Index of /php/manual/zh/


../
feeds/                                             24-Jan-2021 12:02                   -
images/                                            24-Jan-2021 12:02                   -
styles/                                            24-Jan-2021 12:01                   -
toc/                                               24-Jan-2021 12:02                   -
about.formats.php                                  24-Jan-2021 12:02                4131
about.generate.php                                 24-Jan-2021 12:02                2630
about.howtohelp.php                                24-Jan-2021 12:02                2741
about.more.php                                     24-Jan-2021 12:02                1651
about.notes.php                                    24-Jan-2021 12:02                2106
about.php                                          24-Jan-2021 12:02                1735
about.phpversions.php                              24-Jan-2021 12:02                2970
about.prototypes.php                               24-Jan-2021 12:02                6808
about.translations.php                             24-Jan-2021 12:02                2877
aliases.php                                        24-Jan-2021 12:02               28934
apache.configuration.php                           24-Jan-2021 12:02                4546
apache.constants.php                               24-Jan-2021 12:02                1010
apache.installation.php                            24-Jan-2021 12:02                1099
apache.requirements.php                            24-Jan-2021 12:02                1033
apache.resources.php                               24-Jan-2021 12:02                1051
apache.setup.php                                   24-Jan-2021 12:02                1423
apcu.configuration.php                             24-Jan-2021 12:01               14146
apcu.constants.php                                 24-Jan-2021 12:01                5077
apcu.installation.php                              24-Jan-2021 12:01                2629
apcu.requirements.php                              24-Jan-2021 12:01                1021
apcu.resources.php                                 24-Jan-2021 12:01                1039
apcu.setup.php                                     24-Jan-2021 12:01                1379
apcuiterator.construct.php                         24-Jan-2021 12:01                6503
apcuiterator.current.php                           24-Jan-2021 12:01                2815
apcuiterator.gettotalcount.php                     24-Jan-2021 12:01                2960
apcuiterator.gettotalhits.php                      24-Jan-2021 12:01                3045
apcuiterator.gettotalsize.php                      24-Jan-2021 12:01                2838
apcuiterator.key.php                               24-Jan-2021 12:01                2543
apcuiterator.next.php                              24-Jan-2021 12:01                2785
apcuiterator.rewind.php                            24-Jan-2021 12:01                2554
apcuiterator.valid.php                             24-Jan-2021 12:01                2629
appendices.php                                     24-Jan-2021 12:02                9881
appenditerator.append.php                          24-Jan-2021 12:02                5357
appenditerator.construct.php                       24-Jan-2021 12:02               10549
appenditerator.current.php                         24-Jan-2021 12:02                3345
appenditerator.getarrayiterator.php                24-Jan-2021 12:02                2955
appenditerator.getinneriterator.php                24-Jan-2021 12:02                6647
appenditerator.getiteratorindex.php                24-Jan-2021 12:02                6510
appenditerator.key.php                             24-Jan-2021 12:02                8021
appenditerator.next.php                            24-Jan-2021 12:02                3232
appenditerator.rewind.php                          24-Jan-2021 12:02                3220
appenditerator.valid.php                           24-Jan-2021 12:02                3075
array.configuration.php                            24-Jan-2021 12:02                1088
array.constants.php                                24-Jan-2021 12:02                5744
array.installation.php                             24-Jan-2021 12:02                1067
array.requirements.php                             24-Jan-2021 12:02                1027
array.resources.php                                24-Jan-2021 12:02                1045
array.setup.php                                    24-Jan-2021 12:02                1387
array.sorting.php                                  24-Jan-2021 12:02                6521
arrayaccess.offsetexists.php                       24-Jan-2021 12:01                9146
arrayaccess.offsetget.php                          24-Jan-2021 12:01                4851
arrayaccess.offsetset.php                          24-Jan-2021 12:01                4236
arrayaccess.offsetunset.php                        24-Jan-2021 12:01                2753
arrayiterator.append.php                           24-Jan-2021 12:02                3275
arrayiterator.asort.php                            24-Jan-2021 12:02                2956
arrayiterator.construct.php                        24-Jan-2021 12:02                4023
arrayiterator.count.php                            24-Jan-2021 12:02                2760
arrayiterator.current.php                          24-Jan-2021 12:02                5256
arrayiterator.getarraycopy.php                     24-Jan-2021 12:02                2718
arrayiterator.getflags.php                         24-Jan-2021 12:02                2768
arrayiterator.key.php                              24-Jan-2021 12:02                3692
arrayiterator.ksort.php                            24-Jan-2021 12:02                2954
arrayiterator.natcasesort.php                      24-Jan-2021 12:02                3292
arrayiterator.natsort.php                          24-Jan-2021 12:02                3206
arrayiterator.next.php                             24-Jan-2021 12:02                4546
arrayiterator.offsetexists.php                     24-Jan-2021 12:02                3038
arrayiterator.offsetget.php                        24-Jan-2021 12:02                3289
arrayiterator.offsetset.php                        24-Jan-2021 12:02                3532
arrayiterator.offsetunset.php                      24-Jan-2021 12:02                3653
arrayiterator.rewind.php                           24-Jan-2021 12:02                4530
arrayiterator.seek.php                             24-Jan-2021 12:02                2356
arrayiterator.serialize.php                        24-Jan-2021 12:02                2601
arrayiterator.setflags.php                         24-Jan-2021 12:02                3906
arrayiterator.uasort.php                           24-Jan-2021 12:02                4259
arrayiterator.uksort.php                           24-Jan-2021 12:02                4187
arrayiterator.unserialize.php                      24-Jan-2021 12:02                2874
arrayiterator.valid.php                            24-Jan-2021 12:02                4431
arrayobject.append.php                             24-Jan-2021 12:02                5300
arrayobject.asort.php                              24-Jan-2021 12:02                8212
arrayobject.construct.php                          24-Jan-2021 12:02                6755
arrayobject.count.php                              24-Jan-2021 12:02                5193
arrayobject.exchangearray.php                      24-Jan-2021 12:02                6011
arrayobject.getarraycopy.php                       24-Jan-2021 12:02                5123
arrayobject.getflags.php                           24-Jan-2021 12:02                6019
arrayobject.getiterator.php                        24-Jan-2021 12:02                5346
arrayobject.getiteratorclass.php                   24-Jan-2021 12:02                6586
arrayobject.ksort.php                              24-Jan-2021 12:02                7965
arrayobject.natcasesort.php                        24-Jan-2021 12:02                7008
arrayobject.natsort.php                            24-Jan-2021 12:02                6753
arrayobject.offsetexists.php                       24-Jan-2021 12:02                4694
arrayobject.offsetget.php                          24-Jan-2021 12:02                4994
arrayobject.offsetset.php                          24-Jan-2021 12:02                6773
arrayobject.offsetunset.php                        24-Jan-2021 12:02                4120
arrayobject.serialize.php                          24-Jan-2021 12:02                4809
arrayobject.setflags.php                           24-Jan-2021 12:02                6676
arrayobject.setiteratorclass.php                   24-Jan-2021 12:02                5793
arrayobject.uasort.php                             24-Jan-2021 12:02                8930
arrayobject.uksort.php                             24-Jan-2021 12:02                8361
arrayobject.unserialize.php                        24-Jan-2021 12:02                3317
bc.configuration.php                               24-Jan-2021 12:02                2202
bc.constants.php                                   24-Jan-2021 12:02                 990
bc.installation.php                                24-Jan-2021 12:02                1230
bc.requirements.php                                24-Jan-2021 12:02                1009
bc.resources.php                                   24-Jan-2021 12:02                1027
bc.setup.php                                       24-Jan-2021 12:02                1385
blenc.configuration.php                            24-Jan-2021 12:01                2099
blenc.constants.php                                24-Jan-2021 12:01                1335
blenc.installation.php                             24-Jan-2021 12:01                2353
blenc.requirements.php                             24-Jan-2021 12:01                1000
blenc.resources.php                                24-Jan-2021 12:01                1013
blenc.setup.php                                    24-Jan-2021 12:01                1405
book.apache.php                                    24-Jan-2021 12:02                3111
book.apcu.php                                      24-Jan-2021 12:01                4193
book.array.php                                     24-Jan-2021 12:02               10610
book.bc.php                                        24-Jan-2021 12:02                2641
book.blenc.php                                     24-Jan-2021 12:01                1882
book.bson.php                                      24-Jan-2021 12:02               19774
book.bzip2.php                                     24-Jan-2021 12:02                2756
book.calendar.php                                  24-Jan-2021 12:02                3790
book.classkit.php                                  24-Jan-2021 12:02                2549
book.classobj.php                                  24-Jan-2021 12:02                3836
book.cmark.php                                     24-Jan-2021 12:02                8536
book.com.php                                       24-Jan-2021 12:02                7739
book.componere.php                                 24-Jan-2021 12:01                5997
book.csprng.php                                    24-Jan-2021 12:02                1963
book.ctype.php                                     24-Jan-2021 12:02                2827
book.cubrid.php                                    24-Jan-2021 12:02               13662
book.curl.php                                      24-Jan-2021 12:02                6200
book.datetime.php                                  24-Jan-2021 12:02               15494
book.dba.php                                       24-Jan-2021 12:02                3233
book.dbase.php                                     24-Jan-2021 12:02                3045
book.dbplus.php                                    24-Jan-2021 12:02                6544
book.dbx.php                                       24-Jan-2021 12:02                2622
book.dio.php                                       24-Jan-2021 12:02                2748
book.dir.php                                       24-Jan-2021 12:02                2800
book.dom.php                                       24-Jan-2021 12:02               16531
book.ds.php                                        24-Jan-2021 12:02               24925
book.eio.php                                       24-Jan-2021 12:02                7731
book.enchant.php                                   24-Jan-2021 12:02                5127
book.errorfunc.php                                 24-Jan-2021 12:01                3209
book.ev.php                                        24-Jan-2021 12:02               13181
book.event.php                                     24-Jan-2021 12:02               22730
book.exec.php                                      24-Jan-2021 12:02                2985
book.exif.php                                      24-Jan-2021 12:02                2289
book.expect.php                                    24-Jan-2021 12:02                2287
book.fann.php                                      24-Jan-2021 12:02               21687
book.fbsql.php                                     24-Jan-2021 12:02                8444
book.fdf.php                                       24-Jan-2021 12:02                5437
book.ffi.php                                       24-Jan-2021 12:01                3911
book.fileinfo.php                                  24-Jan-2021 12:02                2825
book.filepro.php                                   24-Jan-2021 12:02                2566
book.filesystem.php                                24-Jan-2021 12:02                9008
book.filter.php                                    24-Jan-2021 12:02                3237
book.fpm.php                                       24-Jan-2021 12:02                1545
book.ftp.php                                       24-Jan-2021 12:02                5504
book.funchand.php                                  24-Jan-2021 12:02                3413
book.gearman.php                                   24-Jan-2021 12:02               14621
book.gender.php                                    24-Jan-2021 12:02                2407
book.geoip.php                                     24-Jan-2021 12:02                4018
book.gettext.php                                   24-Jan-2021 12:02                2719
book.gmagick.php                                   24-Jan-2021 12:02               22384
book.gmp.php                                       24-Jan-2021 12:02                6050
book.gnupg.php                                     24-Jan-2021 12:02                4180
book.hash.php                                      24-Jan-2021 12:02                3401
book.hrtime.php                                    24-Jan-2021 12:02                3313
book.ibase.php                                     24-Jan-2021 12:02               11733
book.ibm-db2.php                                   24-Jan-2021 12:02                8449
book.iconv.php                                     24-Jan-2021 12:02                2983
book.image.php                                     24-Jan-2021 12:02               14496
book.imagick.php                                   24-Jan-2021 12:02               61100
book.imap.php                                      24-Jan-2021 12:02                9812
book.info.php                                      24-Jan-2021 12:01                7376
book.ingres.php                                    24-Jan-2021 12:02                5885
book.inotify.php                                   24-Jan-2021 12:02                2354
book.intl.php                                      24-Jan-2021 12:02               43692
book.json.php                                      24-Jan-2021 12:02                2613
book.ldap.php                                      24-Jan-2021 12:02                8314
book.libxml.php                                    24-Jan-2021 12:02                2777
book.lua.php                                       24-Jan-2021 12:02                2448
book.luasandbox.php                                24-Jan-2021 12:02                5379
book.lzf.php                                       24-Jan-2021 12:02                1995
book.mail.php                                      24-Jan-2021 12:02                1881
book.mailparse.php                                 24-Jan-2021 12:02                3717
book.math.php                                      24-Jan-2021 12:02                5541
book.mbstring.php                                  24-Jan-2021 12:02                9226
book.mcrypt.php                                    24-Jan-2021 12:02                6331
book.memcache.php                                  24-Jan-2021 12:02                4029
book.memcached.php                                 24-Jan-2021 12:02                7778
book.memtrack.php                                  24-Jan-2021 12:01                1845
book.mhash.php                                     24-Jan-2021 12:02                2277
book.mime-magic.php                                24-Jan-2021 12:02                1706
book.misc.php                                      24-Jan-2021 12:02                4970
book.mongo.php                                     24-Jan-2021 12:02                6437
book.mongodb.php                                   24-Jan-2021 12:02               17675
book.mqseries.php                                  24-Jan-2021 12:02                2987
book.mysql-xdevapi.php                             24-Jan-2021 12:02               28735
book.mysql.php                                     24-Jan-2021 12:02                7318
book.mysqli.php                                    24-Jan-2021 12:02               16571
book.mysqlnd-memcache.php                          24-Jan-2021 12:02                2632
book.mysqlnd-ms.php                                24-Jan-2021 12:02                6706
book.mysqlnd-mux.php                               24-Jan-2021 12:02                2203
book.mysqlnd-qc.php                                24-Jan-2021 12:02                4523
book.mysqlnd-uh.php                                24-Jan-2021 12:02               11045
book.mysqlnd.php                                   24-Jan-2021 12:02                2316
book.ncurses.php                                   24-Jan-2021 12:02               20547
book.network.php                                   24-Jan-2021 12:02                5404
book.oauth.php                                     24-Jan-2021 12:02                6973
book.oci8.php                                      24-Jan-2021 12:02               16099
