php                          30-May-2024 18:01                7043
intlchar.isjavaidstart.php                         30-May-2024 18:01                6773
intlchar.isjavaspacechar.php                       30-May-2024 18:01                7006
intlchar.islower.php                               30-May-2024 18:01                7435
intlchar.ismirrored.php                            30-May-2024 18:01                5882
intlchar.isprint.php                               30-May-2024 18:01                6354
intlchar.ispunct.php                               30-May-2024 18:01                6036
intlchar.isspace.php                               30-May-2024 18:01                6759
intlchar.istitle.php                               30-May-2024 18:01                7648
intlchar.isualphabetic.php                         30-May-2024 18:01                6095
intlchar.isulowercase.php                          30-May-2024 18:01                7128
intlchar.isupper.php                               30-May-2024 18:01                7438
intlchar.isuuppercase.php                          30-May-2024 18:01                7166
intlchar.isuwhitespace.php                         30-May-2024 18:01                7588
intlchar.iswhitespace.php                          30-May-2024 18:01                7480
intlchar.isxdigit.php                              30-May-2024 18:01                7361
intlchar.ord.php                                   30-May-2024 18:01                5595
intlchar.tolower.php                               30-May-2024 18:01                7892
intlchar.totitle.php                               30-May-2024 18:01                8037
intlchar.toupper.php                               30-May-2024 18:01                7784
intlcodepointbreakiterator.getlastcodepoint.php    30-May-2024 18:01                2760
intldateformatter.create.php                       30-May-2024 18:01               29332
intldateformatter.format.php                       30-May-2024 18:01               26668
intldateformatter.formatobject.php                 30-May-2024 18:01               14737
intldateformatter.getcalendar.php                  30-May-2024 18:01               11201
intldateformatter.getcalendarobject.php            30-May-2024 18:01                7730
intldateformatter.getdatetype.php                  30-May-2024 18:01               11669
intldateformatter.geterrorcode.php                 30-May-2024 18:01                8621
intldateformatter.geterrormessage.php              30-May-2024 18:01                8599
intldateformatter.getlocale.php                    30-May-2024 18:01               12341
intldateformatter.getpattern.php                   30-May-2024 18:01               10394
intldateformatter.gettimetype.php                  30-May-2024 18:01               11663
intldateformatter.gettimezone.php                  30-May-2024 18:01                8732
intldateformatter.gettimezoneid.php                30-May-2024 18:01                8951
intldateformatter.islenient.php                    30-May-2024 18:01               14744
intldateformatter.localtime.php                    30-May-2024 18:01               11615
intldateformatter.parse.php                        30-May-2024 18:01               12468
intldateformatter.setcalendar.php                  30-May-2024 18:01               14530
intldateformatter.setlenient.php                   30-May-2024 18:01               15601
intldateformatter.setpattern.php                   30-May-2024 18:01               11624
intldateformatter.settimezone.php                  30-May-2024 18:01               12595
intldatepatterngenerator.create.php                30-May-2024 18:01                4427
intldatepatterngenerator.getbestpattern.php        30-May-2024 18:01                6969
intlgregoriancalendar.construct.php                30-May-2024 18:01                5700
intlgregoriancalendar.createfromdate.php           30-May-2024 18:01                7449
intlgregoriancalendar.createfromdatetime.php       30-May-2024 18:01                9158
intlgregoriancalendar.getgregorianchange.php       30-May-2024 18:01                2740
intlgregoriancalendar.isleapyear.php               30-May-2024 18:01                3104
intlgregoriancalendar.setgregorianchange.php       30-May-2024 18:01                3142
intliterator.current.php                           30-May-2024 18:01                2392
intliterator.key.php                               30-May-2024 18:01                2361                              30-May-2024 18:01                2377
intliterator.rewind.php                            30-May-2024 18:01                2405
intliterator.valid.php                             30-May-2024 18:01                2382
intlpartsiterator.getbreakiterator.php             30-May-2024 18:01                2603
intlrulebasedbreakiterator.construct.php           30-May-2024 18:01                3238
intlrulebasedbreakiterator.getbinaryrules.php      30-May-2024 18:01                2860
intlrulebasedbreakiterator.getrules.php            30-May-2024 18:01                2824
intlrulebasedbreakiterator.getrulestatus.php       30-May-2024 18:01                2796
intlrulebasedbreakiterator.getrulestatusvec.php    30-May-2024 18:01                2918
intltimezone.construct.php                         30-May-2024 18:01                2009
intltimezone.countequivalentids.php                30-May-2024 18:01                3727
intltimezone.createdefault.php                     30-May-2024 18:01                3055
intltimezone.createenumeration.php                 30-May-2024 18:01                4813
intltimezone.createtimezone.php                    30-May-2024 18:01                3703
intltimezone.createtimezoneidenumeration.php       30-May-2024 18:01                5900
intltimezone.fromdatetimezone.php                  30-May-2024 18:01                3824
intltimezone.getcanonicalid.php                    30-May-2024 18:01                4450
intltimezone.getdisplayname.php                    30-May-2024 18:01                5631
intltimezone.getdstsavings.php                     30-May-2024 18:01                3187
intltimezone.getequivalentid.php                   30-May-2024 18:01                4133
intltimezone.geterrorcode.php                      30-May-2024 18:01                3359
intltimezone.geterrormessage.php                   30-May-2024 18:01                3387
intltimezone.getgmt.php                            30-May-2024 18:01                2904
intltimezone.getid.php                             30-May-2024 18:01                3239
intltimezone.getidforwindowsid.php                 30-May-2024 18:01                5902
intltimezone.getoffset.php                         30-May-2024 18:01                5151
intltimezone.getrawoffset.php                      30-May-2024 18:01                3138
intltimezone.getregion.php                         30-May-2024 18:01                3741
intltimezone.gettzdataversion.php                  30-May-2024 18:01                3278
intltimezone.getunknown.php                        30-May-2024 18:01                3170
intltimezone.getwindowsid.php                      30-May-2024 18:01                4483
intltimezone.hassamerules.php                      30-May-2024 18:01                3565
intltimezone.todatetimezone.php                    30-May-2024 18:01                3488
intltimezone.usedaylighttime.php                   30-May-2024 18:01                3164
intro-whatcando.php                                30-May-2024 18:01                8438
intro-whatis.php                                   30-May-2024 18:01                4276
intro.apache.php                                   30-May-2024 18:01                1205
intro.apcu.php                                     30-May-2024 18:01                1817
intro.array.php                                    30-May-2024 18:01                2047
intro.bc.php                                       30-May-2024 18:01                4675
intro.bzip2.php                                    30-May-2024 18:01                1240
intro.calendar.php                                 30-May-2024 18:01                2334
intro.classobj.php                                 30-May-2024 18:01                1826
intro.cmark.php                                    30-May-2024 18:01                7363                                      30-May-2024 18:01                3108
intro.componere.php                                30-May-2024 18:01                6689
intro.ctype.php                                    30-May-2024 18:01                4046
intro.cubrid.php                                   30-May-2024 18:01                1496
intro.curl.php                                     30-May-2024 18:01                1664
intro.datetime.php                                 30-May-2024 18:01                2984
intro.dba.php                                      30-May-2024 18:01                1605
intro.dbase.php                                    30-May-2024 18:01                7307
intro.dio.php                                      30-May-2024 18:01                1781
intro.dom.php                                      30-May-2024 18:01                1751
intro.ds.php                                       30-May-2024 18:01                1444
intro.eio.php                                      30-May-2024 18:01               14416
intro.enchant.php                                  30-May-2024 18:01                2629
intro.errorfunc.php                                30-May-2024 18:01                2080
intro.ev.php                                       30-May-2024 18:01                2308
intro.event.php                                    30-May-2024 18:01                1985
intro.exec.php                                     30-May-2024 18:01                1851
intro.exif.php                                     30-May-2024 18:01                1514
intro.expect.php                                   30-May-2024 18:01                1450
intro.fann.php                                     30-May-2024 18:01                1429
intro.fdf.php                                      30-May-2024 18:01                3967
intro.ffi.php                                      30-May-2024 18:01                2869
intro.fileinfo.php                                 30-May-2024 18:01                1444
intro.filesystem.php                               30-May-2024 18:01                1457
intro.filter.php                                   30-May-2024 18:01                3063
intro.fpm.php                                      30-May-2024 18:01                1355
intro.ftp.php                                      30-May-2024 18:01                1919
intro.funchand.php                                 30-May-2024 18:01                1256
intro.gearman.php                                  30-May-2024 18:01                1680
intro.gender.php                                   30-May-2024 18:01                1367
intro.geoip.php                                    30-May-2024 18:01                1588
intro.gettext.php                                  30-May-2024 18:01                1652
intro.gmagick.php                                  30-May-2024 18:01                1710
intro.gmp.php                                      30-May-2024 18:01                3200
intro.gnupg.php                                    30-May-2024 18:01                1249
intro.hash.php                                     30-May-2024 18:01                1332
intro.hrtime.php                                   30-May-2024 18:01                1683
intro.ibase.php                                    30-May-2024 18:01                3238                                  30-May-2024 18:01                1297