book.opcache.php                                   24-Jan-2021 12:01                2444
book.openal.php                                    24-Jan-2021 12:02                4227
book.openssl.php                                   24-Jan-2021 12:02                9573
book.outcontrol.php                                24-Jan-2021 12:01                4002
book.paradox.php                                   24-Jan-2021 12:02                4347
book.parallel.php                                  24-Jan-2021 12:02                5570
book.parle.php                                     24-Jan-2021 12:02                8642
book.password.php                                  24-Jan-2021 12:02                2378
book.pcntl.php                                     24-Jan-2021 12:02                4761
book.pcre.php                                      24-Jan-2021 12:02                3609
book.pdo.php                                       24-Jan-2021 12:02                7337
book.pgsql.php                                     24-Jan-2021 12:02               11493
book.phar.php                                      24-Jan-2021 12:02               15211
book.phpdbg.php                                    24-Jan-2021 12:01                2721
book.pht.php                                       24-Jan-2021 12:02                6221
book.posix.php                                     24-Jan-2021 12:02                5942
book.proctitle.php                                 24-Jan-2021 12:02                1991
book.ps.php                                        24-Jan-2021 12:02                9004
book.pspell.php                                    24-Jan-2021 12:02                4039
book.pthreads.php                                  24-Jan-2021 12:02                7074
book.quickhash.php                                 24-Jan-2021 12:02                8710
book.radius.php                                    24-Jan-2021 12:02                5332
book.rar.php                                       24-Jan-2021 12:02                5054
book.readline.php                                  24-Jan-2021 12:02                3399
book.recode.php                                    24-Jan-2021 12:02                2084
book.reflection.php                                24-Jan-2021 12:02               28776
book.regex.php                                     24-Jan-2021 12:02                2542
book.rpminfo.php                                   24-Jan-2021 12:02                2232
book.rrd.php                                       24-Jan-2021 12:02                4912
book.runkit7.php                                   24-Jan-2021 12:01                4033
book.scoutapm.php                                  24-Jan-2021 12:02                2005
book.seaslog.php                                   24-Jan-2021 12:02                4978
book.sem.php                                       24-Jan-2021 12:02                3679
book.session.php                                   24-Jan-2021 12:02                7007
book.shmop.php                                     24-Jan-2021 12:02                2591
book.simplexml.php                                 24-Jan-2021 12:02                5334
book.snmp.php                                      24-Jan-2021 12:02                5572
book.soap.php                                      24-Jan-2021 12:02                5901
book.sockets.php                                   24-Jan-2021 12:02                6569
book.sodium.php                                    24-Jan-2021 12:02               12901
book.solr.php                                      24-Jan-2021 12:02               52948
book.sphinx.php                                    24-Jan-2021 12:02                5803
book.spl-types.php                                 24-Jan-2021 12:02                2434
book.spl.php                                       24-Jan-2021 12:02                9708
book.sqlite3.php                                   24-Jan-2021 12:02                6578
book.sqlsrv.php                                    24-Jan-2021 12:02                5145
book.ssdeep.php                                    24-Jan-2021 12:02                2130
book.ssh2.php                                      24-Jan-2021 12:02                5220
book.stats.php                                     24-Jan-2021 12:02               11612
book.stomp.php                                     24-Jan-2021 12:02                3953
book.stream.php                                    24-Jan-2021 12:02               11352
book.strings.php                                   24-Jan-2021 12:02               12109
book.svm.php                                       24-Jan-2021 12:02                3486
book.svn.php                                       24-Jan-2021 12:02                7639
book.swoole.php                                    24-Jan-2021 12:02               36890
book.sync.php                                      24-Jan-2021 12:02                4573
book.taint.php                                     24-Jan-2021 12:02                2332
book.tcpwrap.php                                   24-Jan-2021 12:02                1852
book.tidy.php                                      24-Jan-2021 12:02                6392
book.tokenizer.php                                 24-Jan-2021 12:02                2927
book.tokyo-tyrant.php                              24-Jan-2021 12:02                7908
book.trader.php                                    24-Jan-2021 12:02               17311
book.ui.php                                        24-Jan-2021 12:02               27783
book.uodbc.php                                     24-Jan-2021 12:02                6350
book.uopz.php                                      24-Jan-2021 12:01                4904
book.url.php                                       24-Jan-2021 12:02                2801
book.v8js.php                                      24-Jan-2021 12:02                2907
book.var.php                                       24-Jan-2021 12:02                5113
book.varnish.php                                   24-Jan-2021 12:02                5171
book.wddx.php                                      24-Jan-2021 12:02                2602
book.weakref.php                                   24-Jan-2021 12:01                3498
book.win32service.php                              24-Jan-2021 12:02                4950
book.wincache.php                                  24-Jan-2021 12:02                5388
book.wkhtmltox.php                                 24-Jan-2021 12:02                3126
book.xattr.php                                     24-Jan-2021 12:02                2236
book.xdiff.php                                     24-Jan-2021 12:02                3891
book.xhprof.php                                    24-Jan-2021 12:02                2279
book.xlswriter.php                                 24-Jan-2021 12:02                4239
book.xml.php                                       24-Jan-2021 12:02                5369
book.xmldiff.php                                   24-Jan-2021 12:02                2944
book.xmlreader.php                                 24-Jan-2021 12:02                4691
book.xmlrpc.php                                    24-Jan-2021 12:02                3535
book.xmlwriter.php                                 24-Jan-2021 12:02                6324
book.xsl.php                                       24-Jan-2021 12:02                3563
book.yac.php                                       24-Jan-2021 12:02                2400
book.yaconf.php                                    24-Jan-2021 12:02                1944
book.yaf.php                                       24-Jan-2021 12:02               34495
book.yaml.php                                      24-Jan-2021 12:02                2567
book.yar.php                                       24-Jan-2021 12:02                3538
book.yaz.php                                       24-Jan-2021 12:02                4156
book.zip.php                                       24-Jan-2021 12:02                9167
book.zlib.php                                      24-Jan-2021 12:02                4744
book.zmq.php                                       24-Jan-2021 12:02                5338
book.zookeeper.php                                 24-Jan-2021 12:02                6452
bzip2.configuration.php                            24-Jan-2021 12:02                1088
bzip2.constants.php                                24-Jan-2021 12:02                1001
bzip2.examples.php                                 24-Jan-2021 12:02                4057
bzip2.installation.php                             24-Jan-2021 12:02                1176
bzip2.requirements.php                             24-Jan-2021 12:02                1196
bzip2.resources.php                                24-Jan-2021 12:02                1099
bzip2.setup.php                                    24-Jan-2021 12:02                1408
cachingiterator.construct.php                      24-Jan-2021 12:02                2580
cachingiterator.count.php                          24-Jan-2021 12:02                2252
cachingiterator.current.php                        24-Jan-2021 12:02                2658
cachingiterator.getcache.php                       24-Jan-2021 12:02                5435
cachingiterator.getflags.php                       24-Jan-2021 12:02                2261
cachingiterator.getinneriterator.php               24-Jan-2021 12:02                2392
cachingiterator.hasnext.php                        24-Jan-2021 12:02                2307
cachingiterator.key.php                            24-Jan-2021 12:02                2050
cachingiterator.next.php                           24-Jan-2021 12:02                2197
cachingiterator.offsetexists.php                   24-Jan-2021 12:02                2692
cachingiterator.offsetget.php                      24-Jan-2021 12:02                2448
cachingiterator.offsetset.php                      24-Jan-2021 12:02                2965
cachingiterator.offsetunset.php                    24-Jan-2021 12:02                2485
cachingiterator.rewind.php                         24-Jan-2021 12:02                2211
cachingiterator.setflags.php                       24-Jan-2021 12:02                2518
cachingiterator.tostring.php                       24-Jan-2021 12:02                2348
cachingiterator.valid.php                          24-Jan-2021 12:02                2344
calendar.configuration.php                         24-Jan-2021 12:02                1106
calendar.constants.php                             24-Jan-2021 12:02                5665
calendar.installation.php                          24-Jan-2021 12:02                1268
calendar.requirements.php                          24-Jan-2021 12:02                1045
calendar.resources.php                             24-Jan-2021 12:02                1063
calendar.setup.php                                 24-Jan-2021 12:02                1444
callbackfilteriterator.accept.php                  24-Jan-2021 12:02                3178
callbackfilteriterator.construct.php               24-Jan-2021 12:02                3918
cc.license.php                                     24-Jan-2021 12:02               20928
changelog.misc.php                                 24-Jan-2021 12:02                3523
changelog.mongo.php                                24-Jan-2021 12:02               29274
changelog.mysql.php                                24-Jan-2021 12:02                4120
changelog.strings.php                              24-Jan-2021 12:02               12235
class.OCI-Collection.php                           24-Jan-2021 12:02                5692
class.OCI-Lob.php                                  24-Jan-2021 12:02               11022
class.apcuiterator.php                             24-Jan-2021 12:01                6370
class.appenditerator.php                           24-Jan-2021 12:02                8635
class.argumentcounterror.php                       24-Jan-2021 12:01                5629
class.arithmeticerror.php                          24-Jan-2021 12:01                5874
class.arrayaccess.php                              24-Jan-2021 12:01               13121
class.arrayiterator.php                            24-Jan-2021 12:02               15716
class.arrayobject.php                              24-Jan-2021 12:02               15952
class.assertionerror.php                           24-Jan-2021 12:01                5647
class.badfunctioncallexception.php                 24-Jan-2021 12:02                6473
class.badmethodcallexception.php                   24-Jan-2021 12:02                5752
class.cachingiterator.php                          24-Jan-2021 12:02               14190
class.callbackfilteriterator.php                   24-Jan-2021 12:02               10897
class.closure.php                                  24-Jan-2021 12:01                4666
class.collator.php                                 24-Jan-2021 12:02               23785
class.collectable.php                              24-Jan-2021 12:02                3007
class.com-exception.php                            24-Jan-2021 12:02                5659
class.com.php                                      24-Jan-2021 12:02               12549
class.commonmark-cql.php                           24-Jan-2021 12:02                7448
class.commonmark-interfaces-ivisitable.php         24-Jan-2021 12:02                2737
class.commonmark-interfaces-ivisitor.php           24-Jan-2021 12:02                4144
class.commonmark-node-blockquote.php               24-Jan-2021 12:02                8226
class.commonmark-node-bulletlist.php               24-Jan-2021 12:02               10162
class.commonmark-node-code.php                     24-Jan-2021 12:02                9118
class.commonmark-node-codeblock.php                24-Jan-2021 12:02               10314
class.commonmark-node-customblock.php              24-Jan-2021 12:02                8827
class.commonmark-node-custominline.php             24-Jan-2021 12:02                8806
class.commonmark-node-document.php                 24-Jan-2021 12:02                8174
class.commonmark-node-heading.php                  24-Jan-2021 12:02                9492
class.commonmark-node-htmlblock.php                24-Jan-2021 12:02                9175
class.commonmark-node-htmlinline.php               24-Jan-2021 12:02                9150
class.commonmark-node-image.php                    24-Jan-2021 12:02               10203
class.commonmark-node-item.php                     24-Jan-2021 12:02                8199
class.commonmark-node-linebreak.php                24-Jan-2021 12:02                8208
class.commonmark-node-link.php                     24-Jan-2021 12:02               10197
class.commonmark-node-orderedlist.php              24-Jan-2021 12:02               10928
class.commonmark-node-paragraph.php                24-Jan-2021 12:02                8233
class.commonmark-node-softbreak.php                24-Jan-2021 12:02                8226
class.commonmark-node-text-emphasis.php            24-Jan-2021 12:02                8251
class.commonmark-node-text-strong.php              24-Jan-2021 12:02                8242
class.commonmark-node-text.php                     24-Jan-2021 12:02                9507
class.commonmark-node-thematicbreak.php            24-Jan-2021 12:02                8251
class.commonmark-node.php                          24-Jan-2021 12:02                9144
class.commonmark-parser.php                        24-Jan-2021 12:02                3513
class.compersisthelper.php                         24-Jan-2021 12:02                6436
class.compileerror.php                             24-Jan-2021 12:01                5570
class.componere-abstract-definition.php            24-Jan-2021 12:01                4485
class.componere-definition.php                     24-Jan-2021 12:01                9450
class.componere-method.php                         24-Jan-2021 12:01                4271
class.componere-patch.php                          24-Jan-2021 12:01                7792
class.componere-value.php                          24-Jan-2021 12:01                5178
class.cond.php                                     24-Jan-2021 12:02                4737
class.countable.php                                24-Jan-2021 12:02                2362
class.curlfile.php                                 24-Jan-2021 12:02                6485
class.dateinterval.php                             24-Jan-2021 12:02                9037
class.dateperiod.php                               24-Jan-2021 12:02               11424
class.datetime.php                                 24-Jan-2021 12:02               19796
class.datetimeimmutable.php                        24-Jan-2021 12:02               19173
class.datetimeinterface.php                        24-Jan-2021 12:02               14823
class.datetimezone.php                             24-Jan-2021 12:02               12887
class.deflatecontext.php                           24-Jan-2021 12:02                1701
class.directory.php                                24-Jan-2021 12:02                4939
class.directoryiterator.php                        24-Jan-2021 12:02               14546
class.divisionbyzeroerror.php                      24-Jan-2021 12:01                5594
class.domainexception.php                          24-Jan-2021 12:02                6419
class.domattr.php                                  24-Jan-2021 12:02               20656
class.domcdatasection.php                          24-Jan-2021 12:02               21686
class.domcharacterdata.php                         24-Jan-2021 12:02               21378
class.domcomment.php                               24-Jan-2021 12:02               20652
class.domdocument.php                              24-Jan-2021 12:02               51303
class.domdocumentfragment.php                      24-Jan-2021 12:02               17195
class.domdocumenttype.php                          24-Jan-2021 12:02               20494
class.domelement.php                               24-Jan-2021 12:02               30959
class.domentity.php                                24-Jan-2021 12:02               20421
class.domentityreference.php                       24-Jan-2021 12:02               17087
class.domexception.php                             24-Jan-2021 12:02                6462
class.domimplementation.php                        24-Jan-2021 12:02                5372
class.domnamednodemap.php                          24-Jan-2021 12:02                5289
class.domnode.php                                  24-Jan-2021 12:02               24183
class.domnodelist.php                              24-Jan-2021 12:02                4747
class.domnotation.php                              24-Jan-2021 12:02               17342
class.domprocessinginstruction.php                 24-Jan-2021 12:02               18417
class.domtext.php                                  24-Jan-2021 12:02               22745
class.domxpath.php                                 24-Jan-2021 12:02                6544
class.dotnet.php                                   24-Jan-2021 12:02                6227
class.ds-collection.php                            24-Jan-2021 12:02                4284
class.ds-deque.php                                 24-Jan-2021 12:02               21659
class.ds-hashable.php                              24-Jan-2021 12:02                3953
class.ds-map.php                                   24-Jan-2021 12:02               22964
class.ds-pair.php                                  24-Jan-2021 12:02                4385
class.ds-priorityqueue.php                         24-Jan-2021 12:02                7923
class.ds-queue.php                                 24-Jan-2021 12:02                7465
class.ds-sequence.php                              24-Jan-2021 12:02               19337
class.ds-set.php                                   24-Jan-2021 12:02               18221
class.ds-stack.php                                 24-Jan-2021 12:02                6862
class.ds-vector.php                                24-Jan-2021 12:02               21268
class.emptyiterator.php                            24-Jan-2021 12:02                3915
class.enchantbroker.php                            24-Jan-2021 12:02                1711
class.enchantdictionary.php                        24-Jan-2021 12:02                1697
class.error.php                                    24-Jan-2021 12:01                8143
class.errorexception.php                           24-Jan-2021 12:01                9815
class.ev.php                                       24-Jan-2021 12:02               37958
class.evcheck.php                                  24-Jan-2021 12:02               10037
class.evchild.php                                  24-Jan-2021 12:02               11580
class.evembed.php                                  24-Jan-2021 12:02                9359
class.event.php                                    24-Jan-2021 12:02               18144
class.eventbase.php                                24-Jan-2021 12:02               13414
class.eventbuffer.php                              24-Jan-2021 12:02               20584
class.eventbufferevent.php                         24-Jan-2021 12:02               33000
class.eventconfig.php                              24-Jan-2021 12:02                6280
class.eventdnsbase.php                             24-Jan-2021 12:02               10276
class.eventhttp.php                                24-Jan-2021 12:02                8570
class.eventhttpconnection.php                      24-Jan-2021 12:02                9403
class.eventhttprequest.php                         24-Jan-2021 12:02               20334
class.eventlistener.php                            24-Jan-2021 12:02               11488
class.eventsslcontext.php                          24-Jan-2021 12:02               16610
class.eventutil.php                                24-Jan-2021 12:02               22587
class.evfork.php                                   24-Jan-2021 12:02                8524
class.evidle.php                                   24-Jan-2021 12:02                9401
class.evio.php                                     24-Jan-2021 12:02               12004
class.evloop.php                                   24-Jan-2021 12:02               28362
class.evperiodic.php                               24-Jan-2021 12:02               13844
class.evprepare.php                                24-Jan-2021 12:02               10183
class.evsignal.php                                 24-Jan-2021 12:02               10992
class.evstat.php                                   24-Jan-2021 12:02               13437
class.evtimer.php                                  24-Jan-2021 12:02               13379
class.evwatcher.php                                24-Jan-2021 12:02                9048
class.exception.php                                24-Jan-2021 12:01                8182
class.fannconnection.php                           24-Jan-2021 12:02                5894
class.ffi-cdata.php                                24-Jan-2021 12:01                5207
class.ffi-ctype.php                                24-Jan-2021 12:01                1488
class.ffi-exception.php                            24-Jan-2021 12:01                5562
class.ffi-parserexception.php                      24-Jan-2021 12:01                2918
class.ffi.php                                      24-Jan-2021 12:01               17901
class.filesystemiterator.php                       24-Jan-2021 12:02               21452
class.filteriterator.php                           24-Jan-2021 12:02                5842
class.finfo.php                                    24-Jan-2021 12:02                4736
class.gearmanclient.php                            24-Jan-2021 12:02               29666
class.gearmanexception.php                         24-Jan-2021 12:02                5635
class.gearmanjob.php                               24-Jan-2021 12:02                9998
class.gearmantask.php                              24-Jan-2021 12:02                8255
class.gearmanworker.php                            24-Jan-2021 12:02               11405
class.gender.php                                   24-Jan-2021 12:02               34012
class.generator.php                                24-Jan-2021 12:01                5807
class.globiterator.php                             24-Jan-2021 12:02                6067
class.gmagick.php                                  24-Jan-2021 12:02               76465
class.gmagickdraw.php                              24-Jan-2021 12:02               21191
class.gmagickpixel.php                             24-Jan-2021 12:02                5202
class.gmp.php                                      24-Jan-2021 12:02                2130
class.hrtime-performancecounter.php                24-Jan-2021 12:02                3409
class.hrtime-stopwatch.php                         24-Jan-2021 12:02                6276
class.hrtime-unit.php                              24-Jan-2021 12:02                3771
class.imagick.php                                  24-Jan-2021 12:02              240066
class.imagickdraw.php                              24-Jan-2021 12:02               65888
class.imagickpixel.php                             24-Jan-2021 12:02               11350
class.imagickpixeliterator.php                     24-Jan-2021 12:02                8397
class.infiniteiterator.php                         24-Jan-2021 12:02                5690
class.inflatecontext.php                           24-Jan-2021 12:02                1675
class.intlbreakiterator.php                        24-Jan-2021 12:02               24299
class.intlcalendar.php                             24-Jan-2021 12:02               78680
class.intlchar.php                                 24-Jan-2021 12:02              351443
class.intlcodepointbreakiterator.php               24-Jan-2021 12:02               18095
class.intldateformatter.php                        24-Jan-2021 12:02               20462
class.intlexception.php                            24-Jan-2021 12:02                5813
class.intlgregoriancalendar.php                    24-Jan-2021 12:02               58597
class.intliterator.php                             24-Jan-2021 12:02                4838
class.intlpartsiterator.php                        24-Jan-2021 12:02                6683
class.intlrulebasedbreakiterator.php               24-Jan-2021 12:02               20298
class.intltimezone.php                             24-Jan-2021 12:02               17119
class.invalidargumentexception.php                 24-Jan-2021 12:02                6433
class.iterator.php                                 24-Jan-2021 12:01               11756
class.iteratoraggregate.php                        24-Jan-2021 12:01                6297
class.iteratoriterator.php                         24-Jan-2021 12:02                5758
class.jsonexception.php                            24-Jan-2021 12:02                6027
class.jsonserializable.php                         24-Jan-2021 12:02                2695
class.lengthexception.php                          24-Jan-2021 12:02                6368
class.libxmlerror.php                              24-Jan-2021 12:02                5026
class.limititerator.php                            24-Jan-2021 12:02                9777
class.locale.php                                   24-Jan-2021 12:02               19015
class.logicexception.php                           24-Jan-2021 12:02                6429
class.lua.php                                      24-Jan-2021 12:02                7172
class.luaclosure.php                               24-Jan-2021 12:02                2710
class.luasandbox.php                               24-Jan-2021 12:02               12548
class.luasandboxerror.php                          24-Jan-2021 12:02                7736
class.luasandboxerrorerror.php                     24-Jan-2021 12:02                5707
class.luasandboxfatalerror.php                     24-Jan-2021 12:02                5829
class.luasandboxfunction.php                       24-Jan-2021 12:02                3502
class.luasandboxmemoryerror.php                    24-Jan-2021 12:02                6028
class.luasandboxruntimeerror.php                   24-Jan-2021 12:02                5847
class.luasandboxsyntaxerror.php                    24-Jan-2021 12:02                5710
class.luasandboxtimeouterror.php                   24-Jan-2021 12:02                6011
class.memcache.php                                 24-Jan-2021 12:02               14476
class.memcached.php                                24-Jan-2021 12:02               34217
class.messageformatter.php                         24-Jan-2021 12:02               10307
class.mongo.php                                    24-Jan-2021 12:02               12056
class.mongobindata.php                             24-Jan-2021 12:02               11172
class.mongoclient.php                              24-Jan-2021 12:02               20711
class.mongocode.php                                24-Jan-2021 12:02                3449
class.mongocollection.php                          24-Jan-2021 12:02               26993
class.mongocommandcursor.php                       24-Jan-2021 12:02               12989
class.mongoconnectionexception.php                 24-Jan-2021 12:02                5395
class.mongocursor.php                              24-Jan-2021 12:02               27167
class.mongocursorexception.php                     24-Jan-2021 12:02               19046
class.mongocursorinterface.php                     24-Jan-2021 12:02                7679
class.mongocursortimeoutexception.php              24-Jan-2021 12:02                2443
class.mongodate.php                                24-Jan-2021 12:02                6984
class.mongodb-bson-binary.php                      24-Jan-2021 12:02               12687
class.mongodb-bson-binaryinterface.php             24-Jan-2021 12:02                3558
class.mongodb-bson-dbpointer.php                   24-Jan-2021 12:02                5188
class.mongodb-bson-decimal128.php                  24-Jan-2021 12:02                7209
class.mongodb-bson-decimal128interface.php         24-Jan-2021 12:02                2772
class.mongodb-bson-int64.php                       24-Jan-2021 12:02                5920
class.mongodb-bson-javascript.php                  24-Jan-2021 12:02                7776
class.mongodb-bson-javascriptinterface.php         24-Jan-2021 12:02                3730
class.mongodb-bson-maxkey.php                      24-Jan-2021 12:02                5746
class.mongodb-bson-maxkeyinterface.php             24-Jan-2021 12:02                1962
class.mongodb-bson-minkey.php                      24-Jan-2021 12:02                5737
class.mongodb-bson-minkeyinterface.php             24-Jan-2021 12:02                1943
class.mongodb-bson-objectid.php                    24-Jan-2021 12:02                8432
class.mongodb-bson-objectidinterface.php           24-Jan-2021 12:02                3219
class.mongodb-bson-persistable.php                 24-Jan-2021 12:02                4475
class.mongodb-bson-regex.php                       24-Jan-2021 12:02                7488
class.mongodb-bson-regexinterface.php              24-Jan-2021 12:02                3576
class.mongodb-bson-serializable.php                24-Jan-2021 12:02                2893
class.mongodb-bson-symbol.php                      24-Jan-2021 12:02                5079
class.mongodb-bson-timestamp.php                   24-Jan-2021 12:02                7712
class.mongodb-bson-timestampinterface.php          24-Jan-2021 12:02                3734
class.mongodb-bson-type.php                        24-Jan-2021 12:02                1846
class.mongodb-bson-undefined.php                   24-Jan-2021 12:02                5164
class.mongodb-bson-unserializable.php              24-Jan-2021 12:02                2937
class.mongodb-bson-utcdatetime.php                 24-Jan-2021 12:02                7245
class.mongodb-bson-utcdatetimeinterface.php        24-Jan-2021 12:02                3347
class.mongodb-driver-bulkwrite.php                 24-Jan-2021 12:02               25328
class.mongodb-driver-command.php                   24-Jan-2021 12:02               15634
class.mongodb-driver-cursor.php                    24-Jan-2021 12:02               27169
class.mongodb-driver-cursorid.php                  24-Jan-2021 12:02                4801
class.mongodb-driver-exception-authenticationex..> 24-Jan-2021 12:02                7078
class.mongodb-driver-exception-bulkwriteexcepti..> 24-Jan-2021 12:02                7968
class.mongodb-driver-exception-connectionexcept..> 24-Jan-2021 12:02                7134
class.mongodb-driver-exception-connectiontimeou..> 24-Jan-2021 12:02                7512
class.mongodb-driver-exception-exception.php       24-Jan-2021 12:02                2001
class.mongodb-driver-exception-executiontimeout..> 24-Jan-2021 12:02                8018
class.mongodb-driver-exception-invalidargumente..> 24-Jan-2021 12:02                6279
class.mongodb-driver-exception-logicexception.php  24-Jan-2021 12:02                6173
class.mongodb-driver-exception-runtimeexception..> 24-Jan-2021 12:02                9570
class.mongodb-driver-exception-sslconnectionexc..> 24-Jan-2021 12:02                7440
class.mongodb-driver-exception-unexpectedvaluee..> 24-Jan-2021 12:02                6296
class.mongodb-driver-exception-writeexception.php  24-Jan-2021 12:02                9895
class.mongodb-driver-manager.php                   24-Jan-2021 12:02               16695
class.mongodb-driver-monitoring-commandfailedev..> 24-Jan-2021 12:02                6180
class.mongodb-driver-monitoring-commandstartede..> 24-Jan-2021 12:02                5654
class.mongodb-driver-monitoring-commandsubscrib..> 24-Jan-2021 12:02                5261
class.mongodb-driver-monitoring-commandsucceede..> 24-Jan-2021 12:02                5720
class.mongodb-driver-monitoring-subscriber.php     24-Jan-2021 12:02                2422
class.mongodb-driver-query.php                     24-Jan-2021 12:02                2841
class.mongodb-driver-readconcern.php               24-Jan-2021 12:02               13631
class.mongodb-driver-readpreference.php            24-Jan-2021 12:02               18167
class.mongodb-driver-server.php                    24-Jan-2021 12:02               20887
class.mongodb-driver-writeconcern.php              24-Jan-2021 12:02                8968
class.mongodb-driver-writeconcernerror.php         24-Jan-2021 12:02                3912
class.mongodb-driver-writeerror.php                24-Jan-2021 12:02                4237
class.mongodb-driver-writeresult.php               24-Jan-2021 12:02                7778
class.mongodb.php                                  24-Jan-2021 12:02               23914
class.mongodbref.php                               24-Jan-2021 12:02               12438
class.mongoduplicatekeyexception.php               24-Jan-2021 12:02                6069
class.mongoexception.php                           24-Jan-2021 12:02                7725
class.mongoexecutiontimeoutexception.php           24-Jan-2021 12:02                3295
class.mongogridfs.php                              24-Jan-2021 12:02               27593
class.mongogridfscursor.php                        24-Jan-2021 12:02                4640
class.mongogridfsexception.php                     24-Jan-2021 12:02                5247
class.mongogridfsfile.php                          24-Jan-2021 12:02                5255
class.mongoid.php                                  24-Jan-2021 12:02                7443
class.mongoint32.php                               24-Jan-2021 12:02                3825
class.mongoint64.php                               24-Jan-2021 12:02                3796
class.mongolog.php                                 24-Jan-2021 12:02               18032
class.mongomaxkey.php                              24-Jan-2021 12:02                5500
class.mongominkey.php                              24-Jan-2021 12:02                5495
class.mongopool.php                                24-Jan-2021 12:02                4064
class.mongoprotocolexception.php                   24-Jan-2021 12:02                5561
class.mongoregex.php                               24-Jan-2021 12:02                5086
class.mongoresultexception.php                     24-Jan-2021 12:02                4610
class.mongotimestamp.php                           24-Jan-2021 12:02                4262
class.mongowriteconcernexception.php               24-Jan-2021 12:02                4456
class.multipleiterator.php                         24-Jan-2021 12:02               10201
class.mutex.php                                    24-Jan-2021 12:02                4739
class.mysql-xdevapi-baseresult.php                 24-Jan-2021 12:02                2748
class.mysql-xdevapi-client.php                     24-Jan-2021 12:02                2891
class.mysql-xdevapi-collection.php                 24-Jan-2021 12:02               10016
class.mysql-xdevapi-collectionadd.php              24-Jan-2021 12:02                2763
class.mysql-xdevapi-collectionfind.php             24-Jan-2021 12:02                8417
class.mysql-xdevapi-collectionmodify.php           24-Jan-2021 12:02                9657
class.mysql-xdevapi-collectionremove.php           24-Jan-2021 12:02                5065
class.mysql-xdevapi-columnresult.php               24-Jan-2021 12:02                6017