intro.iconv.php                                    30-May-2024 18:01                1973
intro.igbinary.php                                 30-May-2024 18:01                1692
intro.image.php                                    30-May-2024 18:01                7282
intro.imagick.php                                  30-May-2024 18:01                1773
intro.imap.php                                     30-May-2024 18:01                1772                                     30-May-2024 18:01                1638
intro.inotify.php                                  30-May-2024 18:01                2359
intro.intl.php                                     30-May-2024 18:01                5031
intro.json.php                                     30-May-2024 18:01                1673
intro.ldap.php                                     30-May-2024 18:01                4562
intro.libxml.php                                   30-May-2024 18:01                1788
intro.lua.php                                      30-May-2024 18:01                1285
intro.luasandbox.php                               30-May-2024 18:01                2382
intro.lzf.php                                      30-May-2024 18:01                1438
intro.mail.php                                     30-May-2024 18:01                1245
intro.mailparse.php                                30-May-2024 18:01                1957
intro.math.php                                     30-May-2024 18:01                2111
intro.mbstring.php                                 30-May-2024 18:01                2877
intro.mcrypt.php                                   30-May-2024 18:01                2349
intro.memcache.php                                 30-May-2024 18:01                1717
intro.memcached.php                                30-May-2024 18:01                1894
intro.mhash.php                                    30-May-2024 18:01                2861
intro.misc.php                                     30-May-2024 18:01                1185
intro.mqseries.php                                 30-May-2024 18:01                1761
intro.mysql-xdevapi.php                            30-May-2024 18:01                2007
intro.mysql.php                                    30-May-2024 18:01                1991
intro.mysqli.php                                   30-May-2024 18:01                2226
intro.mysqlnd.php                                  30-May-2024 18:01                2037                                  30-May-2024 18:01                1211
intro.oauth.php                                    30-May-2024 18:01                1351
intro.oci8.php                                     30-May-2024 18:01                1571
intro.opcache.php                                  30-May-2024 18:01                1561
intro.openal.php                                   30-May-2024 18:01                1270
intro.openssl.php                                  30-May-2024 18:01                1726
intro.outcontrol.php                               30-May-2024 18:01                1906
intro.parallel.php                                 30-May-2024 18:01                6912
intro.parle.php                                    30-May-2024 18:01                3456
intro.password.php                                 30-May-2024 18:01                1466
intro.pcntl.php                                    30-May-2024 18:01                2893
intro.pcre.php                                     30-May-2024 18:01                2976
intro.pdo.php                                      30-May-2024 18:01                2220
intro.pgsql.php                                    30-May-2024 18:01                1662
intro.phar.php                                     30-May-2024 18:01               10041
intro.phpdbg.php                                   30-May-2024 18:01                6058
intro.posix.php                                    30-May-2024 18:01                1777                                       30-May-2024 18:01                1779
intro.pspell.php                                   30-May-2024 18:01                1249
intro.pthreads.php                                 30-May-2024 18:01                9152
intro.quickhash.php                                30-May-2024 18:01                1284
intro.radius.php                                   30-May-2024 18:01                2185
intro.random.php                                   30-May-2024 18:01                1126
intro.rar.php                                      30-May-2024 18:01                1567
intro.readline.php                                 30-May-2024 18:01                2170
intro.recode.php                                   30-May-2024 18:01                2462
intro.reflection.php                               30-May-2024 18:01                1908
intro.rnp.php                                      30-May-2024 18:01                1297
intro.rpminfo.php                                  30-May-2024 18:01                1414
intro.rrd.php                                      30-May-2024 18:01                1453
intro.runkit7.php                                  30-May-2024 18:01                1496
intro.scoutapm.php                                 30-May-2024 18:01                1501
intro.seaslog.php                                  30-May-2024 18:01                3950
intro.sem.php                                      30-May-2024 18:01                3822
intro.session.php                                  30-May-2024 18:01                5103
intro.shmop.php                                    30-May-2024 18:01                1299
intro.simdjson.php                                 30-May-2024 18:01                1246
intro.simplexml.php                                30-May-2024 18:01                1379
intro.snmp.php                                     30-May-2024 18:01                1758
intro.soap.php                                     30-May-2024 18:01                1517
intro.sockets.php                                  30-May-2024 18:01                2781
intro.sodium.php                                   30-May-2024 18:01                1465
intro.solr.php                                     30-May-2024 18:01                1941
intro.spl.php                                      30-May-2024 18:01                1647
intro.sqlite3.php                                  30-May-2024 18:01                1178
intro.sqlsrv.php                                   30-May-2024 18:01                2183
intro.ssdeep.php                                   30-May-2024 18:01                1776
intro.ssh2.php                                     30-May-2024 18:01                1411
intro.stats.php                                    30-May-2024 18:01                1528
intro.stomp.php                                    30-May-2024 18:01                1361                                   30-May-2024 18:01                3977
intro.strings.php                                  30-May-2024 18:01                1774
intro.svm.php                                      30-May-2024 18:01                1259
intro.svn.php                                      30-May-2024 18:01                1838
intro.swoole.php                                   30-May-2024 18:01                1674
intro.sync.php                                     30-May-2024 18:01                2372
intro.taint.php                                    30-May-2024 18:01                4324
intro.tcpwrap.php                                  30-May-2024 18:01                1290
intro.tidy.php                                     30-May-2024 18:01                1426
intro.tokenizer.php                                30-May-2024 18:01                1581
intro.trader.php                                   30-May-2024 18:01                2405
intro.ui.php                                       30-May-2024 18:01                1218
intro.uodbc.php                                    30-May-2024 18:01                2867
intro.uopz.php                                     30-May-2024 18:01                2302
intro.url.php                                      30-May-2024 18:01                1156
intro.v8js.php                                     30-May-2024 18:01                1250
intro.var.php                                      30-May-2024 18:01                1346
intro.var_representation.php                       30-May-2024 18:01                1446
intro.varnish.php                                  30-May-2024 18:01                1335
intro.wddx.php                                     30-May-2024 18:01                2164
intro.win32service.php                             30-May-2024 18:01                1418
intro.wincache.php                                 30-May-2024 18:01                4907
intro.wkhtmltox.php                                30-May-2024 18:01                1294
intro.xattr.php                                    30-May-2024 18:01                1207
intro.xdiff.php                                    30-May-2024 18:01                2629
intro.xhprof.php                                   30-May-2024 18:01                2811
intro.xlswriter.php                                30-May-2024 18:01                1207
intro.xml.php                                      30-May-2024 18:01                2271
intro.xmldiff.php                                  30-May-2024 18:01                1428
intro.xmlreader.php                                30-May-2024 18:01                1631
intro.xmlrpc.php                                   30-May-2024 18:01                1920
intro.xmlwriter.php                                30-May-2024 18:01                1611
intro.xsl.php                                      30-May-2024 18:01                1376
intro.yac.php                                      30-May-2024 18:01                1219
intro.yaconf.php                                   30-May-2024 18:01                2568
intro.yaf.php                                      30-May-2024 18:01                1567
intro.yaml.php                                     30-May-2024 18:01                1423
intro.yar.php                                      30-May-2024 18:01                1288
intro.yaz.php                                      30-May-2024 18:01                2547                                      30-May-2024 18:01                1239
intro.zlib.php                                     30-May-2024 18:01                1788
intro.zmq.php                                      30-May-2024 18:01                1404
intro.zookeeper.php                                30-May-2024 18:01                1465
introduction.php                                   30-May-2024 18:01                1482
iterator.current.php                               30-May-2024 18:01                2197
iterator.key.php                                   30-May-2024 18:01                2639                                  30-May-2024 18:01                2485
iterator.rewind.php                                30-May-2024 18:01                2654
iterator.valid.php                                 30-May-2024 18:01                2854
iteratoraggregate.getiterator.php                  30-May-2024 18:01                2892
iteratoriterator.construct.php                     30-May-2024 18:01                3472
iteratoriterator.current.php                       30-May-2024 18:01                2746
iteratoriterator.getinneriterator.php              30-May-2024 18:01                3193
iteratoriterator.key.php                           30-May-2024 18:01                2694                          30-May-2024 18:01                2863