class.mysql-xdevapi-crudoperationbindable.php      24-Jan-2021 12:02                2719
class.mysql-xdevapi-crudoperationlimitable.php     24-Jan-2021 12:02                2724
class.mysql-xdevapi-crudoperationskippable.php     24-Jan-2021 12:02                2735
class.mysql-xdevapi-crudoperationsortable.php      24-Jan-2021 12:02                2714
class.mysql-xdevapi-databaseobject.php             24-Jan-2021 12:02                3256
class.mysql-xdevapi-docresult.php                  24-Jan-2021 12:02                3714
class.mysql-xdevapi-exception.php                  24-Jan-2021 12:02                2005
class.mysql-xdevapi-executable.php                 24-Jan-2021 12:02                2429
class.mysql-xdevapi-executionstatus.php            24-Jan-2021 12:02                4721
class.mysql-xdevapi-expression.php                 24-Jan-2021 12:02                3004
class.mysql-xdevapi-result.php                     24-Jan-2021 12:02                4057
class.mysql-xdevapi-rowresult.php                  24-Jan-2021 12:02                4679
class.mysql-xdevapi-schema.php                     24-Jan-2021 12:02                7018
class.mysql-xdevapi-schemaobject.php               24-Jan-2021 12:02                2627
class.mysql-xdevapi-session.php                    24-Jan-2021 12:02                8578
class.mysql-xdevapi-sqlstatement.php               24-Jan-2021 12:02                6138
class.mysql-xdevapi-sqlstatementresult.php         24-Jan-2021 12:02                6687
class.mysql-xdevapi-statement.php                  24-Jan-2021 12:02                4536
class.mysql-xdevapi-table.php                      24-Jan-2021 12:02                7319
class.mysql-xdevapi-tabledelete.php                24-Jan-2021 12:02                4828
class.mysql-xdevapi-tableinsert.php                24-Jan-2021 12:02                3282
class.mysql-xdevapi-tableselect.php                24-Jan-2021 12:02                8001
class.mysql-xdevapi-tableupdate.php                24-Jan-2021 12:02                5808
class.mysql-xdevapi-warning.php                    24-Jan-2021 12:02                3591
class.mysqli-driver.php                            24-Jan-2021 12:02                7173
class.mysqli-result.php                            24-Jan-2021 12:02               10655
class.mysqli-sql-exception.php                     24-Jan-2021 12:02                3488
class.mysqli-stmt.php                              24-Jan-2021 12:02               16482
class.mysqli-warning.php                           24-Jan-2021 12:02                3562
class.mysqli.php                                   24-Jan-2021 12:02               31415
class.mysqlnduhconnection.php                      24-Jan-2021 12:02               35782
class.mysqlnduhpreparedstatement.php               24-Jan-2021 12:02                3649
class.norewinditerator.php                         24-Jan-2021 12:02                7475
class.normalizer.php                               24-Jan-2021 12:02                7885
class.numberformatter.php                          24-Jan-2021 12:02               38477
class.oauth.php                                    24-Jan-2021 12:02               16687
class.oauthexception.php                           24-Jan-2021 12:02                6629
class.oauthprovider.php                            24-Jan-2021 12:02               11584
class.outeriterator.php                            24-Jan-2021 12:02                4258
class.outofboundsexception.php                     24-Jan-2021 12:02                6472
class.outofrangeexception.php                      24-Jan-2021 12:02                6475
class.overflowexception.php                        24-Jan-2021 12:02                6396
class.parallel-channel.php                         24-Jan-2021 12:02                7975
class.parallel-events-event-type.php               24-Jan-2021 12:02                3236
class.parallel-events-event.php                    24-Jan-2021 12:02                3132
class.parallel-events-input.php                    24-Jan-2021 12:02                4325
class.parallel-events.php                          24-Jan-2021 12:02                6635
class.parallel-future.php                          24-Jan-2021 12:02                8086
class.parallel-runtime.php                         24-Jan-2021 12:02                6092
class.parallel-sync.php                            24-Jan-2021 12:02                5141
class.parentiterator.php                           24-Jan-2021 12:02                5585
class.parle-errorinfo.php                          24-Jan-2021 12:02                3541
class.parle-lexer.php                              24-Jan-2021 12:02               11829
class.parle-lexerexception.php                     24-Jan-2021 12:02                5845
class.parle-parser.php                             24-Jan-2021 12:02               14926
class.parle-parserexception.php                    24-Jan-2021 12:02                5826
class.parle-rlexer.php                             24-Jan-2021 12:02               13453
class.parle-rparser.php                            24-Jan-2021 12:02               15076
class.parle-stack.php                              24-Jan-2021 12:02                4529
class.parle-token.php                              24-Jan-2021 12:02                4333
class.parseerror.php                               24-Jan-2021 12:01                6021
class.pdo.php                                      24-Jan-2021 12:02                8696
class.pdoexception.php                             24-Jan-2021 12:02                6687
class.pdostatement.php                             24-Jan-2021 12:02               14092
class.phar.php                                     24-Jan-2021 12:02               36515
class.phardata.php                                 24-Jan-2021 12:02               21362
class.pharexception.php                            24-Jan-2021 12:02                5637
class.pharfileinfo.php                             24-Jan-2021 12:02               16839
class.php-user-filter.php                          24-Jan-2021 12:02                5028
class.phptoken.php                                 24-Jan-2021 12:02                7410
class.pht-atomicinteger.php                        24-Jan-2021 12:02                5846
class.pht-hashtable.php                            24-Jan-2021 12:02                4031
class.pht-queue.php                                24-Jan-2021 12:02                4841
class.pht-runnable.php                             24-Jan-2021 12:02                2461
class.pht-thread.php                               24-Jan-2021 12:02                5849
class.pht-threaded.php                             24-Jan-2021 12:02                3455
class.pht-vector.php                               24-Jan-2021 12:02                9233
class.pool.php                                     24-Jan-2021 12:02                7234
class.quickhashinthash.php                         24-Jan-2021 12:02               12486
class.quickhashintset.php                          24-Jan-2021 12:02               10729
class.quickhashintstringhash.php                   24-Jan-2021 12:02               13275
class.quickhashstringinthash.php                   24-Jan-2021 12:02               11342
class.rangeexception.php                           24-Jan-2021 12:02                6577
class.rararchive.php                               24-Jan-2021 12:02                6944
class.rarentry.php                                 24-Jan-2021 12:02               42452
class.rarexception.php                             24-Jan-2021 12:02                7670
class.recursivearrayiterator.php                   24-Jan-2021 12:02               14825
class.recursivecachingiterator.php                 24-Jan-2021 12:02               12797
class.recursivecallbackfilteriterator.php          24-Jan-2021 12:02               10253
class.recursivedirectoryiterator.php               24-Jan-2021 12:02               14149
class.recursivefilteriterator.php                  24-Jan-2021 12:02                7046
class.recursiveiterator.php                        24-Jan-2021 12:02                4748
class.recursiveiteratoriterator.php                24-Jan-2021 12:02               13618
class.recursiveregexiterator.php                   24-Jan-2021 12:02                9555
class.recursivetreeiterator.php                    24-Jan-2021 12:02               23467
class.reflection.php                               24-Jan-2021 12:02                3028
class.reflectionclass.php                          24-Jan-2021 12:02               29489
class.reflectionclassconstant.php                  24-Jan-2021 12:02               11177
class.reflectionexception.php                      24-Jan-2021 12:02                5579
class.reflectionextension.php                      24-Jan-2021 12:02                9018
class.reflectionfunction.php                       24-Jan-2021 12:02               15583
class.reflectionfunctionabstract.php               24-Jan-2021 12:02               14567
class.reflectiongenerator.php                      24-Jan-2021 12:02                4992
class.reflectionmethod.php                         24-Jan-2021 12:02               24256
class.reflectionobject.php                         24-Jan-2021 12:02               23194
class.reflectionparameter.php                      24-Jan-2021 12:02               12737
class.reflectionproperty.php                       24-Jan-2021 12:02               15852
class.reflectiontype.php                           24-Jan-2021 12:02                2711
class.reflectionzendextension.php                  24-Jan-2021 12:02                6298
class.reflector.php                                24-Jan-2021 12:02                2646
class.regexiterator.php                            24-Jan-2021 12:02               13344
class.resourcebundle.php                           24-Jan-2021 12:02                7475
class.rrdcreator.php                               24-Jan-2021 12:02                3942
class.rrdgraph.php                                 24-Jan-2021 12:02                3505
class.rrdupdater.php                               24-Jan-2021 12:02                2891
class.runtimeexception.php                         24-Jan-2021 12:02                6384
class.seaslog.php                                  24-Jan-2021 12:02               17992
class.seekableiterator.php                         24-Jan-2021 12:02               12745
class.serializable.php                             24-Jan-2021 12:01                7522
class.sessionhandler.php                           24-Jan-2021 12:02               26784
class.sessionhandlerinterface.php                  24-Jan-2021 12:02               15714
class.shmop.php                                    24-Jan-2021 12:02                1603
class.simplexmlelement.php                         24-Jan-2021 12:02               10722
class.simplexmliterator.php                        24-Jan-2021 12:02               12557
class.snmp.php                                     24-Jan-2021 12:02               23593
class.snmpexception.php                            24-Jan-2021 12:02                6549
class.soapclient.php                               24-Jan-2021 12:02               10811
class.soapfault.php                                24-Jan-2021 12:02                7865
class.soapheader.php                               24-Jan-2021 12:02                2892
class.soapparam.php                                24-Jan-2021 12:02                2481
class.soapserver.php                               24-Jan-2021 12:02                7750
class.soapvar.php                                  24-Jan-2021 12:02                3191
class.solrclient.php                               24-Jan-2021 12:02               21578
class.solrclientexception.php                      24-Jan-2021 12:02                7551
class.solrcollapsefunction.php                     24-Jan-2021 12:02               10522
class.solrdismaxquery.php                          24-Jan-2021 12:02               98731
class.solrdocument.php                             24-Jan-2021 12:02               20640
class.solrdocumentfield.php                        24-Jan-2021 12:02                4361
class.solrexception.php                            24-Jan-2021 12:02                7990
class.solrgenericresponse.php                      24-Jan-2021 12:02               11164
class.solrillegalargumentexception.php             24-Jan-2021 12:02                7666
class.solrillegaloperationexception.php            24-Jan-2021 12:02                7703
class.solrinputdocument.php                        24-Jan-2021 12:02               16938
class.solrmissingmandatoryparameterexception.php   24-Jan-2021 12:02                6842
class.solrmodifiableparams.php                     24-Jan-2021 12:02                8021
class.solrobject.php                               24-Jan-2021 12:02                5349
class.solrparams.php                               24-Jan-2021 12:02                8140
class.solrpingresponse.php                         24-Jan-2021 12:02               10196
class.solrquery.php                                24-Jan-2021 12:02              107025
class.solrqueryresponse.php                        24-Jan-2021 12:02               11093
class.solrresponse.php                             24-Jan-2021 12:02               12905
class.solrserverexception.php                      24-Jan-2021 12:02                7557
class.solrupdateresponse.php                       24-Jan-2021 12:02               11136
class.solrutils.php                                24-Jan-2021 12:02                4348
class.sphinxclient.php                             24-Jan-2021 12:02               21752
class.splbool.php                                  24-Jan-2021 12:02                5458
class.spldoublylinkedlist.php                      24-Jan-2021 12:02               17574
class.splenum.php                                  24-Jan-2021 12:02                8726
class.splfileinfo.php                              24-Jan-2021 12:02               13776
class.splfileobject.php                            24-Jan-2021 12:02               28565
class.splfixedarray.php                            24-Jan-2021 12:02               16140
class.splfloat.php                                 24-Jan-2021 12:02                5342
class.splheap.php                                  24-Jan-2021 12:02                8188
class.splint.php                                   24-Jan-2021 12:02                4865
class.splmaxheap.php                               24-Jan-2021 12:02                7555
class.splminheap.php                               24-Jan-2021 12:02                7565
class.splobjectstorage.php                         24-Jan-2021 12:02               20247
class.splobserver.php                              24-Jan-2021 12:02                2634
class.splpriorityqueue.php                         24-Jan-2021 12:02               10015
class.splqueue.php                                 24-Jan-2021 12:02               13377
class.splstack.php                                 24-Jan-2021 12:02               12460
class.splstring.php                                24-Jan-2021 12:02                5028
class.splsubject.php                               24-Jan-2021 12:02                3565
class.spltempfileobject.php                        24-Jan-2021 12:02               15880
class.spltype.php                                  24-Jan-2021 12:02                3258
class.spoofchecker.php                             24-Jan-2021 12:02               13236
class.sqlite3.php                                  24-Jan-2021 12:02               14625
class.sqlite3result.php                            24-Jan-2021 12:02                4767
class.sqlite3stmt.php                              24-Jan-2021 12:02                6611
class.stomp.php                                    24-Jan-2021 12:02               10064
class.stompexception.php                           24-Jan-2021 12:02                5291
class.stompframe.php                               24-Jan-2021 12:02                3947
class.streamwrapper.php                            24-Jan-2021 12:02               16820
class.svm.php                                      24-Jan-2021 12:02               15846
class.svmmodel.php                                 24-Jan-2021 12:02                6033
class.swoole-async.php                             24-Jan-2021 12:02                6699
class.swoole-atomic.php                            24-Jan-2021 12:02                4326
class.swoole-buffer.php                            24-Jan-2021 12:02                6507
class.swoole-channel.php                           24-Jan-2021 12:02                3621
class.swoole-client.php                            24-Jan-2021 12:02               14366
class.swoole-connection-iterator.php               24-Jan-2021 12:02                7111
class.swoole-coroutine.php                         24-Jan-2021 12:02               20453
class.swoole-event.php                             24-Jan-2021 12:02                6356
class.swoole-exception.php                         24-Jan-2021 12:02                2953
class.swoole-http-client.php                       24-Jan-2021 12:02               12791
class.swoole-http-request.php                      24-Jan-2021 12:02                2728
class.swoole-http-response.php                     24-Jan-2021 12:02                9127
class.swoole-http-server.php                       24-Jan-2021 12:02               21883
class.swoole-lock.php                              24-Jan-2021 12:02                4372
class.swoole-mmap.php                              24-Jan-2021 12:02                2719
class.swoole-mysql-exception.php                   24-Jan-2021 12:02                2988
class.swoole-mysql.php                             24-Jan-2021 12:02                5071
class.swoole-process.php                           24-Jan-2021 12:02               12062
class.swoole-redis-server.php                      24-Jan-2021 12:02               26475
class.swoole-serialize.php                         24-Jan-2021 12:02                3240
class.swoole-server.php                            24-Jan-2021 12:02               25108
class.swoole-table.php                             24-Jan-2021 12:02               11152
class.swoole-timer.php                             24-Jan-2021 12:02                4404
class.swoole-websocket-frame.php                   24-Jan-2021 12:02                1712
class.swoole-websocket-server.php                  24-Jan-2021 12:02                6735
class.syncevent.php                                24-Jan-2021 12:02                4209
class.syncmutex.php                                24-Jan-2021 12:02                3674