iteratoriterator.rewind.php                        30-May-2024 18:01                2882
iteratoriterator.valid.php                         30-May-2024 18:01                3065
json.configuration.php                             30-May-2024 18:01                1277
json.constants.php                                 30-May-2024 18:01               17440
json.installation.php                              30-May-2024 18:01                1805
json.requirements.php                              30-May-2024 18:01                1258
json.resources.php                                 30-May-2024 18:01                1220
json.setup.php                                     30-May-2024 18:01                1596
jsonserializable.jsonserialize.php                 30-May-2024 18:01               12679
langref.php                                        30-May-2024 18:01               21053
language.attributes.classes.php                    30-May-2024 18:01                6781
language.attributes.overview.php                   30-May-2024 18:01               10585
language.attributes.php                            30-May-2024 18:01                1803
language.attributes.reflection.php                 30-May-2024 18:01                8332
language.attributes.syntax.php                     30-May-2024 18:01                6307
language.basic-syntax.comments.php                 30-May-2024 18:01                4044
language.basic-syntax.instruction-separation.php   30-May-2024 18:01                4390
language.basic-syntax.php                          30-May-2024 18:01                1709
language.basic-syntax.phpmode.php                  30-May-2024 18:01                4750
language.basic-syntax.phptags.php                  30-May-2024 18:01                5098
language.constants.magic.php                       30-May-2024 18:01                5964
language.constants.php                             30-May-2024 18:01                6548
language.constants.predefined.php                  30-May-2024 18:01                1632
language.constants.syntax.php                      30-May-2024 18:01               10997
language.control-structures.php                    30-May-2024 18:01                2798
language.enumerations.backed.php                   30-May-2024 18:01               10851
language.enumerations.basics.php                   30-May-2024 18:01                8655
language.enumerations.constants.php                30-May-2024 18:01                2461
language.enumerations.examples.php                 30-May-2024 18:01                7478
language.enumerations.expressions.php              30-May-2024 18:01                6782
language.enumerations.listing.php                  30-May-2024 18:01                2335
language.enumerations.methods.php                  30-May-2024 18:01               13823
language.enumerations.object-differences.inheri..> 30-May-2024 18:01                6188
language.enumerations.object-differences.php       30-May-2024 18:01                5002
language.enumerations.overview.php                 30-May-2024 18:01                2586
language.enumerations.php                          30-May-2024 18:01                2618
language.enumerations.serialization.php            30-May-2024 18:01                5080
language.enumerations.static-methods.php           30-May-2024 18:01                3322
language.enumerations.traits.php                   30-May-2024 18:01                4381
language.errors.basics.php                         30-May-2024 18:01                5525
language.errors.php                                30-May-2024 18:01                1892
language.errors.php7.php                           30-May-2024 18:01                5984
language.exceptions.extending.php                  30-May-2024 18:01               19783
language.exceptions.php                            30-May-2024 18:01               28112
language.expressions.php                           30-May-2024 18:01               16124
language.fibers.php                                30-May-2024 18:01                6838
language.functions.php                             30-May-2024 18:01                1998
language.generators.comparison.php                 30-May-2024 18:01                9172
language.generators.overview.php                   30-May-2024 18:01                9410
language.generators.php                            30-May-2024 18:01                1631
language.generators.syntax.php                     30-May-2024 18:01               24761
language.namespaces.basics.php                     30-May-2024 18:01               11362
language.namespaces.definition.php                 30-May-2024 18:01                4433
language.namespaces.definitionmultiple.php         30-May-2024 18:01                9084
language.namespaces.dynamic.php                    30-May-2024 18:01                8345
language.namespaces.fallback.php                   30-May-2024 18:01                6179
language.namespaces.faq.php                        30-May-2024 18:01               32589                     30-May-2024 18:01                2851
language.namespaces.importing.php                  30-May-2024 18:01               15239
language.namespaces.nested.php                     30-May-2024 18:01                2835
language.namespaces.nsconstants.php                30-May-2024 18:01                8846
language.namespaces.php                            30-May-2024 18:01                2374
language.namespaces.rationale.php                  30-May-2024 18:01                6667
language.namespaces.rules.php                      30-May-2024 18:01               13321
language.oop5.abstract.php                         30-May-2024 18:01               11017
language.oop5.anonymous.php                        30-May-2024 18:01               10686
language.oop5.autoload.php                         30-May-2024 18:01                6901
language.oop5.basic.php                            30-May-2024 18:01               50190
language.oop5.changelog.php                        30-May-2024 18:01               14072
language.oop5.cloning.php                          30-May-2024 18:01                9025
language.oop5.constants.php                        30-May-2024 18:01                9169
language.oop5.decon.php                            30-May-2024 18:01               29307                            30-May-2024 18:01                6118
language.oop5.inheritance.php                      30-May-2024 18:01               13644
language.oop5.interfaces.php                       30-May-2024 18:01               23522
language.oop5.iterations.php                       30-May-2024 18:01                5885
language.oop5.late-static-bindings.php             30-May-2024 18:01               15050
language.oop5.magic.php                            30-May-2024 18:01               44431
language.oop5.object-comparison.php                30-May-2024 18:01                8827
language.oop5.overloading.php                      30-May-2024 18:01               24533
language.oop5.paamayim-nekudotayim.php             30-May-2024 18:01                8775
language.oop5.php                                  30-May-2024 18:01                3422                       30-May-2024 18:01               27942
language.oop5.references.php                       30-May-2024 18:01                5897
language.oop5.serialization.php                    30-May-2024 18:01                7418
language.oop5.static.php                           30-May-2024 18:01                9432
language.oop5.traits.php                           30-May-2024 18:01               35461
language.oop5.variance.php                         30-May-2024 18:01               16153
language.oop5.visibility.php                       30-May-2024 18:01               24817
language.operators.arithmetic.php                  30-May-2024 18:01                5871
language.operators.array.php                       30-May-2024 18:01                9054
language.operators.assignment.php                  30-May-2024 18:01               11429
language.operators.bitwise.php                     30-May-2024 18:01               44712
language.operators.comparison.php                  30-May-2024 18:01               42958
language.operators.errorcontrol.php                30-May-2024 18:01                6054
language.operators.execution.php                   30-May-2024 18:01                3510
language.operators.increment.php                   30-May-2024 18:01               14444
language.operators.logical.php                     30-May-2024 18:01                7933
language.operators.php                             30-May-2024 18:01                4032
language.operators.precedence.php                  30-May-2024 18:01               19752
language.operators.string.php                      30-May-2024 18:01                3225
language.operators.type.php                        30-May-2024 18:01               18564
language.references.arent.php                      30-May-2024 18:01                3301
language.references.pass.php                       30-May-2024 18:01                6814
language.references.php                            30-May-2024 18:01                1963
language.references.return.php                     30-May-2024 18:01                7291                       30-May-2024 18:01                2516
language.references.unset.php                      30-May-2024 18:01                2404
language.references.whatare.php                    30-May-2024 18:01                2114
language.references.whatdo.php                     30-May-2024 18:01               18747
language.types.array.php                           30-May-2024 18:01              103503
language.types.boolean.php                         30-May-2024 18:01                9803
language.types.callable.php                        30-May-2024 18:01               12445
language.types.declarations.php                    30-May-2024 18:01               42918
language.types.enumerations.php                    30-May-2024 18:01                3656
language.types.float.php                           30-May-2024 18:01                9886
language.types.integer.php                         30-May-2024 18:01               20612
language.types.intro.php                           30-May-2024 18:01                8827
language.types.iterable.php                        30-May-2024 18:01                2962
language.types.mixed.php                           30-May-2024 18:01                1717
language.types.never.php                           30-May-2024 18:01                1936
language.types.null.php                            30-May-2024 18:01                3650
language.types.numeric-strings.php                 30-May-2024 18:01               10957
language.types.object.php                          30-May-2024 18:01                5600
language.types.php                                 30-May-2024 18:01                2792
language.types.relative-class-types.php            30-May-2024 18:01                2377
language.types.resource.php                        30-May-2024 18:01                3152
language.types.string.php                          30-May-2024 18:01               84564
language.types.type-juggling.php                   30-May-2024 18:01               26577
language.types.type-system.php                     30-May-2024 18:01                8418
language.types.value.php                           30-May-2024 18:01                2168
language.types.void.php                            30-May-2024 18:01                1966
language.variables.basics.php                      30-May-2024 18:01               14187
language.variables.external.php                    30-May-2024 18:01               18124
language.variables.php                             30-May-2024 18:01                1769
language.variables.predefined.php                  30-May-2024 18:01                3044
language.variables.scope.php                       30-May-2024 18:01               28523
language.variables.superglobals.php                30-May-2024 18:01                4450
language.variables.variable.php                    30-May-2024 18:01               10361
ldap.configuration.php                             30-May-2024 18:01                2455
ldap.constants.php                                 30-May-2024 18:01               33999
ldap.controls.php                                  30-May-2024 18:01                9938
ldap.examples-basic.php                            30-May-2024 18:01                8260
ldap.examples-controls.php                         30-May-2024 18:01               16250
ldap.examples.php                                  30-May-2024 18:01                1471
ldap.installation.php                              30-May-2024 18:01                2969
ldap.requirements.php                              30-May-2024 18:01                1543
ldap.resources.php                                 30-May-2024 18:01                1511
ldap.setup.php                                     30-May-2024 18:01                1625
ldap.using.php                                     30-May-2024 18:01                2379
libxml.configuration.php                           30-May-2024 18:01                1321
libxml.constants.php                               30-May-2024 18:01               13652
libxml.installation.php                            30-May-2024 18:01                1938
libxml.installation_old.php                        30-May-2024 18:01                2623
libxml.requirements.php                            30-May-2024 18:01                1377
libxml.resources.php                               30-May-2024 18:01                1234
libxml.setup.php                                   30-May-2024 18:01                1761
limititerator.construct.php                        30-May-2024 18:01                7348
limititerator.current.php                          30-May-2024 18:01                3579
limititerator.getposition.php                      30-May-2024 18:01                5781
limititerator.key.php                              30-May-2024 18:01                3629                             30-May-2024 18:01                3321
limititerator.rewind.php                           30-May-2024 18:01                3489                             30-May-2024 18:01                4140
limititerator.valid.php                            30-May-2024 18:01                3552
locale.acceptfromhttp.php                          30-May-2024 18:01                6260
locale.canonicalize.php                            30-May-2024 18:01                3227
locale.composelocale.php                           30-May-2024 18:01               13437
locale.filtermatches.php                           30-May-2024 18:01                9332
locale.getallvariants.php                          30-May-2024 18:01                6730
locale.getdefault.php                              30-May-2024 18:01                5893
locale.getdisplaylanguage.php                      30-May-2024 18:01                9932
locale.getdisplayname.php                          30-May-2024 18:01                9914
locale.getdisplayregion.php                        30-May-2024 18:01                9880
locale.getdisplayscript.php                        30-May-2024 18:01                9887
locale.getdisplayvariant.php                       30-May-2024 18:01                9926
locale.getkeywords.php                             30-May-2024 18:01                7342
locale.getprimarylanguage.php                      30-May-2024 18:01                6131
locale.getregion.php                               30-May-2024 18:01                6072
locale.getscript.php                               30-May-2024 18:01                5736
locale.lookup.php                                  30-May-2024 18:01               10219
locale.parselocale.php                             30-May-2024 18:01                7439
locale.setdefault.php                              30-May-2024 18:01                5403
lua.assign.php                                     30-May-2024 18:01                4675                                       30-May-2024 18:01                7562
lua.configuration.php                              30-May-2024 18:01                1270
lua.construct.php                                  30-May-2024 18:01                2445
lua.eval.php                                       30-May-2024 18:01                3826
lua.getversion.php                                 30-May-2024 18:01                2323
lua.include.php                                    30-May-2024 18:01                2749
lua.installation.php                               30-May-2024 18:01                2054
lua.registercallback.php                           30-May-2024 18:01                4619
lua.requirements.php                               30-May-2024 18:01                1309
lua.resources.php                                  30-May-2024 18:01                1214
lua.setup.php                                      30-May-2024 18:01                1583
luaclosure.invoke.php                              30-May-2024 18:01                4183
luasandbox.callfunction.php                        30-May-2024 18:01                5101
luasandbox.configuration.php                       30-May-2024 18:01                1319
luasandbox.disableprofiler.php                     30-May-2024 18:01                2907
luasandbox.enableprofiler.php                      30-May-2024 18:01                3533
luasandbox.examples-basic.php                      30-May-2024 18:01                6653
luasandbox.examples.php                            30-May-2024 18:01                1507
luasandbox.getcpuusage.php                         30-May-2024 18:01                3651
luasandbox.getmemoryusage.php                      30-May-2024 18:01                3228
luasandbox.getpeakmemoryusage.php                  30-May-2024 18:01                3278
luasandbox.getprofilerfunctionreport.php           30-May-2024 18:01                6035
luasandbox.getversioninfo.php                      30-May-2024 18:01                3141
luasandbox.installation.php                        30-May-2024 18:01                2120
luasandbox.loadbinary.php                          30-May-2024 18:01                3662
luasandbox.loadstring.php                          30-May-2024 18:01                5673
luasandbox.pauseusagetimer.php                     30-May-2024 18:01                9471
luasandbox.registerlibrary.php                     30-May-2024 18:01                6672
luasandbox.requirements.php                        30-May-2024 18:01                1795
luasandbox.resources.php                           30-May-2024 18:01                1279
luasandbox.setcpulimit.php                         30-May-2024 18:01                6194
luasandbox.setmemorylimit.php                      30-May-2024 18:01                5596
luasandbox.setup.php                               30-May-2024 18:01                1674
luasandbox.unpauseusagetimer.php                   30-May-2024 18:01                3203
luasandbox.wrapphpfunction.php                     30-May-2024 18:01                4400                        30-May-2024 18:01                8076
luasandboxfunction.construct.php                   30-May-2024 18:01                2721
luasandboxfunction.dump.php                        30-May-2024 18:01                2482
lzf.configuration.php                              30-May-2024 18:01                1270
lzf.constants.php                                  30-May-2024 18:01                1178
lzf.installation.php                               30-May-2024 18:01                2502
lzf.requirements.php                               30-May-2024 18:01                1230
lzf.resources.php                                  30-May-2024 18:01                1213
lzf.setup.php                                      30-May-2024 18:01                1604
mail.configuration.php                             30-May-2024 18:01                8386
mail.constants.php                                 30-May-2024 18:01                1187
mail.installation.php                              30-May-2024 18:01                1261
mail.requirements.php                              30-May-2024 18:01                1958
mail.resources.php                                 30-May-2024 18:01                1220
mail.setup.php                                     30-May-2024 18:01                1620
mailparse.configuration.php                        30-May-2024 18:01                2577
mailparse.constants.php                            30-May-2024 18:01                2425
mailparse.installation.php                         30-May-2024 18:01                2488
mailparse.requirements.php                         30-May-2024 18:01                1272
mailparse.resources.php                            30-May-2024 18:01                1578
mailparse.setup.php                                30-May-2024 18:01                1682
manual.php                                         30-May-2024 18:01                1290
math.configuration.php                             30-May-2024 18:01                1277
math.constants.php                                 30-May-2024 18:01                7327
math.installation.php                              30-May-2024 18:01                1261
math.requirements.php                              30-May-2024 18:01                1237
math.resources.php                                 30-May-2024 18:01                1220
math.setup.php                                     30-May-2024 18:01                1612
mbstring.configuration.php                         30-May-2024 18:01               16342
mbstring.constants.php                             30-May-2024 18:01                6871
mbstring.encodings.php                             30-May-2024 18:01               15453
mbstring.http.php                                  30-May-2024 18:01                5112
mbstring.installation.php                          30-May-2024 18:01                3352
mbstring.ja-basic.php                              30-May-2024 18:01                3730
mbstring.overload.php                              30-May-2024 18:01                7264
mbstring.php4.req.php                              30-May-2024 18:01                4039
mbstring.requirements.php                          30-May-2024 18:01                1265
mbstring.resources.php                             30-May-2024 18:01                1248
mbstring.setup.php                                 30-May-2024 18:01                1682
mbstring.supported-encodings.php                   30-May-2024 18:01                8221
mcrypt.ciphers.php                                 30-May-2024 18:01                6475
mcrypt.configuration.php                           30-May-2024 18:01                3772
mcrypt.constants.php                               30-May-2024 18:01                6679
mcrypt.installation.php                            30-May-2024 18:01                1789
mcrypt.requirements.php                            30-May-2024 18:01                2168
mcrypt.resources.php                               30-May-2024 18:01                1353
mcrypt.setup.php                                   30-May-2024 18:01                1653
memcache.add.php                                   30-May-2024 18:01                7281
memcache.addserver.php                             30-May-2024 18:01               13832