class.syncreaderwriter.php                         24-Jan-2021 12:02                4603
class.syncsemaphore.php                            24-Jan-2021 12:02                4004
class.syncsharedmemory.php                         24-Jan-2021 12:02                4875
class.thread.php                                   24-Jan-2021 12:02               13129
class.threaded.php                                 24-Jan-2021 12:02               10244
class.tidy.php                                     24-Jan-2021 12:02               14149
class.tidynode.php                                 24-Jan-2021 12:02               10067
class.tokyotyrant.php                              24-Jan-2021 12:02               40014
class.tokyotyrantexception.php                     24-Jan-2021 12:02                6369
class.tokyotyrantiterator.php                      24-Jan-2021 12:02               17405
class.tokyotyrantquery.php                         24-Jan-2021 12:02                8537
class.tokyotyranttable.php                         24-Jan-2021 12:02               21754
class.transliterator.php                           24-Jan-2021 12:02                8025
class.traversable.php                              24-Jan-2021 12:01                2739
class.typeerror.php                                24-Jan-2021 12:01                5770
class.uconverter.php                               24-Jan-2021 12:02               31513
class.ui-area.php                                  24-Jan-2021 12:02               11150
class.ui-control.php                               24-Jan-2021 12:02                5200
class.ui-controls-box.php                          24-Jan-2021 12:02                9208
class.ui-controls-button.php                       24-Jan-2021 12:02                6265
class.ui-controls-check.php                        24-Jan-2021 12:02                7020
class.ui-controls-colorbutton.php                  24-Jan-2021 12:02                6296
class.ui-controls-combo.php                        24-Jan-2021 12:02                6238
class.ui-controls-editablecombo.php                24-Jan-2021 12:02                6338
class.ui-controls-entry.php                        24-Jan-2021 12:02                8781
class.ui-controls-form.php                         24-Jan-2021 12:02                7362
class.ui-controls-grid.php                         24-Jan-2021 12:02               11170
class.ui-controls-group.php                        24-Jan-2021 12:02                7853
class.ui-controls-label.php                        24-Jan-2021 12:02                6004
class.ui-controls-multilineentry.php               24-Jan-2021 12:02                9058
class.ui-controls-picker.php                       24-Jan-2021 12:02                6879
class.ui-controls-progress.php                     24-Jan-2021 12:02                5552
class.ui-controls-radio.php                        24-Jan-2021 12:02                6217
class.ui-controls-separator.php                    24-Jan-2021 12:02                6483
class.ui-controls-slider.php                       24-Jan-2021 12:02                6552
class.ui-controls-spin.php                         24-Jan-2021 12:02                6424
class.ui-controls-tab.php                          24-Jan-2021 12:02                8325
class.ui-draw-brush-gradient.php                   24-Jan-2021 12:02                6308
class.ui-draw-brush-lineargradient.php             24-Jan-2021 12:02                5638
class.ui-draw-brush-radialgradient.php             24-Jan-2021 12:02                5770
class.ui-draw-brush.php                            24-Jan-2021 12:02                4104
class.ui-draw-color.php                            24-Jan-2021 12:02                7695
class.ui-draw-line-cap.php                         24-Jan-2021 12:02                2292
class.ui-draw-line-join.php                        24-Jan-2021 12:02                2251
class.ui-draw-matrix.php                           24-Jan-2021 12:02                5380
class.ui-draw-path.php                             24-Jan-2021 12:02                8942
class.ui-draw-pen.php                              24-Jan-2021 12:02                7973
class.ui-draw-stroke.php                           24-Jan-2021 12:02                5974
class.ui-draw-text-font-descriptor.php             24-Jan-2021 12:02                5169
class.ui-draw-text-font-italic.php                 24-Jan-2021 12:02                2492
class.ui-draw-text-font-stretch.php                24-Jan-2021 12:02                3992
class.ui-draw-text-font-weight.php                 24-Jan-2021 12:02                3940
class.ui-draw-text-font.php                        24-Jan-2021 12:02                4427
class.ui-draw-text-layout.php                      24-Jan-2021 12:02                4655
class.ui-exception-invalidargumentexception.php    24-Jan-2021 12:02                5849
class.ui-exception-runtimeexception.php            24-Jan-2021 12:02                5780
class.ui-executor.php                              24-Jan-2021 12:02                4792
class.ui-key.php                                   24-Jan-2021 12:02                9430
class.ui-menu.php                                  24-Jan-2021 12:02                5692
class.ui-menuitem.php                              24-Jan-2021 12:02                3477
class.ui-point.php                                 24-Jan-2021 12:02                5782
class.ui-size.php                                  24-Jan-2021 12:02                5886
class.ui-window.php                                24-Jan-2021 12:02               12039
class.underflowexception.php                       24-Jan-2021 12:02                6466
class.unexpectedvalueexception.php                 24-Jan-2021 12:02                6617
class.v8js.php                                     24-Jan-2021 12:02                7479
class.v8jsexception.php                            24-Jan-2021 12:02                9255
class.variant.php                                  24-Jan-2021 12:02                5406
class.varnishadmin.php                             24-Jan-2021 12:02               10011
class.varnishlog.php                               24-Jan-2021 12:02               28781
class.varnishstat.php                              24-Jan-2021 12:02                2684
class.volatile.php                                 24-Jan-2021 12:02               13095
class.vtiful-kernel-excel.php                      24-Jan-2021 12:02               10186
class.vtiful-kernel-format.php                     24-Jan-2021 12:02               13309
class.weakmap.php                                  24-Jan-2021 12:01                9404
class.weakref.php                                  24-Jan-2021 12:01                7407
class.win32serviceexception.php                    24-Jan-2021 12:02                5906
class.wkhtmltox-image-converter.php                24-Jan-2021 12:02                3662
class.wkhtmltox-pdf-converter.php                  24-Jan-2021 12:02                4028
class.wkhtmltox-pdf-object.php                     24-Jan-2021 12:02                2651
class.worker.php                                   24-Jan-2021 12:02                9083
class.xmldiff-base.php                             24-Jan-2021 12:02                4105
class.xmldiff-dom.php                              24-Jan-2021 12:02                5482
class.xmldiff-file.php                             24-Jan-2021 12:02                5097
class.xmldiff-memory.php                           24-Jan-2021 12:02                5127
class.xmlreader.php                                24-Jan-2021 12:02               33583
class.xmlwriter.php                                24-Jan-2021 12:02               24694
class.xsltprocessor.php                            24-Jan-2021 12:02                8972
class.yac.php                                      24-Jan-2021 12:02                8414
class.yaconf.php                                   24-Jan-2021 12:02                3187
class.yaf-action-abstract.php                      24-Jan-2021 12:02               12651
class.yaf-application.php                          24-Jan-2021 12:02               12339
class.yaf-bootstrap-abstract.php                   24-Jan-2021 12:02                5938
class.yaf-config-abstract.php                      24-Jan-2021 12:02                4955
class.yaf-config-ini.php                           24-Jan-2021 12:02               16532
class.yaf-config-simple.php                        24-Jan-2021 12:02               12630
class.yaf-controller-abstract.php                  24-Jan-2021 12:02               18442
class.yaf-dispatcher.php                           24-Jan-2021 12:02               19552
class.yaf-exception-dispatchfailed.php             24-Jan-2021 12:02                2617
class.yaf-exception-loadfailed-action.php          24-Jan-2021 12:02                2685
class.yaf-exception-loadfailed-controller.php      24-Jan-2021 12:02                2706
class.yaf-exception-loadfailed-module.php          24-Jan-2021 12:02                2674
class.yaf-exception-loadfailed-view.php            24-Jan-2021 12:02                2616
class.yaf-exception-loadfailed.php                 24-Jan-2021 12:02                2595
class.yaf-exception-routerfailed.php               24-Jan-2021 12:02                2604
class.yaf-exception-startuperror.php               24-Jan-2021 12:02                2602
class.yaf-exception-typeerror.php                  24-Jan-2021 12:02                2576
class.yaf-exception.php                            24-Jan-2021 12:02                7036
class.yaf-loader.php                               24-Jan-2021 12:02               17137
class.yaf-plugin-abstract.php                      24-Jan-2021 12:02               17973
class.yaf-registry.php                             24-Jan-2021 12:02                5705
class.yaf-request-abstract.php                     24-Jan-2021 12:02               21394
class.yaf-request-http.php                         24-Jan-2021 12:02               19258
class.yaf-request-simple.php                       24-Jan-2021 12:02               19063
class.yaf-response-abstract.php                    24-Jan-2021 12:02               10300
class.yaf-route-interface.php                      24-Jan-2021 12:02                3361
class.yaf-route-map.php                            24-Jan-2021 12:02                4899
class.yaf-route-regex.php                          24-Jan-2021 12:02                7155
class.yaf-route-rewrite.php                        24-Jan-2021 12:02                6618
class.yaf-route-simple.php                         24-Jan-2021 12:02                5858
class.yaf-route-static.php                         24-Jan-2021 12:02                4353
class.yaf-route-supervar.php                       24-Jan-2021 12:02                4299
class.yaf-router.php                               24-Jan-2021 12:02               10703
class.yaf-session.php                              24-Jan-2021 12:02               11738
class.yaf-view-interface.php                       24-Jan-2021 12:02                5312
class.yaf-view-simple.php                          24-Jan-2021 12:02                9978
class.yar-client-exception.php                     24-Jan-2021 12:02                6067
class.yar-client.php                               24-Jan-2021 12:02                5156
class.yar-concurrent-client.php                    24-Jan-2021 12:02                5943
class.yar-server-exception.php                     24-Jan-2021 12:02                6511
class.yar-server.php                               24-Jan-2021 12:02                3183
class.ziparchive.php                               24-Jan-2021 12:02               34821
class.zmq.php                                      24-Jan-2021 12:02               33138
class.zmqcontext.php                               24-Jan-2021 12:02                4993
class.zmqdevice.php                                24-Jan-2021 12:02                6802
class.zmqpoll.php                                  24-Jan-2021 12:02                4668
class.zmqsocket.php                                24-Jan-2021 12:02                9968
class.zookeeper.php                                24-Jan-2021 12:02               47682
class.zookeeperauthenticationexception.php         24-Jan-2021 12:02                5779
class.zookeeperconfig.php                          24-Jan-2021 12:02                5321
class.zookeeperconnectionexception.php             24-Jan-2021 12:02                5778
class.zookeeperexception.php                       24-Jan-2021 12:02                5654
class.zookeepermarshallingexception.php            24-Jan-2021 12:02                5798
class.zookeepernonodeexception.php                 24-Jan-2021 12:02                5770
class.zookeeperoperationtimeoutexception.php       24-Jan-2021 12:02                5803
class.zookeepersessionexception.php                24-Jan-2021 12:02                5723
classkit.configuration.php                         24-Jan-2021 12:02                1103
classkit.constants.php                             24-Jan-2021 12:02                1887
classkit.installation.php                          24-Jan-2021 12:02                1343
classkit.requirements.php                          24-Jan-2021 12:02                1045
classkit.resources.php                             24-Jan-2021 12:02                1063
classkit.setup.php                                 24-Jan-2021 12:02                1436
classobj.configuration.php                         24-Jan-2021 12:02                1106
classobj.constants.php                             24-Jan-2021 12:02                1024
classobj.examples.php                              24-Jan-2021 12:02               14383
classobj.installation.php                          24-Jan-2021 12:02                1085
classobj.requirements.php                          24-Jan-2021 12:02                1045
classobj.resources.php                             24-Jan-2021 12:02                1063
classobj.setup.php                                 24-Jan-2021 12:02                1424
closure.bind.php                                   24-Jan-2021 12:01                7617
closure.bindto.php                                 24-Jan-2021 12:01                8485
closure.construct.php                              24-Jan-2021 12:01                2465
cmark.installation.php                             24-Jan-2021 12:02                1831
cmark.requirements.php                             24-Jan-2021 12:02                1155
cmark.setup.php                                    24-Jan-2021 12:02                1268
collator.asort.php                                 24-Jan-2021 12:02                8753
collator.compare.php                               24-Jan-2021 12:02                8138
collator.construct.php                             24-Jan-2021 12:02                5381
collator.create.php                                24-Jan-2021 12:02                5095
collator.getattribute.php                          24-Jan-2021 12:02                5528
collator.geterrorcode.php                          24-Jan-2021 12:02                4776
collator.geterrormessage.php                       24-Jan-2021 12:02                4835
collator.getlocale.php                             24-Jan-2021 12:02                6258
collator.getsortkey.php                            24-Jan-2021 12:02                6840
collator.getstrength.php                           24-Jan-2021 12:02                4654
collator.setattribute.php                          24-Jan-2021 12:02                6271
collator.setstrength.php                           24-Jan-2021 12:02               12471
collator.sort.php                                  24-Jan-2021 12:02                7516
collator.sortwithsortkeys.php                      24-Jan-2021 12:02                6095
collectable.isgarbage.php                          24-Jan-2021 12:02                2185
collectable.setgarbage.php                         24-Jan-2021 12:02                2377
com.configuration.php                              24-Jan-2021 12:02                6824
com.constants.php                                  24-Jan-2021 12:02                8971
com.construct.php                                  24-Jan-2021 12:02                7760
com.error-handling.php                             24-Jan-2021 12:02                1431
com.examples.arrays.php                            24-Jan-2021 12:02                1974
com.examples.foreach.php                           24-Jan-2021 12:02                2875
com.examples.php                                   24-Jan-2021 12:02                1308
com.installation.php                               24-Jan-2021 12:02                1455
com.requirements.php                               24-Jan-2021 12:02                1117
com.resources.php                                  24-Jan-2021 12:02                1033
com.setup.php                                      24-Jan-2021 12:02                1387
commonmark-cql.construct.php                       24-Jan-2021 12:02                2028
commonmark-cql.invoke.php                          24-Jan-2021 12:02                3678
commonmark-interfaces-ivisitable.accept.php        24-Jan-2021 12:02                2960
commonmark-interfaces-ivisitor.enter.php           24-Jan-2021 12:02                3834
commonmark-interfaces-ivisitor.leave.php           24-Jan-2021 12:02                3836
commonmark-node-bulletlist.construct.php           24-Jan-2021 12:02                2858
commonmark-node-codeblock.construct.php            24-Jan-2021 12:02                2559
commonmark-node-heading.construct.php              24-Jan-2021 12:02                2400
commonmark-node-image.construct.php                24-Jan-2021 12:02                2973
commonmark-node-link.construct.php                 24-Jan-2021 12:02                2971
commonmark-node-orderedlist.construct.php          24-Jan-2021 12:02                3710
commonmark-node-text.construct.php                 24-Jan-2021 12:02                2457
commonmark-node.accept.php                         24-Jan-2021 12:02                2717
commonmark-node.appendchild.php                    24-Jan-2021 12:02                2544
commonmark-node.insertafter.php                    24-Jan-2021 12:02                2569
commonmark-node.insertbefore.php                   24-Jan-2021 12:02                2566
commonmark-node.prependchild.php                   24-Jan-2021 12:02                2570
commonmark-node.replace.php                        24-Jan-2021 12:02                2519
commonmark-node.unlink.php                         24-Jan-2021 12:02                2177
commonmark-parser.construct.php                    24-Jan-2021 12:02                3100