memcache.close.php                                 30-May-2024 18:01                5221
memcache.connect.php                               30-May-2024 18:01                7489
memcache.constants.php                             30-May-2024 18:01                5223
memcache.decrement.php                             30-May-2024 18:01                7307
memcache.delete.php                                30-May-2024 18:01                6579
memcache.examples-overview.php                     30-May-2024 18:01                6543
memcache.examples.php                              30-May-2024 18:01                1464
memcache.flush.php                                 30-May-2024 18:01                4639
memcache.get.php                                   30-May-2024 18:01                8877
memcache.getextendedstats.php                      30-May-2024 18:01                8260
memcache.getserverstatus.php                       30-May-2024 18:01                6215
memcache.getstats.php                              30-May-2024 18:01                4873
memcache.getversion.php                            30-May-2024 18:01                5092
memcache.increment.php                             30-May-2024 18:01                7102
memcache.ini.php                                   30-May-2024 18:01               11183
memcache.installation.php                          30-May-2024 18:01                2130
memcache.pconnect.php                              30-May-2024 18:01                6329
memcache.replace.php                               30-May-2024 18:01                7384
memcache.requirements.php                          30-May-2024 18:01                1423
memcache.resources.php                             30-May-2024 18:01                1313
memcache.set.php                                   30-May-2024 18:01                9746
memcache.setcompressthreshold.php                  30-May-2024 18:01                6076
memcache.setserverparams.php                       30-May-2024 18:01               11247
memcache.setup.php                                 30-May-2024 18:01                1670
memcached.add.php                                  30-May-2024 18:01                4737
memcached.addbykey.php                             30-May-2024 18:01                5769
memcached.addserver.php                            30-May-2024 18:01                7723
memcached.addservers.php                           30-May-2024 18:01                5483
memcached.append.php                               30-May-2024 18:01                7573
memcached.appendbykey.php                          30-May-2024 18:01                5320
memcached.callbacks.php                            30-May-2024 18:01                1548               30-May-2024 18:01                4381
memcached.callbacks.result.php                     30-May-2024 18:01                4889
memcached.cas.php                                  30-May-2024 18:01                9514
memcached.casbykey.php                             30-May-2024 18:01                6095
memcached.configuration.php                        30-May-2024 18:01               28346
memcached.constants.php                            30-May-2024 18:01               28792
memcached.construct.php                            30-May-2024 18:01                5747
memcached.decrement.php                            30-May-2024 18:01                9203
memcached.decrementbykey.php                       30-May-2024 18:01                6109
memcached.delete.php                               30-May-2024 18:01                5760
memcached.deletebykey.php                          30-May-2024 18:01                5776
memcached.deletemulti.php                          30-May-2024 18:01                4981
memcached.deletemultibykey.php                     30-May-2024 18:01                6024
memcached.expiration.php                           30-May-2024 18:01                1953
memcached.fetch.php                                30-May-2024 18:01                6792
memcached.fetchall.php                             30-May-2024 18:01                6618
memcached.flush.php                                30-May-2024 18:01                4769
memcached.get.php                                  30-May-2024 18:01               10501
memcached.getallkeys.php                           30-May-2024 18:01                3106
memcached.getbykey.php                             30-May-2024 18:01                6734
memcached.getdelayed.php                           30-May-2024 18:01                8922
memcached.getdelayedbykey.php                      30-May-2024 18:01                5941
memcached.getmulti.php                             30-May-2024 18:01               20930
memcached.getmultibykey.php                        30-May-2024 18:01                5793
memcached.getoption.php                            30-May-2024 18:01                5208
memcached.getresultcode.php                        30-May-2024 18:01                4293
memcached.getresultmessage.php                     30-May-2024 18:01                4749
memcached.getserverbykey.php                       30-May-2024 18:01                7550
memcached.getserverlist.php                        30-May-2024 18:01                4663
memcached.getstats.php                             30-May-2024 18:01                5805
memcached.getversion.php                           30-May-2024 18:01                4042
memcached.increment.php                            30-May-2024 18:01                8533
memcached.incrementbykey.php                       30-May-2024 18:01                6042
memcached.installation.php                         30-May-2024 18:01                2622
memcached.ispersistent.php                         30-May-2024 18:01                3043
memcached.ispristine.php                           30-May-2024 18:01                2970
memcached.prepend.php                              30-May-2024 18:01                7583
memcached.prependbykey.php                         30-May-2024 18:01                5328
memcached.quit.php                                 30-May-2024 18:01                2506
memcached.replace.php                              30-May-2024 18:01                4809
memcached.replacebykey.php                         30-May-2024 18:01                5856
memcached.requirements.php                         30-May-2024 18:01                1559
memcached.resetserverlist.php                      30-May-2024 18:01                3217
memcached.resources.php                            30-May-2024 18:01                1255
memcached.sessions.php                             30-May-2024 18:01                2452
memcached.set.php                                  30-May-2024 18:01                9275
memcached.setbykey.php                             30-May-2024 18:01                7188
memcached.setmulti.php                             30-May-2024 18:01                6343
memcached.setmultibykey.php                        30-May-2024 18:01                5135
memcached.setoption.php                            30-May-2024 18:01                7397
memcached.setoptions.php                           30-May-2024 18:01                7013
memcached.setsaslauthdata.php                      30-May-2024 18:01                3567
memcached.setup.php                                30-May-2024 18:01                1682
memcached.touch.php                                30-May-2024 18:01                3847
memcached.touchbykey.php                           30-May-2024 18:01                4834
messageformatter.create.php                        30-May-2024 18:01               11072
messageformatter.format.php                        30-May-2024 18:01                9747
messageformatter.formatmessage.php                 30-May-2024 18:01               14511
messageformatter.geterrorcode.php                  30-May-2024 18:01                4009
messageformatter.geterrormessage.php               30-May-2024 18:01                7666
messageformatter.getlocale.php                     30-May-2024 18:01                5523
messageformatter.getpattern.php                    30-May-2024 18:01               10133
messageformatter.parse.php                         30-May-2024 18:01                9860
messageformatter.parsemessage.php                  30-May-2024 18:01               10057
messageformatter.setpattern.php                    30-May-2024 18:01               10671
mhash.configuration.php                            30-May-2024 18:01                1284
mhash.constants.php                                30-May-2024 18:01                7248
mhash.examples.php                                 30-May-2024 18:01                3357
mhash.installation.php                             30-May-2024 18:01                1633
mhash.requirements.php                             30-May-2024 18:01                1366
mhash.resources.php                                30-May-2024 18:01                1227
mhash.setup.php                                    30-May-2024 18:01                1630
migration56.changed-functions.php                  30-May-2024 18:01                7161
migration56.constants.php                          30-May-2024 18:01                6813
migration56.deprecated.php                         30-May-2024 18:01                6483
migration56.extensions.php                         30-May-2024 18:01                4610
migration56.incompatible.php                       30-May-2024 18:01                8967                       30-May-2024 18:01               29713                      30-May-2024 18:01                7578
migration56.openssl.php                            30-May-2024 18:01               28048
migration56.php                                    30-May-2024 18:01                2585
migration70.changed-functions.php                  30-May-2024 18:01                5772
migration70.classes.php                            30-May-2024 18:01                3943
migration70.constants.php                          30-May-2024 18:01                9544
migration70.deprecated.php                         30-May-2024 18:01                5858
migration70.incompatible.php                       30-May-2024 18:01               65566                       30-May-2024 18:01               42995                      30-May-2024 18:01                7419
migration70.other-changes.php                      30-May-2024 18:01                3788
migration70.php                                    30-May-2024 18:01                2956
migration70.removed-exts-sapis.php                 30-May-2024 18:01                3226
migration70.sapi-changes.php                       30-May-2024 18:01                2139
migration71.changed-functions.php                  30-May-2024 18:01                8218
migration71.constants.php                          30-May-2024 18:01                8833
migration71.deprecated.php                         30-May-2024 18:01                2370
migration71.incompatible.php                       30-May-2024 18:01               34613                       30-May-2024 18:01               28015                      30-May-2024 18:01                5099
migration71.other-changes.php                      30-May-2024 18:01                9313
migration71.php                                    30-May-2024 18:01                2558                    30-May-2024 18:01                7852
migration72.constants.php                          30-May-2024 18:01               32021
migration72.deprecated.php                         30-May-2024 18:01               11255
migration72.incompatible.php                       30-May-2024 18:01               20953                       30-May-2024 18:01               19962                      30-May-2024 18:01               24442