commonmark-parser.finish.php                       24-Jan-2021 12:02                2230
commonmark-parser.parse.php                        24-Jan-2021 12:02                2393
compersisthelper.construct.php                     24-Jan-2021 12:02                3309
compersisthelper.getcurfilename.php                24-Jan-2021 12:02                2866
compersisthelper.getmaxstreamsize.php              24-Jan-2021 12:02                2902
compersisthelper.initnew.php                       24-Jan-2021 12:02                2756
compersisthelper.loadfromfile.php                  24-Jan-2021 12:02                3873
compersisthelper.loadfromstream.php                24-Jan-2021 12:02                3142
compersisthelper.savetofile.php                    24-Jan-2021 12:02                5722
compersisthelper.savetostream.php                  24-Jan-2021 12:02                3167
componere-abstract-definition.addinterface.php     24-Jan-2021 12:01                3125
componere-abstract-definition.addmethod.php        24-Jan-2021 12:01                3899
componere-abstract-definition.addtrait.php         24-Jan-2021 12:01                3081
componere-abstract-definition.getreflector.php     24-Jan-2021 12:01                2242
componere-definition.addconstant.php               24-Jan-2021 12:01                4192
componere-definition.addproperty.php               24-Jan-2021 12:01                3601
componere-definition.construct.php                 24-Jan-2021 12:01                5407
componere-definition.getclosure.php                24-Jan-2021 12:01                3267
componere-definition.getclosures.php               24-Jan-2021 12:01                2513
componere-definition.isregistered.php              24-Jan-2021 12:01                2074
componere-definition.register.php                  24-Jan-2021 12:01                2302
componere-method.construct.php                     24-Jan-2021 12:01                2078
componere-method.getreflector.php                  24-Jan-2021 12:01                2062
componere-method.setprivate.php                    24-Jan-2021 12:01                2321
componere-method.setprotected.php                  24-Jan-2021 12:01                2334
componere-method.setstatic.php                     24-Jan-2021 12:01                1919
componere-patch.apply.php                          24-Jan-2021 12:01                1731
componere-patch.construct.php                      24-Jan-2021 12:01                3335
componere-patch.derive.php                         24-Jan-2021 12:01                3060
componere-patch.getclosure.php                     24-Jan-2021 12:01                2861
componere-patch.getclosures.php                    24-Jan-2021 12:01                2002
componere-patch.isapplied.php                      24-Jan-2021 12:01                1651
componere-patch.revert.php                         24-Jan-2021 12:01                1731
componere-value.construct.php                      24-Jan-2021 12:01                2512
componere-value.hasdefault.php                     24-Jan-2021 12:01                1694
componere-value.isprivate.php                      24-Jan-2021 12:01                1716
componere-value.isprotected.php                    24-Jan-2021 12:01                1724
componere-value.isstatic.php                       24-Jan-2021 12:01                1711
componere-value.setprivate.php                     24-Jan-2021 12:01                2344
componere-value.setprotected.php                   24-Jan-2021 12:01                2356
componere-value.setstatic.php                      24-Jan-2021 12:01                1936
componere.cast.php                                 24-Jan-2021 12:01                4773
componere.cast_by_ref.php                          24-Jan-2021 12:01                4935
componere.installation.php                         24-Jan-2021 12:01                1199
componere.requirements.php                         24-Jan-2021 12:01                1041
componere.setup.php                                24-Jan-2021 12:01                1303
cond.broadcast.php                                 24-Jan-2021 12:02                4609
cond.create.php                                    24-Jan-2021 12:02                3912
cond.destroy.php                                   24-Jan-2021 12:02                4627
cond.signal.php                                    24-Jan-2021 12:02                4430
cond.wait.php                                      24-Jan-2021 12:02                6198
configuration.changes.modes.php                    24-Jan-2021 12:01                3409
configuration.changes.php                          24-Jan-2021 12:01                7654
configuration.file.per-user.php                    24-Jan-2021 12:01                2823
configuration.file.php                             24-Jan-2021 12:01               10827
configuration.php                                  24-Jan-2021 12:01                1489
configure.about.php                                24-Jan-2021 12:02               16298
configure.php                                      24-Jan-2021 12:02                1240
constants.dbx.php                                  24-Jan-2021 12:02                5790
context.curl.php                                   24-Jan-2021 12:01                8431
context.ftp.php                                    24-Jan-2021 12:01                3885
context.http.php                                   24-Jan-2021 12:01               16877
context.mongodb.php                                24-Jan-2021 12:01                5628
context.params.php                                 24-Jan-2021 12:01                2362
context.phar.php                                   24-Jan-2021 12:01                2763
context.php                                        24-Jan-2021 12:01                2832
context.socket.php                                 24-Jan-2021 12:01               10314
context.ssl.php                                    24-Jan-2021 12:01               12054
context.zip.php                                    24-Jan-2021 12:01                4257
control-structures.alternative-syntax.php          24-Jan-2021 12:01                6850
control-structures.break.php                       24-Jan-2021 12:01                5789
control-structures.continue.php                    24-Jan-2021 12:01                7756
control-structures.declare.php                     24-Jan-2021 12:01               11200
control-structures.do.while.php                    24-Jan-2021 12:01                5129
control-structures.else.php                        24-Jan-2021 12:01                2843
control-structures.elseif.php                      24-Jan-2021 12:01                7565
control-structures.for.php                         24-Jan-2021 12:01               12135
control-structures.foreach.php                     24-Jan-2021 12:01               22246
control-structures.goto.php                        24-Jan-2021 12:01                6986
control-structures.if.php                          24-Jan-2021 12:01                4385
control-structures.intro.php                       24-Jan-2021 12:01                2161
control-structures.match.php                       24-Jan-2021 12:01               17403
control-structures.switch.php                      24-Jan-2021 12:01               15614
control-structures.while.php                       24-Jan-2021 12:01                4451
copyright.php                                      24-Jan-2021 12:01                1772
countable.count.php                                24-Jan-2021 12:02                5308
csprng.configuration.php                           24-Jan-2021 12:02                1094
csprng.constants.php                               24-Jan-2021 12:02                1010
csprng.installation.php                            24-Jan-2021 12:02                1073
csprng.requirements.php                            24-Jan-2021 12:02                1033
csprng.resources.php                               24-Jan-2021 12:02                1051
csprng.setup.php                                   24-Jan-2021 12:02                1398
ctype.configuration.php                            24-Jan-2021 12:02                1088
ctype.constants.php                                24-Jan-2021 12:02                1002
ctype.installation.php                             24-Jan-2021 12:02                1237
ctype.requirements.php                             24-Jan-2021 12:02                1061
ctype.resources.php                                24-Jan-2021 12:02                1045
ctype.setup.php                                    24-Jan-2021 12:02                1394
cubrid.configuration.php                           24-Jan-2021 12:02                1041
cubrid.constants.php                               24-Jan-2021 12:02               13615
cubrid.examples.php                                24-Jan-2021 12:02               20946
cubrid.installation.php                            24-Jan-2021 12:02                1864
cubrid.requirements.php                            24-Jan-2021 12:02                1091
cubrid.resources.php                               24-Jan-2021 12:02                2904
cubrid.setup.php                                   24-Jan-2021 12:02                1406
cubridmysql.cubrid.php                             24-Jan-2021 12:02                4796
curl.configuration.php                             24-Jan-2021 12:02                2174
curl.constants.php                                 24-Jan-2021 12:02              101001
curl.examples-basic.php                            24-Jan-2021 12:02                4435
curl.examples.php                                  24-Jan-2021 12:02                1228
curl.installation.php                              24-Jan-2021 12:02                2450
curl.requirements.php                              24-Jan-2021 12:02                1169
curl.resources.php                                 24-Jan-2021 12:02                1082
curl.setup.php                                     24-Jan-2021 12:02                1405
curlfile.construct.php                             24-Jan-2021 12:02               10092
curlfile.getfilename.php                           24-Jan-2021 12:02                1976
curlfile.getmimetype.php                           24-Jan-2021 12:02                1990
curlfile.getpostfilename.php                       24-Jan-2021 12:02                2026
curlfile.setmimetype.php                           24-Jan-2021 12:02                2229
curlfile.setpostfilename.php                       24-Jan-2021 12:02                2238
dateinterval.construct.php                         24-Jan-2021 12:02                7937
dateinterval.createfromdatestring.php              24-Jan-2021 12:02                8308
dateinterval.format.php                            24-Jan-2021 12:02               14176
dateperiod.construct.php                           24-Jan-2021 12:02               13150
dateperiod.getdateinterval.php                     24-Jan-2021 12:02                4423
dateperiod.getenddate.php                          24-Jan-2021 12:02                7240
dateperiod.getrecurrences.php                      24-Jan-2021 12:02                2483
dateperiod.getstartdate.php                        24-Jan-2021 12:02                4790
datetime.add.php                                   24-Jan-2021 12:02               12324
datetime.configuration.php                         24-Jan-2021 12:02                4737
datetime.constants.php                             24-Jan-2021 12:02                2431
datetime.construct.php                             24-Jan-2021 12:02               16187
datetime.createfromformat.php                      24-Jan-2021 12:02               28054
datetime.createfromimmutable.php                   24-Jan-2021 12:02                4060
datetime.createfrominterface.php                   24-Jan-2021 12:02                4678
datetime.diff.php                                  24-Jan-2021 12:02               12024
datetime.examples-arithmetic.php                   24-Jan-2021 12:02               15868
datetime.examples.php                              24-Jan-2021 12:02                1286
datetime.format.php                                24-Jan-2021 12:02               20359
datetime.formats.compound.php                      24-Jan-2021 12:02                9203
datetime.formats.date.php                          24-Jan-2021 12:02               13397
datetime.formats.php                               24-Jan-2021 12:02                2728
datetime.formats.relative.php                      24-Jan-2021 12:02               14944
datetime.formats.time.php                          24-Jan-2021 12:02                7221
datetime.getlasterrors.php                         24-Jan-2021 12:02                5608
datetime.getoffset.php                             24-Jan-2021 12:02                8033
datetime.gettimestamp.php                          24-Jan-2021 12:02                6421
datetime.gettimezone.php                           24-Jan-2021 12:02                7463
datetime.installation.php                          24-Jan-2021 12:02                1912
datetime.modify.php                                24-Jan-2021 12:02                9715
datetime.requirements.php                          24-Jan-2021 12:02                1045
datetime.resources.php                             24-Jan-2021 12:02                1063
datetime.set-state.php                             24-Jan-2021 12:02                2427
datetime.setdate.php                               24-Jan-2021 12:02               10166
datetime.setisodate.php                            24-Jan-2021 12:02               13250
datetime.settime.php                               24-Jan-2021 12:02               13870
datetime.settimestamp.php                          24-Jan-2021 12:02                9125
datetime.settimezone.php                           24-Jan-2021 12:02                8366
datetime.setup.php                                 24-Jan-2021 12:02                1459
datetime.sub.php                                   24-Jan-2021 12:02               12268
datetime.wakeup.php                                24-Jan-2021 12:02                2816
datetimeimmutable.add.php                          24-Jan-2021 12:02                2200
datetimeimmutable.construct.php                    24-Jan-2021 12:02                3478
datetimeimmutable.createfromformat.php             24-Jan-2021 12:02                3974
datetimeimmutable.createfrominterface.php          24-Jan-2021 12:02                4933
datetimeimmutable.createfrommutable.php            24-Jan-2021 12:02                4212
datetimeimmutable.getlasterrors.php                24-Jan-2021 12:02                2138
datetimeimmutable.modify.php                       24-Jan-2021 12:02                3207
datetimeimmutable.set-state.php                    24-Jan-2021 12:02                2182
datetimeimmutable.setdate.php                      24-Jan-2021 12:02                2328
datetimeimmutable.setisodate.php                   24-Jan-2021 12:02                2389
datetimeimmutable.settime.php                      24-Jan-2021 12:02                2522
datetimeimmutable.settimestamp.php                 24-Jan-2021 12:02                2199
datetimeimmutable.settimezone.php                  24-Jan-2021 12:02                2225
datetimeimmutable.sub.php                          24-Jan-2021 12:02                2207
datetimezone.construct.php                         24-Jan-2021 12:02                5804
datetimezone.getlocation.php                       24-Jan-2021 12:02                4775
datetimezone.getname.php                           24-Jan-2021 12:02                2828
datetimezone.getoffset.php                         24-Jan-2021 12:02                7042
datetimezone.gettransitions.php                    24-Jan-2021 12:02                7846
datetimezone.listabbreviations.php                 24-Jan-2021 12:02                4818
datetimezone.listidentifiers.php                   24-Jan-2021 12:02                6802
dba.configuration.php                              24-Jan-2021 12:02                2015
dba.constants.php                                  24-Jan-2021 12:02                 987
dba.example.php                                    24-Jan-2021 12:02                6610
dba.examples.php                                   24-Jan-2021 12:02                1192
dba.installation.php                               24-Jan-2021 12:02                9315
dba.requirements.php                               24-Jan-2021 12:02                7104
dba.resources.php                                  24-Jan-2021 12:02                1321
dba.setup.php                                      24-Jan-2021 12:02                1388
dbase.configuration.php                            24-Jan-2021 12:02                1088
dbase.constants.php                                24-Jan-2021 12:02                2870
dbase.installation.php                             24-Jan-2021 12:02                1379
dbase.requirements.php                             24-Jan-2021 12:02                1027
dbase.resources.php                                24-Jan-2021 12:02                1331
dbase.setup.php                                    24-Jan-2021 12:02                1407
dbplus.configuration.php                           24-Jan-2021 12:02                1094
dbplus.constants.php                               24-Jan-2021 12:02                1384
dbplus.errorcodes.php                              24-Jan-2021 12:02               10400
dbplus.installation.php                            24-Jan-2021 12:02                2436
dbplus.requirements.php                            24-Jan-2021 12:02                1663
dbplus.resources.php                               24-Jan-2021 12:02                1373
dbplus.setup.php                                   24-Jan-2021 12:02                1417
dbx.configuration.php                              24-Jan-2021 12:02                2351
dbx.installation.php                               24-Jan-2021 12:02                1971
dbx.requirements.php                               24-Jan-2021 12:02                2252
dbx.resources.php                                  24-Jan-2021 12:02                1236
dbx.setup.php                                      24-Jan-2021 12:02                1389
debugger-about.php                                 24-Jan-2021 12:02                1675
debugger.php                                       24-Jan-2021 12:02                1235
dio.configuration.php                              24-Jan-2021 12:02                1076
dio.constants.php                                  24-Jan-2021 12:02                7046
dio.installation.php                               24-Jan-2021 12:02                1801
dio.requirements.php                               24-Jan-2021 12:02                1015
dio.resources.php                                  24-Jan-2021 12:02                1179
dio.setup.php                                      24-Jan-2021 12:02                1389
dir.configuration.php                              24-Jan-2021 12:02                1076
dir.constants.php                                  24-Jan-2021 12:02                1643
dir.installation.php                               24-Jan-2021 12:02                1055
dir.requirements.php                               24-Jan-2021 12:02                1015
dir.resources.php                                  24-Jan-2021 12:02                1033
dir.setup.php                                      24-Jan-2021 12:02                1380
directory.close.php                                24-Jan-2021 12:02                1973
directory.read.php                                 24-Jan-2021 12:02                1957
directory.rewind.php                               24-Jan-2021 12:02                1982
directoryiterator.construct.php                    24-Jan-2021 12:02                4833
directoryiterator.current.php                      24-Jan-2021 12:02                6058
directoryiterator.getatime.php                     24-Jan-2021 12:02                5484
directoryiterator.getbasename.php                  24-Jan-2021 12:02                6508
directoryiterator.getctime.php                     24-Jan-2021 12:02                5586
directoryiterator.getextension.php                 24-Jan-2021 12:02                6026
directoryiterator.getfilename.php                  24-Jan-2021 12:02                5145
directoryiterator.getgroup.php                     24-Jan-2021 12:02                5593
directoryiterator.getinode.php                     24-Jan-2021 12:02                4468
directoryiterator.getmtime.php                     24-Jan-2021 12:02                5473
directoryiterator.getowner.php                     24-Jan-2021 12:02                5009
directoryiterator.getpath.php                      24-Jan-2021 12:02                4580
directoryiterator.getpathname.php                  24-Jan-2021 12:02                5026
directoryiterator.getperms.php                     24-Jan-2021 12:02                5933
directoryiterator.getsize.php                      24-Jan-2021 12:02                4727
directoryiterator.gettype.php                      24-Jan-2021 12:02                5539
directoryiterator.isdir.php                        24-Jan-2021 12:02                5385
directoryiterator.isdot.php                        24-Jan-2021 12:02                5619
directoryiterator.isexecutable.php                 24-Jan-2021 12:02                5263
directoryiterator.isfile.php                       24-Jan-2021 12:02                5539
directoryiterator.islink.php                       24-Jan-2021 12:02                7199
directoryiterator.isreadable.php                   24-Jan-2021 12:02                5117
directoryiterator.iswritable.php                   24-Jan-2021 12:02                5293
directoryiterator.key.php                          24-Jan-2021 12:02                5648
directoryiterator.next.php                         24-Jan-2021 12:02                5314
directoryiterator.rewind.php                       24-Jan-2021 12:02                5251
directoryiterator.seek.php                         24-Jan-2021 12:02                5195
directoryiterator.tostring.php                     24-Jan-2021 12:02                4392
directoryiterator.valid.php                        24-Jan-2021 12:02                5556
doc.changelog.php                                  24-Jan-2021 12:02              121746
dom.configuration.php                              24-Jan-2021 12:02                1076
dom.constants.php                                  24-Jan-2021 12:02               13684
dom.examples.php                                   24-Jan-2021 12:02                2830
dom.installation.php                               24-Jan-2021 12:02                1116
dom.requirements.php                               24-Jan-2021 12:02                1296
dom.resources.php                                  24-Jan-2021 12:02                1033
dom.setup.php                                      24-Jan-2021 12:02                1378
domattr.construct.php                              24-Jan-2021 12:02                5313
domattr.isid.php                                   24-Jan-2021 12:02                4698
domcdatasection.construct.php                      24-Jan-2021 12:02                4979
domcharacterdata.appenddata.php                    24-Jan-2021 12:02                3546
domcharacterdata.deletedata.php                    24-Jan-2021 12:02                4556
domcharacterdata.insertdata.php                    24-Jan-2021 12:02                4276
domcharacterdata.replacedata.php                   24-Jan-2021 12:02                4899
domcharacterdata.substringdata.php                 24-Jan-2021 12:02                4559
domcomment.construct.php                           24-Jan-2021 12:02                4879
domdocument.construct.php                          24-Jan-2021 12:02                4182
domdocument.createattribute.php                    24-Jan-2021 12:02                5583
domdocument.createattributens.php                  24-Jan-2021 12:02                6408
domdocument.createcdatasection.php                 24-Jan-2021 12:02                5254
domdocument.createcomment.php                      24-Jan-2021 12:02                5201
domdocument.createdocumentfragment.php             24-Jan-2021 12:02                4870
domdocument.createelement.php                      24-Jan-2021 12:02               11110
domdocument.createelementns.php                    24-Jan-2021 12:02               13838
domdocument.createentityreference.php              24-Jan-2021 12:02                5894
domdocument.createprocessinginstruction.php        24-Jan-2021 12:02                6156
domdocument.createtextnode.php                     24-Jan-2021 12:02                5187
domdocument.getelementbyid.php                     24-Jan-2021 12:02                7431
domdocument.getelementsbytagname.php               24-Jan-2021 12:02                5905
domdocument.getelementsbytagnamens.php             24-Jan-2021 12:02                6866
domdocument.importnode.php                         24-Jan-2021 12:02                8795
domdocument.load.php                               24-Jan-2021 12:02                5799
domdocument.loadhtml.php                           24-Jan-2021 12:02                6326
domdocument.loadhtmlfile.php                       24-Jan-2021 12:02                6131
domdocument.loadxml.php                            24-Jan-2021 12:02                6570
domdocument.normalizedocument.php                  24-Jan-2021 12:02                2623
domdocument.registernodeclass.php                  24-Jan-2021 12:02               19066
domdocument.relaxngvalidate.php                    24-Jan-2021 12:02                3704
domdocument.relaxngvalidatesource.php              24-Jan-2021 12:02                3731
domdocument.save.php                               24-Jan-2021 12:02                7445
domdocument.savehtml.php                           24-Jan-2021 12:02                7304
domdocument.savehtmlfile.php                       24-Jan-2021 12:02                7871
domdocument.savexml.php                            24-Jan-2021 12:02                8760
domdocument.schemavalidate.php                     24-Jan-2021 12:02                4552
domdocument.schemavalidatesource.php               24-Jan-2021 12:02                4614
domdocument.validate.php                           24-Jan-2021 12:02                5625
domdocument.xinclude.php                           24-Jan-2021 12:02                6984
domdocumentfragment.appendxml.php                  24-Jan-2021 12:02                5153
domelement.construct.php                           24-Jan-2021 12:02                6347
domelement.getattribute.php                        24-Jan-2021 12:02                3286
domelement.getattributenode.php                    24-Jan-2021 12:02                3764
domelement.getattributenodens.php                  24-Jan-2021 12:02                4128
domelement.getattributens.php                      24-Jan-2021 12:02                3745
domelement.getelementsbytagname.php                24-Jan-2021 12:02                3376
domelement.getelementsbytagnamens.php              24-Jan-2021 12:02                3579
domelement.hasattribute.php                        24-Jan-2021 12:02                3491
domelement.hasattributens.php                      24-Jan-2021 12:02                3866
domelement.removeattribute.php                     24-Jan-2021 12:02                3636
domelement.removeattributenode.php                 24-Jan-2021 12:02                4088
domelement.removeattributens.php                   24-Jan-2021 12:02                4042
domelement.setattribute.php                        24-Jan-2021 12:02                5793
domelement.setattributenode.php                    24-Jan-2021 12:02                3840
domelement.setattributenodens.php                  24-Jan-2021 12:02                3836
domelement.setattributens.php                      24-Jan-2021 12:02                4715
domelement.setidattribute.php                      24-Jan-2021 12:02                4361
domelement.setidattributenode.php                  24-Jan-2021 12:02                4411
domelement.setidattributens.php                    24-Jan-2021 12:02                4730
domentityreference.construct.php                   24-Jan-2021 12:02                4691
domimplementation.construct.php                    24-Jan-2021 12:02                1783
domimplementation.createdocument.php               24-Jan-2021 12:02                6095
domimplementation.createdocumenttype.php           24-Jan-2021 12:02                8875
domimplementation.hasfeature.php                   24-Jan-2021 12:02                9339
domnamednodemap.count.php                          24-Jan-2021 12:02                2297
domnamednodemap.getnameditem.php                   24-Jan-2021 12:02                3147
domnamednodemap.getnameditemns.php                 24-Jan-2021 12:02                3505
domnamednodemap.item.php                           24-Jan-2021 12:02                2712
domnode.appendchild.php                            24-Jan-2021 12:02                8217
domnode.c14n.php                                   24-Jan-2021 12:02                4018
domnode.c14nfile.php                               24-Jan-2021 12:02                4271
domnode.clonenode.php                              24-Jan-2021 12:02                2511
domnode.getlineno.php                              24-Jan-2021 12:02                4767
domnode.getnodepath.php                            24-Jan-2021 12:02                4981
domnode.hasattributes.php                          24-Jan-2021 12:02                2412
domnode.haschildnodes.php                          24-Jan-2021 12:02                2334
domnode.insertbefore.php                           24-Jan-2021 12:02                4870
domnode.isdefaultnamespace.php                     24-Jan-2021 12:02                2553
domnode.issamenode.php                             24-Jan-2021 12:02                2511
domnode.issupported.php                            24-Jan-2021 12:02                3403
domnode.lookupnamespaceuri.php                     24-Jan-2021 12:02                2829
domnode.lookupprefix.php                           24-Jan-2021 12:02                2815
domnode.normalize.php                              24-Jan-2021 12:02                2471
domnode.removechild.php                            24-Jan-2021 12:02                6567
domnode.replacechild.php                           24-Jan-2021 12:02                5088
domnodelist.count.php                              24-Jan-2021 12:02                2214
domnodelist.item.php                               24-Jan-2021 12:02                6485
domprocessinginstruction.construct.php             24-Jan-2021 12:02                6398
domtext.construct.php                              24-Jan-2021 12:02                4637
domtext.iselementcontentwhitespace.php             24-Jan-2021 12:02                2307
domtext.iswhitespaceinelementcontent.php           24-Jan-2021 12:02                2313
domtext.splittext.php                              24-Jan-2021 12:02                3010
domxpath.construct.php                             24-Jan-2021 12:02                2519
domxpath.evaluate.php                              24-Jan-2021 12:02                7239
domxpath.query.php                                 24-Jan-2021 12:02               12024
domxpath.registernamespace.php                     24-Jan-2021 12:02                2847
domxpath.registerphpfunctions.php                  24-Jan-2021 12:02               13827
dotnet.construct.php                               24-Jan-2021 12:02                2772
ds-collection.clear.php                            24-Jan-2021 12:02                3820
ds-collection.copy.php                             24-Jan-2021 12:02                4273
ds-collection.isempty.php                          24-Jan-2021 12:02                4113
ds-collection.toarray.php                          24-Jan-2021 12:02                3889
ds-deque.allocate.php                              24-Jan-2021 12:02                4489
ds-deque.apply.php                                 24-Jan-2021 12:02                5024
ds-deque.capacity.php                              24-Jan-2021 12:02                3789
ds-deque.clear.php                                 24-Jan-2021 12:02                3707
ds-deque.construct.php                             24-Jan-2021 12:02                4205
ds-deque.contains.php                              24-Jan-2021 12:02                7407
ds-deque.copy.php                                  24-Jan-2021 12:02                4105
ds-deque.count.php                                 24-Jan-2021 12:02                1447
ds-deque.filter.php                                24-Jan-2021 12:02                7470
ds-deque.find.php                                  24-Jan-2021 12:02                5379
ds-deque.first.php                                 24-Jan-2021 12:02                3672
ds-deque.get.php                                   24-Jan-2021 12:02                6530
ds-deque.insert.php                                24-Jan-2021 12:02                6881
ds-deque.isempty.php                               24-Jan-2021 12:02                3965
ds-deque.join.php                                  24-Jan-2021 12:02                5639
ds-deque.jsonserialize.php                         24-Jan-2021 12:02                1721
ds-deque.last.php                                  24-Jan-2021 12:02                3661
ds-deque.map.php                                   24-Jan-2021 12:02                5429
ds-deque.merge.php                                 24-Jan-2021 12:02                4739
ds-deque.pop.php                                   24-Jan-2021 12:02                4159
ds-deque.push.php                                  24-Jan-2021 12:02                4606
ds-deque.reduce.php                                24-Jan-2021 12:02                8605
ds-deque.remove.php                                24-Jan-2021 12:02                4741
ds-deque.reverse.php                               24-Jan-2021 12:02                3541
ds-deque.reversed.php                              24-Jan-2021 12:02                3918
ds-deque.rotate.php                                24-Jan-2021 12:02                4981
ds-deque.set.php                                   24-Jan-2021 12:02                5995
ds-deque.shift.php                                 24-Jan-2021 12:02                4258
ds-deque.slice.php                                 24-Jan-2021 12:02                7140
ds-deque.sort.php                                  24-Jan-2021 12:02                7293
ds-deque.sorted.php                                24-Jan-2021 12:02                7353
ds-deque.sum.php                                   24-Jan-2021 12:02                5003
ds-deque.toarray.php                               24-Jan-2021 12:02                3745
ds-deque.unshift.php                               24-Jan-2021 12:02                4685
ds-hashable.equals.php                             24-Jan-2021 12:02                3240
ds-hashable.hash.php                               24-Jan-2021 12:02                8367
ds-map.allocate.php                                24-Jan-2021 12:02                4357
ds-map.apply.php                                   24-Jan-2021 12:02                5815
ds-map.capacity.php                                24-Jan-2021 12:02                3076
ds-map.clear.php                                   24-Jan-2021 12:02                4265
ds-map.construct.php                               24-Jan-2021 12:02                4739
ds-map.copy.php                                    24-Jan-2021 12:02                4037
ds-map.count.php                                   24-Jan-2021 12:02                1410
ds-map.diff.php                                    24-Jan-2021 12:02                5545
ds-map.filter.php                                  24-Jan-2021 12:02                8354
ds-map.first.php                                   24-Jan-2021 12:02                3962
ds-map.get.php                                     24-Jan-2021 12:02                8490
ds-map.haskey.php                                  24-Jan-2021 12:02                4537
ds-map.hasvalue.php                                24-Jan-2021 12:02                4579
ds-map.intersect.php                               24-Jan-2021 12:02                6063
ds-map.isempty.php                                 24-Jan-2021 12:02                4219
ds-map.jsonserialize.php                           24-Jan-2021 12:02                1701
ds-map.keys.php                                    24-Jan-2021 12:02                3843
ds-map.ksort.php                                   24-Jan-2021 12:02                8026
ds-map.ksorted.php                                 24-Jan-2021 12:02                8148
ds-map.last.php                                    24-Jan-2021 12:02                3948
ds-map.map.php                                     24-Jan-2021 12:02                6488
ds-map.merge.php                                   24-Jan-2021 12:02                5552
ds-map.pairs.php                                   24-Jan-2021 12:02                4202
ds-map.put.php                                     24-Jan-2021 12:02               14688