migration72.other-changes.php                      30-May-2024 18:01                6212
migration72.php                                    30-May-2024 18:01                2458
migration73.constants.php                          30-May-2024 18:01               26197
migration73.deprecated.php                         30-May-2024 18:01                9193
migration73.incompatible.php                       30-May-2024 18:01               19414                       30-May-2024 18:01               18264                      30-May-2024 18:01                7476
migration73.other-changes.php                      30-May-2024 18:01               17592
migration73.php                                    30-May-2024 18:01                2584                    30-May-2024 18:01                1958
migration74.constants.php                          30-May-2024 18:01                7844
migration74.deprecated.php                         30-May-2024 18:01               16437
migration74.incompatible.php                       30-May-2024 18:01               19764                        30-May-2024 18:01                1546                       30-May-2024 18:01               23012                      30-May-2024 18:01                3766
migration74.other-changes.php                      30-May-2024 18:01               22487
migration74.php                                    30-May-2024 18:01                2808
migration74.removed-extensions.php                 30-May-2024 18:01                2005                    30-May-2024 18:01                4101
migration80.deprecated.php                         30-May-2024 18:01               19354
migration80.incompatible.php                       30-May-2024 18:01              106036                       30-May-2024 18:01               34737
migration80.other-changes.php                      30-May-2024 18:01               15738
migration80.php                                    30-May-2024 18:01                2421
migration81.constants.php                          30-May-2024 18:01                8374
migration81.deprecated.php                         30-May-2024 18:01               20216
migration81.incompatible.php                       30-May-2024 18:01               24531                        30-May-2024 18:01                2180                       30-May-2024 18:01               25299                      30-May-2024 18:01                8531
migration81.other-changes.php                      30-May-2024 18:01               10661
migration81.php                                    30-May-2024 18:01                2657
migration82.constants.php                          30-May-2024 18:01               22242
migration82.deprecated.php                         30-May-2024 18:01                6232
migration82.incompatible.php                       30-May-2024 18:01               10253                       30-May-2024 18:01                7854                      30-May-2024 18:01                4329
migration82.other-changes.php                      30-May-2024 18:01               26684
migration82.php                                    30-May-2024 18:01                2720                    30-May-2024 18:01                2498
migration83.constants.php                          30-May-2024 18:01               15585
migration83.deprecated.php                         30-May-2024 18:01                8176
migration83.incompatible.php                       30-May-2024 18:01               16201                        30-May-2024 18:01                3442                       30-May-2024 18:01                8003                      30-May-2024 18:01                7359
migration83.other-changes.php                      30-May-2024 18:01               35497
migration83.php                                    30-May-2024 18:01                2862                    30-May-2024 18:01                1474
misc.configuration.php                             30-May-2024 18:01                6165
misc.constants.php                                 30-May-2024 18:01                2644
misc.installation.php                              30-May-2024 18:01                1261
misc.requirements.php                              30-May-2024 18:01                1237
misc.resources.php                                 30-May-2024 18:01                1220
misc.setup.php                                     30-May-2024 18:01                1604
mongodb-bson-binary.construct.php                  30-May-2024 18:01                8035
mongodb-bson-binary.getdata.php                    30-May-2024 18:01                4513
mongodb-bson-binary.gettype.php                    30-May-2024 18:01                4495
mongodb-bson-binary.jsonserialize.php              30-May-2024 18:01                5475
mongodb-bson-binary.serialize.php                  30-May-2024 18:01                3571
mongodb-bson-binary.tostring.php                   30-May-2024 18:01                4267
mongodb-bson-binary.unserialize.php                30-May-2024 18:01                4405
mongodb-bson-binaryinterface.getdata.php           30-May-2024 18:01                2881
mongodb-bson-binaryinterface.gettype.php           30-May-2024 18:01                2891
mongodb-bson-binaryinterface.tostring.php          30-May-2024 18:01                3350
mongodb-bson-dbpointer.construct.php               30-May-2024 18:01                2707
mongodb-bson-dbpointer.jsonserialize.php           30-May-2024 18:01                5544
mongodb-bson-dbpointer.serialize.php               30-May-2024 18:01                3646
mongodb-bson-dbpointer.tostring.php                30-May-2024 18:01                2723
mongodb-bson-dbpointer.unserialize.php             30-May-2024 18:01                3904
mongodb-bson-decimal128.construct.php              30-May-2024 18:01                5884
mongodb-bson-decimal128.jsonserialize.php          30-May-2024 18:01                5565
mongodb-bson-decimal128.serialize.php              30-May-2024 18:01                3671
mongodb-bson-decimal128.tostring.php               30-May-2024 18:01                4605
mongodb-bson-decimal128.unserialize.php            30-May-2024 18:01                4497
mongodb-bson-decimal128interface.tostring.php      30-May-2024 18:01                3044
mongodb-bson-document.construct.php                30-May-2024 18:01                3321
mongodb-bson-document.frombson.php                 30-May-2024 18:01                4124
mongodb-bson-document.fromjson.php                 30-May-2024 18:01                4637
mongodb-bson-document.fromphp.php                  30-May-2024 18:01                4359
mongodb-bson-document.get.php                      30-May-2024 18:01                4331
mongodb-bson-document.getiterator.php              30-May-2024 18:01                3597
mongodb-bson-document.has.php                      30-May-2024 18:01                3860
mongodb-bson-document.offsetexists.php             30-May-2024 18:01                3557
mongodb-bson-document.offsetget.php                30-May-2024 18:01                4435
mongodb-bson-document.offsetset.php                30-May-2024 18:01                3632
mongodb-bson-document.offsetunset.php              30-May-2024 18:01                3241
mongodb-bson-document.serialize.php                30-May-2024 18:01                3651
mongodb-bson-document.tocanonicalextendedjson.php  30-May-2024 18:01               12788
mongodb-bson-document.tophp.php                    30-May-2024 18:01                5650
mongodb-bson-document.torelaxedextendedjson.php    30-May-2024 18:01               12505
mongodb-bson-document.tostring.php                 30-May-2024 18:01                2797
mongodb-bson-document.unserialize.php              30-May-2024 18:01                4453
mongodb-bson-int64.construct.php                   30-May-2024 18:01                4835
mongodb-bson-int64.jsonserialize.php               30-May-2024 18:01                5220
mongodb-bson-int64.serialize.php                   30-May-2024 18:01                3548
mongodb-bson-int64.tostring.php                    30-May-2024 18:01                3923
mongodb-bson-int64.unserialize.php                 30-May-2024 18:01                4376
mongodb-bson-iterator.construct.php                30-May-2024 18:01                3409
mongodb-bson-iterator.current.php                  30-May-2024 18:01                3695
mongodb-bson-iterator.key.php                      30-May-2024 18:01                3699                     30-May-2024 18:01                2466
mongodb-bson-iterator.rewind.php                   30-May-2024 18:01                2492
mongodb-bson-iterator.valid.php                    30-May-2024 18:01                2879
mongodb-bson-javascript.construct.php              30-May-2024 18:01                7346
mongodb-bson-javascript.getcode.php                30-May-2024 18:01                4485
mongodb-bson-javascript.getscope.php               30-May-2024 18:01                5461
mongodb-bson-javascript.jsonserialize.php          30-May-2024 18:01                5561
mongodb-bson-javascript.serialize.php              30-May-2024 18:01                3671
mongodb-bson-javascript.tostring.php               30-May-2024 18:01                4261
mongodb-bson-javascript.unserialize.php            30-May-2024 18:01                4489
mongodb-bson-javascriptinterface.getcode.php       30-May-2024 18:01                2975
mongodb-bson-javascriptinterface.getscope.php      30-May-2024 18:01                3140
mongodb-bson-javascriptinterface.tostring.php      30-May-2024 18:01                3448
mongodb-bson-maxkey.construct.php                  30-May-2024 18:01                3741
mongodb-bson-maxkey.jsonserialize.php              30-May-2024 18:01                5481
mongodb-bson-maxkey.serialize.php                  30-May-2024 18:01                3575
mongodb-bson-maxkey.unserialize.php                30-May-2024 18:01                3837
mongodb-bson-minkey.construct.php                  30-May-2024 18:01                3741
mongodb-bson-minkey.jsonserialize.php              30-May-2024 18:01                5481
mongodb-bson-minkey.serialize.php                  30-May-2024 18:01                3575
mongodb-bson-minkey.unserialize.php                30-May-2024 18:01                3841
mongodb-bson-objectid.construct.php                30-May-2024 18:01                5360
mongodb-bson-objectid.gettimestamp.php             30-May-2024 18:01                5674
mongodb-bson-objectid.jsonserialize.php            30-May-2024 18:01                5527
mongodb-bson-objectid.serialize.php                30-May-2024 18:01                3623
mongodb-bson-objectid.tostring.php                 30-May-2024 18:01                4251
mongodb-bson-objectid.unserialize.php              30-May-2024 18:01                4443
mongodb-bson-objectidinterface.gettimestamp.php    30-May-2024 18:01                3044
mongodb-bson-objectidinterface.tostring.php        30-May-2024 18:01                3028
mongodb-bson-packedarray.construct.php             30-May-2024 18:01                2941
mongodb-bson-packedarray.fromphp.php               30-May-2024 18:01                4040
mongodb-bson-packedarray.get.php                   30-May-2024 18:01                4379
mongodb-bson-packedarray.getiterator.php           30-May-2024 18:01                3651
mongodb-bson-packedarray.has.php                   30-May-2024 18:01                3914
mongodb-bson-packedarray.offsetexists.php          30-May-2024 18:01                3613
mongodb-bson-packedarray.offsetget.php             30-May-2024 18:01                4601
mongodb-bson-packedarray.offsetset.php             30-May-2024 18:01                3686
mongodb-bson-packedarray.offsetunset.php           30-May-2024 18:01                3295
mongodb-bson-packedarray.serialize.php             30-May-2024 18:01                3683
mongodb-bson-packedarray.tophp.php                 30-May-2024 18:01                4701
mongodb-bson-packedarray.tostring.php              30-May-2024 18:01                2813
mongodb-bson-packedarray.unserialize.php           30-May-2024 18:01                4509
mongodb-bson-persistable.bsonserialize.php         30-May-2024 18:01                6181
mongodb-bson-regex.construct.php                   30-May-2024 18:01                7110
mongodb-bson-regex.getflags.php                    30-May-2024 18:01                4596
mongodb-bson-regex.getpattern.php                  30-May-2024 18:01                4458
mongodb-bson-regex.jsonserialize.php               30-May-2024 18:01                5460
mongodb-bson-regex.serialize.php                   30-May-2024 18:01                3546
mongodb-bson-regex.tostring.php                    30-May-2024 18:01                3958
mongodb-bson-regex.unserialize.php                 30-May-2024 18:01                4380
mongodb-bson-regexinterface.getflags.php           30-May-2024 18:01                2880
mongodb-bson-regexinterface.getpattern.php         30-May-2024 18:01                2923
mongodb-bson-regexinterface.tostring.php           30-May-2024 18:01                2954
mongodb-bson-serializable.bsonserialize.php        30-May-2024 18:01               16703
mongodb-bson-symbol.construct.php                  30-May-2024 18:01                2647
mongodb-bson-symbol.jsonserialize.php              30-May-2024 18:01                5481
mongodb-bson-symbol.serialize.php                  30-May-2024 18:01                3571
mongodb-bson-symbol.tostring.php                   30-May-2024 18:01                2701
mongodb-bson-symbol.unserialize.php                30-May-2024 18:01                3843
mongodb-bson-timestamp.construct.php               30-May-2024 18:01                4918
mongodb-bson-timestamp.getincrement.php            30-May-2024 18:01                4473
mongodb-bson-timestamp.gettimestamp.php            30-May-2024 18:01                4458
mongodb-bson-timestamp.jsonserialize.php           30-May-2024 18:01                5548
mongodb-bson-timestamp.serialize.php               30-May-2024 18:01                3646
mongodb-bson-timestamp.tostring.php                30-May-2024 18:01                4093
mongodb-bson-timestamp.unserialize.php             30-May-2024 18:01                4476
mongodb-bson-timestampinterface.getincrement.php   30-May-2024 18:01                3408
mongodb-bson-timestampinterface.gettimestamp.php   30-May-2024 18:01                3423
mongodb-bson-timestampinterface.tostring.php       30-May-2024 18:01                3046
mongodb-bson-undefined.construct.php               30-May-2024 18:01                2707
mongodb-bson-undefined.jsonserialize.php           30-May-2024 18:01                5544
mongodb-bson-undefined.serialize.php               30-May-2024 18:01                3646
mongodb-bson-undefined.tostring.php                30-May-2024 18:01                2723
mongodb-bson-undefined.unserialize.php             30-May-2024 18:01                3905
mongodb-bson-unserializable.bsonunserialize.php    30-May-2024 18:01                7133
mongodb-bson-utcdatetime.construct.php             30-May-2024 18:01                8250
mongodb-bson-utcdatetime.jsonserialize.php         30-May-2024 18:01                5586
mongodb-bson-utcdatetime.serialize.php             30-May-2024 18:01                3698
mongodb-bson-utcdatetime.todatetime.php            30-May-2024 18:01                5927
mongodb-bson-utcdatetime.tostring.php              30-May-2024 18:01                4056
mongodb-bson-utcdatetime.unserialize.php           30-May-2024 18:01                4508
mongodb-bson-utcdatetimeinterface.todatetime.php   30-May-2024 18:01                3323
mongodb-bson-utcdatetimeinterface.tostring.php     30-May-2024 18:01                3062
mongodb-driver-bulkwrite.construct.php             30-May-2024 18:01               18820
mongodb-driver-bulkwrite.count.php                 30-May-2024 18:01                7032
mongodb-driver-bulkwrite.delete.php                30-May-2024 18:01               12409
mongodb-driver-bulkwrite.insert.php                30-May-2024 18:01                9696
mongodb-driver-bulkwrite.update.php                30-May-2024 18:01               16019
mongodb-driver-clientencryption.addkeyaltname.php  30-May-2024 18:01                5701
mongodb-driver-clientencryption.construct.php      30-May-2024 18:01               11678
mongodb-driver-clientencryption.createdatakey.php  30-May-2024 18:01               11320
mongodb-driver-clientencryption.decrypt.php        30-May-2024 18:01                4273
mongodb-driver-clientencryption.deletekey.php      30-May-2024 18:01                4445
mongodb-driver-clientencryption.encrypt.php        30-May-2024 18:01               12944
mongodb-driver-clientencryption.encryptexpressi..> 30-May-2024 18:01               14657
mongodb-driver-clientencryption.getkey.php         30-May-2024 18:01                4578
mongodb-driver-clientencryption.getkeybyaltname..> 30-May-2024 18:01                5171
mongodb-driver-clientencryption.getkeys.php        30-May-2024 18:01                4012
mongodb-driver-clientencryption.removekeyaltnam..> 30-May-2024 18:01                5766
mongodb-driver-clientencryption.rewrapmanydatak..> 30-May-2024 18:01               12590
mongodb-driver-command.construct.php               30-May-2024 18:01               14338
mongodb-driver-commandexception.getresultdocume..> 30-May-2024 18:01                3296
mongodb-driver-cursor.construct.php                30-May-2024 18:01                3381
mongodb-driver-cursor.current.php                  30-May-2024 18:01                3144
mongodb-driver-cursor.getid.php                    30-May-2024 18:01                7698
mongodb-driver-cursor.getserver.php                30-May-2024 18:01                7591
mongodb-driver-cursor.isdead.php                   30-May-2024 18:01               10722
mongodb-driver-cursor.key.php                      30-May-2024 18:01                2709                     30-May-2024 18:01                3676
mongodb-driver-cursor.rewind.php                   30-May-2024 18:01                4118
mongodb-driver-cursor.settypemap.php               30-May-2024 18:01                8075
mongodb-driver-cursor.toarray.php                  30-May-2024 18:01                7784
mongodb-driver-cursor.valid.php                    30-May-2024 18:01                2904
mongodb-driver-cursorid.construct.php              30-May-2024 18:01                2869
mongodb-driver-cursorid.serialize.php              30-May-2024 18:01                3669
mongodb-driver-cursorid.tostring.php               30-May-2024 18:01                7047
mongodb-driver-cursorid.unserialize.php            30-May-2024 18:01                4515
mongodb-driver-cursorinterface.getid.php           30-May-2024 18:01                4091
mongodb-driver-cursorinterface.getserver.php       30-May-2024 18:01                4192
mongodb-driver-cursorinterface.isdead.php          30-May-2024 18:01                4155
mongodb-driver-cursorinterface.settypemap.php      30-May-2024 18:01                4202
mongodb-driver-cursorinterface.toarray.php         30-May-2024 18:01                4054
mongodb-driver-manager.addsubscriber.php           30-May-2024 18:01                5624
mongodb-driver-manager.construct.php               30-May-2024 18:01               80600
mongodb-driver-manager.createclientencryption.php  30-May-2024 18:01               13055
mongodb-driver-manager.executebulkwrite.php        30-May-2024 18:01               23489
mongodb-driver-manager.executecommand.php          30-May-2024 18:01               25261
mongodb-driver-manager.executequery.php            30-May-2024 18:01               16704
mongodb-driver-manager.executereadcommand.php      30-May-2024 18:01               10358
mongodb-driver-manager.executereadwritecommand.php 30-May-2024 18:01               11458
mongodb-driver-manager.executewritecommand.php     30-May-2024 18:01               11548
mongodb-driver-manager.getencryptedfieldsmap.php   30-May-2024 18:01                3989
mongodb-driver-manager.getreadconcern.php          30-May-2024 18:01                5995
mongodb-driver-manager.getreadpreference.php       30-May-2024 18:01                6590
mongodb-driver-manager.getservers.php              30-May-2024 18:01                8034
mongodb-driver-manager.getwriteconcern.php         30-May-2024 18:01                6048
mongodb-driver-manager.removesubscriber.php        30-May-2024 18:01                5016
mongodb-driver-manager.selectserver.php            30-May-2024 18:01                7346
mongodb-driver-manager.startsession.php            30-May-2024 18:01               12710> 30-May-2024 18:01                3789> 30-May-2024 18:01                3716> 30-May-2024 18:01                3888> 30-May-2024 18:01                3717> 30-May-2024 18:01                4918> 30-May-2024 18:01                4108> 30-May-2024 18:01                4344> 30-May-2024 18:01                4270> 30-May-2024 18:01                4113> 30-May-2024 18:01                3897
mongodb-driver-monitoring-commandstartedevent.g..> 30-May-2024 18:01                4115
mongodb-driver-monitoring-commandstartedevent.g..> 30-May-2024 18:01                3825
mongodb-driver-monitoring-commandstartedevent.g..> 30-May-2024 18:01                3727
mongodb-driver-monitoring-commandstartedevent.g..> 30-May-2024 18:01                5227
mongodb-driver-monitoring-commandstartedevent.g..> 30-May-2024 18:01                4805
mongodb-driver-monitoring-commandstartedevent.g..> 30-May-2024 18:01                4561
mongodb-driver-monitoring-commandstartedevent.g..> 30-May-2024 18:01                4133
mongodb-driver-monitoring-commandstartedevent.g..> 30-May-2024 18:01                3917> 30-May-2024 18:01                4995> 30-May-2024 18:01                5045> 30-May-2024 18:01                5058
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                3846
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                3773
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                3957
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                5005
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                4165
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                4407
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                4775
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                4173
mongodb-driver-monitoring-commandsucceededevent..> 30-May-2024 18:01                3943
mongodb-driver-monitoring-logsubscriber.log.php    30-May-2024 18:01                4725
mongodb-driver-monitoring-sdamsubscriber.server..> 30-May-2024 18:01                4878
mongodb-driver-monitoring-sdamsubscriber.server..> 30-May-2024 18:01                4848
mongodb-driver-monitoring-sdamsubscriber.server..> 30-May-2024 18:01                5415
mongodb-driver-monitoring-sdamsubscriber.server..> 30-May-2024 18:01                5460
mongodb-driver-monitoring-sdamsubscriber.server..> 30-May-2024 18:01                5491
mongodb-driver-monitoring-sdamsubscriber.server..> 30-May-2024 18:01                4878
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-May-2024 18:01                4953
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-May-2024 18:01                4890
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-May-2024 18:01                4873> 30-May-2024 18:01                3262> 30-May-2024 18:01                3578> 30-May-2024 18:01                3330> 30-May-2024 18:01                3655> 30-May-2024 18:01                3378
mongodb-driver-monitoring-serverclosedevent.get..> 30-May-2024 18:01                3224
mongodb-driver-monitoring-serverclosedevent.get..> 30-May-2024 18:01                3274
mongodb-driver-monitoring-serverclosedevent.get..> 30-May-2024 18:01                3334
mongodb-driver-monitoring-serverheartbeatfailed..> 30-May-2024 18:01                3710
mongodb-driver-monitoring-serverheartbeatfailed..> 30-May-2024 18:01                3562
mongodb-driver-monitoring-serverheartbeatfailed..> 30-May-2024 18:01                3399
mongodb-driver-monitoring-serverheartbeatfailed..> 30-May-2024 18:01                3428
mongodb-driver-monitoring-serverheartbeatfailed..> 30-May-2024 18:01                3784
mongodb-driver-monitoring-serverheartbeatstarte..> 30-May-2024 18:01                3404
mongodb-driver-monitoring-serverheartbeatstarte..> 30-May-2024 18:01                3446
mongodb-driver-monitoring-serverheartbeatstarte..> 30-May-2024 18:01                3804
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-May-2024 18:01                3762
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-May-2024 18:01                3471
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-May-2024 18:01                3480
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-May-2024 18:01                4302
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-May-2024 18:01                3820> 30-May-2024 18:01                3242> 30-May-2024 18:01                3292> 30-May-2024 18:01                3366
mongodb-driver-monitoring-topologychangedevent...> 30-May-2024 18:01                3647
mongodb-driver-monitoring-topologychangedevent...> 30-May-2024 18:01                3725
mongodb-driver-monitoring-topologychangedevent...> 30-May-2024 18:01                3386
mongodb-driver-monitoring-topologyclosedevent.g..> 30-May-2024 18:01                3331
mongodb-driver-monitoring-topologyopeningevent...> 30-May-2024 18:01                3341
mongodb-driver-query.construct.php                 30-May-2024 18:01               33277
mongodb-driver-readconcern.bsonserialize.php       30-May-2024 18:01                6885
mongodb-driver-readconcern.construct.php           30-May-2024 18:01                5798
mongodb-driver-readconcern.getlevel.php            30-May-2024 18:01                5890
mongodb-driver-readconcern.isdefault.php           30-May-2024 18:01                8164
mongodb-driver-readconcern.serialize.php           30-May-2024 18:01                3746
mongodb-driver-readconcern.unserialize.php         30-May-2024 18:01                4566
mongodb-driver-readpreference.bsonserialize.php    30-May-2024 18:01               10536
mongodb-driver-readpreference.construct.php        30-May-2024 18:01               18532
mongodb-driver-readpreference.gethedge.php         30-May-2024 18:01                3501
mongodb-driver-readpreference.getmaxstalenessse..> 30-May-2024 18:01                8262
mongodb-driver-readpreference.getmode.php          30-May-2024 18:01                7586
mongodb-driver-readpreference.getmodestring.php    30-May-2024 18:01                7792
mongodb-driver-readpreference.gettagsets.php       30-May-2024 18:01                8147
mongodb-driver-readpreference.serialize.php        30-May-2024 18:01                3823
mongodb-driver-readpreference.unserialize.php      30-May-2024 18:01                4645
mongodb-driver-runtimeexception.haserrorlabel.php  30-May-2024 18:01                4315
mongodb-driver-server.construct.php                30-May-2024 18:01                3413
mongodb-driver-server.executebulkwrite.php         30-May-2024 18:01               11812
mongodb-driver-server.executecommand.php           30-May-2024 18:01               13692
mongodb-driver-server.executequery.php             30-May-2024 18:01                9173
mongodb-driver-server.executereadcommand.php       30-May-2024 18:01               11033
mongodb-driver-server.executereadwritecommand.php  30-May-2024 18:01               12050
mongodb-driver-server.executewritecommand.php      30-May-2024 18:01               12106
mongodb-driver-server.gethost.php                  30-May-2024 18:01                5553
mongodb-driver-server.getinfo.php                  30-May-2024 18:01               10699
mongodb-driver-server.getlatency.php               30-May-2024 18:01                7211
mongodb-driver-server.getport.php                  30-May-2024 18:01                5595
mongodb-driver-server.getserverdescription.php     30-May-2024 18:01                3502
mongodb-driver-server.gettags.php                  30-May-2024 18:01                3862
mongodb-driver-server.gettype.php                  30-May-2024 18:01                3898
mongodb-driver-server.isarbiter.php                30-May-2024 18:01                3715
mongodb-driver-server.ishidden.php                 30-May-2024 18:01                3709
mongodb-driver-server.ispassive.php                30-May-2024 18:01                3777
mongodb-driver-server.isprimary.php                30-May-2024 18:01                3722
mongodb-driver-server.issecondary.php              30-May-2024 18:01                3757
mongodb-driver-serverapi.bsonserialize.php         30-May-2024 18:01                3384
mongodb-driver-serverapi.construct.php             30-May-2024 18:01                5254
mongodb-driver-serverapi.serialize.php             30-May-2024 18:01                3699
mongodb-driver-serverapi.unserialize.php           30-May-2024 18:01                4533
mongodb-driver-serverdescription.gethellorespon..> 30-May-2024 18:01                5276
mongodb-driver-serverdescription.gethost.php       30-May-2024 18:01                3524
mongodb-driver-serverdescription.getlastupdatet..> 30-May-2024 18:01                3680
mongodb-driver-serverdescription.getport.php       30-May-2024 18:01                3579
mongodb-driver-serverdescription.getroundtripti..> 30-May-2024 18:01                3978
mongodb-driver-serverdescription.gettype.php       30-May-2024 18:01                3914
mongodb-driver-session.aborttransaction.php        30-May-2024 18:01                4288
mongodb-driver-session.advanceclustertime.php      30-May-2024 18:01                4962
mongodb-driver-session.advanceoperationtime.php    30-May-2024 18:01                4902
mongodb-driver-session.committransaction.php       30-May-2024 18:01                5644
mongodb-driver-session.construct.php               30-May-2024 18:01                2936
mongodb-driver-session.endsession.php              30-May-2024 18:01                4423
mongodb-driver-session.getclustertime.php          30-May-2024 18:01                4052
mongodb-driver-session.getlogicalsessionid.php     30-May-2024 18:01                3212
mongodb-driver-session.getoperationtime.php        30-May-2024 18:01                4132
mongodb-driver-session.getserver.php               30-May-2024 18:01                4027
mongodb-driver-session.gettransactionoptions.php   30-May-2024 18:01                3907
mongodb-driver-session.gettransactionstate.php     30-May-2024 18:01                3811
mongodb-driver-session.isdirty.php                 30-May-2024 18:01                3097
mongodb-driver-session.isintransaction.php         30-May-2024 18:01                3873
mongodb-driver-session.starttransaction.php        30-May-2024 18:01                9198
mongodb-driver-topologydescription.getservers.php  30-May-2024 18:01                3539
mongodb-driver-topologydescription.gettype.php     30-May-2024 18:01                3587
mongodb-driver-topologydescription.hasreadables..> 30-May-2024 18:01                4026
mongodb-driver-topologydescription.haswritables..> 30-May-2024 18:01                3307
mongodb-driver-writeconcern.bsonserialize.php      30-May-2024 18:01                7330
mongodb-driver-writeconcern.construct.php          30-May-2024 18:01               10595
mongodb-driver-writeconcern.getjournal.php         30-May-2024 18:01                6076
mongodb-driver-writeconcern.getw.php               30-May-2024 18:01                5366
mongodb-driver-writeconcern.getwtimeout.php        30-May-2024 18:01                5988
mongodb-driver-writeconcern.isdefault.php          30-May-2024 18:01                7951
mongodb-driver-writeconcern.serialize.php          30-May-2024 18:01                3771
mongodb-driver-writeconcern.unserialize.php        30-May-2024 18:01                4605
mongodb-driver-writeconcernerror.getcode.php       30-May-2024 18:01                6405
mongodb-driver-writeconcernerror.getinfo.php       30-May-2024 18:01                6731
mongodb-driver-writeconcernerror.getmessage.php    30-May-2024 18:01                6496
mongodb-driver-writeerror.getcode.php              30-May-2024 18:01                5750
mongodb-driver-writeerror.getindex.php             30-May-2024 18:01                6276
mongodb-driver-writeerror.getinfo.php              30-May-2024 18:01                3209
mongodb-driver-writeerror.getmessage.php           30-May-2024 18:01                5886
mongodb-driver-writeexception.getwriteresult.php   30-May-2024 18:01                7972
mongodb-driver-writeresult.getdeletedcount.php     30-May-2024 18:01                8245
mongodb-driver-writeresult.getinsertedcount.php    30-May-2024 18:01                8327
mongodb-driver-writeresult.getmatchedcount.php     30-May-2024 18:01                8890
mongodb-driver-writeresult.getmodifiedcount.php    30-May-2024 18:01                9188
mongodb-driver-writeresult.getserver.php           30-May-2024 18:01                6620
mongodb-driver-writeresult.getupsertedcount.php    30-May-2024 18:01                8416
mongodb-driver-writeresult.getupsertedids.php      30-May-2024 18:01                8893
mongodb-driver-writeresult.getwriteconcernerror..> 30-May-2024 18:01                7283
mongodb-driver-writeresult.getwriteerrors.php      30-May-2024 18:01               13113
mongodb-driver-writeresult.isacknowledged.php      30-May-2024 18:01                8287
mongodb.architecture.php                           30-May-2024 18:01                1982
mongodb.configuration.php                          30-May-2024 18:01                4017
mongodb.connection-handling.php                    30-May-2024 18:01                8783
mongodb.constants.php                              30-May-2024 18:01                2187
mongodb.exceptions.php                             30-May-2024 18:01                5209
mongodb.exceptions.tree.php                        30-May-2024 18:01                5633
mongodb.installation.homebrew.php                  30-May-2024 18:01                2035
mongodb.installation.manual.php                    30-May-2024 18:01                6166
mongodb.installation.pecl.php                      30-May-2024 18:01                4964
mongodb.installation.php                           30-May-2024 18:01                1848                   30-May-2024 18:01                4347
mongodb.monitoring.php                             30-May-2024 18:01               19448
mongodb.overview.php                               30-May-2024 18:01                4673
mongodb.persistence.deserialization.php            30-May-2024 18:01               21974
mongodb.persistence.php                            30-May-2024 18:01                1883
mongodb.persistence.serialization.php              30-May-2024 18:01               20134