ds-map.putall.php                                  24-Jan-2021 12:02                5177
ds-map.reduce.php                                  24-Jan-2021 12:02                9665
ds-map.remove.php                                  24-Jan-2021 12:02                6930
ds-map.reverse.php                                 24-Jan-2021 12:02                4025
ds-map.reversed.php                                24-Jan-2021 12:02                4160
ds-map.skip.php                                    24-Jan-2021 12:02                4438
ds-map.slice.php                                   24-Jan-2021 12:02                8043
ds-map.sort.php                                    24-Jan-2021 12:02                7945
ds-map.sorted.php                                  24-Jan-2021 12:02                8128
ds-map.sum.php                                     24-Jan-2021 12:02                5532
ds-map.toarray.php                                 24-Jan-2021 12:02                4706
ds-map.union.php                                   24-Jan-2021 12:02                6051
ds-map.values.php                                  24-Jan-2021 12:02                3835
ds-map.xor.php                                     24-Jan-2021 12:02                5608
ds-pair.clear.php                                  24-Jan-2021 12:02                3604
ds-pair.construct.php                              24-Jan-2021 12:02                2551
ds-pair.copy.php                                   24-Jan-2021 12:02                4025
ds-pair.isempty.php                                24-Jan-2021 12:02                3911
ds-pair.jsonserialize.php                          24-Jan-2021 12:02                1720
ds-pair.toarray.php                                24-Jan-2021 12:02                3671
ds-priorityqueue.allocate.php                      24-Jan-2021 12:02                4647
ds-priorityqueue.capacity.php                      24-Jan-2021 12:02                3275
ds-priorityqueue.clear.php                         24-Jan-2021 12:02                4366
ds-priorityqueue.construct.php                     24-Jan-2021 12:02                2830
ds-priorityqueue.copy.php                          24-Jan-2021 12:02                4400
ds-priorityqueue.count.php                         24-Jan-2021 12:02                1548
ds-priorityqueue.isempty.php                       24-Jan-2021 12:02                4877
ds-priorityqueue.jsonserialize.php                 24-Jan-2021 12:02                1831
ds-priorityqueue.peek.php                          24-Jan-2021 12:02                4653
ds-priorityqueue.pop.php                           24-Jan-2021 12:02                5426
ds-priorityqueue.push.php                          24-Jan-2021 12:02                5484
ds-priorityqueue.toarray.php                       24-Jan-2021 12:02                4836
ds-queue.allocate.php                              24-Jan-2021 12:02                4684
ds-queue.capacity.php                              24-Jan-2021 12:02                3795
ds-queue.clear.php                                 24-Jan-2021 12:02                3692
ds-queue.construct.php                             24-Jan-2021 12:02                4203
ds-queue.copy.php                                  24-Jan-2021 12:02                4242
ds-queue.count.php                                 24-Jan-2021 12:02                1444
ds-queue.isempty.php                               24-Jan-2021 12:02                3981
ds-queue.jsonserialize.php                         24-Jan-2021 12:02                1727
ds-queue.peek.php                                  24-Jan-2021 12:02                4245
ds-queue.pop.php                                   24-Jan-2021 12:02                4780
ds-queue.push.php                                  24-Jan-2021 12:02                4641
ds-queue.toarray.php                               24-Jan-2021 12:02                3907
ds-sequence.allocate.php                           24-Jan-2021 12:02                4388
ds-sequence.apply.php                              24-Jan-2021 12:02                5136
ds-sequence.capacity.php                           24-Jan-2021 12:02                4351
ds-sequence.contains.php                           24-Jan-2021 12:02                7531
ds-sequence.filter.php                             24-Jan-2021 12:02                7606
ds-sequence.find.php                               24-Jan-2021 12:02                5488
ds-sequence.first.php                              24-Jan-2021 12:02                3784
ds-sequence.get.php                                24-Jan-2021 12:02                6655
ds-sequence.insert.php                             24-Jan-2021 12:02                6997
ds-sequence.join.php                               24-Jan-2021 12:02                5732
ds-sequence.last.php                               24-Jan-2021 12:02                3752
ds-sequence.map.php                                24-Jan-2021 12:02                5555
ds-sequence.merge.php                              24-Jan-2021 12:02                4862
ds-sequence.pop.php                                24-Jan-2021 12:02                4268
ds-sequence.push.php                               24-Jan-2021 12:02                4725
ds-sequence.reduce.php                             24-Jan-2021 12:02                8721
ds-sequence.remove.php                             24-Jan-2021 12:02                4850
ds-sequence.reverse.php                            24-Jan-2021 12:02                3651
ds-sequence.reversed.php                           24-Jan-2021 12:02                4038
ds-sequence.rotate.php                             24-Jan-2021 12:02                5115
ds-sequence.set.php                                24-Jan-2021 12:02                6116
ds-sequence.shift.php                              24-Jan-2021 12:02                4367
ds-sequence.slice.php                              24-Jan-2021 12:02                7302
ds-sequence.sort.php                               24-Jan-2021 12:02                7417
ds-sequence.sorted.php                             24-Jan-2021 12:02                7477
ds-sequence.sum.php                                24-Jan-2021 12:02                5125
ds-sequence.unshift.php                            24-Jan-2021 12:02                4793
ds-set.add.php                                     24-Jan-2021 12:02               12866
ds-set.allocate.php                                24-Jan-2021 12:02                4370
ds-set.capacity.php                                24-Jan-2021 12:02                3750
ds-set.clear.php                                   24-Jan-2021 12:02                3640
ds-set.construct.php                               24-Jan-2021 12:02                4124
ds-set.contains.php                                24-Jan-2021 12:02                7303
ds-set.copy.php                                    24-Jan-2021 12:02                4183
ds-set.count.php                                   24-Jan-2021 12:02                1410
ds-set.diff.php                                    24-Jan-2021 12:02                4775
ds-set.filter.php                                  24-Jan-2021 12:02                7403
ds-set.first.php                                   24-Jan-2021 12:02                3627
ds-set.get.php                                     24-Jan-2021 12:02                6476
ds-set.intersect.php                               24-Jan-2021 12:02                5001
ds-set.isempty.php                                 24-Jan-2021 12:02                3925
ds-set.join.php                                    24-Jan-2021 12:02                5587
ds-set.jsonserialize.php                           24-Jan-2021 12:02                1695
ds-set.last.php                                    24-Jan-2021 12:02                3629
ds-set.merge.php                                   24-Jan-2021 12:02                4667
ds-set.reduce.php                                  24-Jan-2021 12:02                8553
ds-set.remove.php                                  24-Jan-2021 12:02                5117
ds-set.reverse.php                                 24-Jan-2021 12:02                3491
ds-set.reversed.php                                24-Jan-2021 12:02                3858
ds-set.slice.php                                   24-Jan-2021 12:02                7056
ds-set.sort.php                                    24-Jan-2021 12:02                7231
ds-set.sorted.php                                  24-Jan-2021 12:02                7291
ds-set.sum.php                                     24-Jan-2021 12:02                4945
ds-set.toarray.php                                 24-Jan-2021 12:02                3693
ds-set.union.php                                   24-Jan-2021 12:02                4968
ds-set.xor.php                                     24-Jan-2021 12:02                4942
ds-stack.allocate.php                              24-Jan-2021 12:02                2621
ds-stack.capacity.php                              24-Jan-2021 12:02                1971
ds-stack.clear.php                                 24-Jan-2021 12:02                3692
ds-stack.construct.php                             24-Jan-2021 12:02                4169
ds-stack.copy.php                                  24-Jan-2021 12:02                4242
ds-stack.count.php                                 24-Jan-2021 12:02                1444
ds-stack.isempty.php                               24-Jan-2021 12:02                3981
ds-stack.jsonserialize.php                         24-Jan-2021 12:02                1727
ds-stack.peek.php                                  24-Jan-2021 12:02                4239
ds-stack.pop.php                                   24-Jan-2021 12:02                4774
ds-stack.push.php                                  24-Jan-2021 12:02                4641
ds-stack.toarray.php                               24-Jan-2021 12:02                3732
ds-vector.allocate.php                             24-Jan-2021 12:02                4307
ds-vector.apply.php                                24-Jan-2021 12:02                5049
ds-vector.capacity.php                             24-Jan-2021 12:02                4258
ds-vector.clear.php                                24-Jan-2021 12:02                3718
ds-vector.construct.php                            24-Jan-2021 12:02                4236
ds-vector.contains.php                             24-Jan-2021 12:02                7436
ds-vector.copy.php                                 24-Jan-2021 12:02                4265
ds-vector.count.php                                24-Jan-2021 12:02                1460
ds-vector.filter.php                               24-Jan-2021 12:02                7503
ds-vector.find.php                                 24-Jan-2021 12:02                5403
ds-vector.first.php                                24-Jan-2021 12:02                3697
ds-vector.get.php                                  24-Jan-2021 12:02                6560
ds-vector.insert.php                               24-Jan-2021 12:02                6910
ds-vector.isempty.php                              24-Jan-2021 12:02                3988
ds-vector.join.php                                 24-Jan-2021 12:02                5665
ds-vector.jsonserialize.php                        24-Jan-2021 12:02                1734
ds-vector.last.php                                 24-Jan-2021 12:02                3685
ds-vector.map.php                                  24-Jan-2021 12:02                5460
ds-vector.merge.php                                24-Jan-2021 12:02                4769
ds-vector.pop.php                                  24-Jan-2021 12:02                4183
ds-vector.push.php                                 24-Jan-2021 12:02                4634
ds-vector.reduce.php                               24-Jan-2021 12:02                8632
ds-vector.remove.php                               24-Jan-2021 12:02                4765
ds-vector.reverse.php                              24-Jan-2021 12:02                3566
ds-vector.reversed.php                             24-Jan-2021 12:02                3947
ds-vector.rotate.php                               24-Jan-2021 12:02                5014
ds-vector.set.php                                  24-Jan-2021 12:02                6025
ds-vector.shift.php                                24-Jan-2021 12:02                4282
ds-vector.slice.php                                24-Jan-2021 12:02                7185
ds-vector.sort.php                                 24-Jan-2021 12:02                7324
ds-vector.sorted.php                               24-Jan-2021 12:02                7384
ds-vector.sum.php                                  24-Jan-2021 12:02                5032
ds-vector.toarray.php                              24-Jan-2021 12:02                3769
ds-vector.unshift.php                              24-Jan-2021 12:02                4714
ds.constants.php                                   24-Jan-2021 12:02                 990
ds.examples.php                                    24-Jan-2021 12:02                4764
ds.installation.php                                24-Jan-2021 12:02                2360
ds.requirements.php                                24-Jan-2021 12:02                1049
ds.setup.php                                       24-Jan-2021 12:02                1247
eio.configuration.php                              24-Jan-2021 12:02                1076
eio.constants.php                                  24-Jan-2021 12:02               15914
eio.examples.php                                   24-Jan-2021 12:02               29256
eio.installation.php                               24-Jan-2021 12:02                1515
eio.requirements.php                               24-Jan-2021 12:02                1168
eio.resources.php                                  24-Jan-2021 12:02                1087
eio.setup.php                                      24-Jan-2021 12:02                1390
emptyiterator.current.php                          24-Jan-2021 12:02                2539
emptyiterator.key.php                              24-Jan-2021 12:02                2443
emptyiterator.next.php                             24-Jan-2021 12:02                2171
emptyiterator.rewind.php                           24-Jan-2021 12:02                2191
emptyiterator.valid.php                            24-Jan-2021 12:02                2179
enchant.configuration.php                          24-Jan-2021 12:02                1100
enchant.constants.php                              24-Jan-2021 12:02                2428
enchant.examples.php                               24-Jan-2021 12:02                5750
enchant.installation.php                           24-Jan-2021 12:02                1544
enchant.requirements.php                           24-Jan-2021 12:02                1647
enchant.resources.php                              24-Jan-2021 12:02                1190
enchant.setup.php                                  24-Jan-2021 12:02                1431
error.clone.php                                    24-Jan-2021 12:01                2197
error.construct.php                                24-Jan-2021 12:01                3006
error.getcode.php                                  24-Jan-2021 12:01                3884
error.getfile.php                                  24-Jan-2021 12:01                3464
error.getline.php                                  24-Jan-2021 12:01                3716
error.getmessage.php                               24-Jan-2021 12:01                3586
error.getprevious.php                              24-Jan-2021 12:01                6564
error.gettrace.php                                 24-Jan-2021 12:01                3981
error.gettraceasstring.php                         24-Jan-2021 12:01                3862
error.tostring.php                                 24-Jan-2021 12:01                3579
errorexception.construct.php                       24-Jan-2021 12:01                4620
errorexception.getseverity.php                     24-Jan-2021 12:01                4194
errorfunc.configuration.php                        24-Jan-2021 12:01               21892
errorfunc.constants.php                            24-Jan-2021 12:01                9321
errorfunc.examples.php                             24-Jan-2021 12:01               23474
errorfunc.installation.php                         24-Jan-2021 12:01                1091
errorfunc.requirements.php                         24-Jan-2021 12:01                1051
errorfunc.resources.php                            24-Jan-2021 12:01                1069
errorfunc.setup.php                                24-Jan-2021 12:01                1444
ev.backend.php                                     24-Jan-2021 12:02                3267
ev.configuration.php                               24-Jan-2021 12:02                1070
ev.depth.php                                       24-Jan-2021 12:02                3078
ev.embeddablebackends.php                          24-Jan-2021 12:02                6790
ev.examples.php                                    24-Jan-2021 12:02               47639
ev.feedsignal.php                                  24-Jan-2021 12:02                3181
ev.feedsignalevent.php                             24-Jan-2021 12:02                2963
ev.global.constants.php                            24-Jan-2021 12:02                1117
ev.installation.php                                24-Jan-2021 12:02                1497
ev.iteration.php                                   24-Jan-2021 12:02                2448
ev.now.php                                         24-Jan-2021 12:02                2863
ev.nowupdate.php                                   24-Jan-2021 12:02                3043
ev.periodic-modes.php                              24-Jan-2021 12:02                7690
ev.recommendedbackends.php                         24-Jan-2021 12:02                7531
ev.requirements.php                                24-Jan-2021 12:02                1104
ev.resources.php                                   24-Jan-2021 12:02                1034
ev.resume.php                                      24-Jan-2021 12:02                3636
ev.run.php                                         24-Jan-2021 12:02                4682
ev.setup.php                                       24-Jan-2021 12:02                1346
ev.sleep.php                                       24-Jan-2021 12:02                2236
ev.stop.php                                        24-Jan-2021 12:02                2703
ev.supportedbackends.php                           24-Jan-2021 12:02                6773
ev.suspend.php                                     24-Jan-2021 12:02                3368
ev.time.php                                        24-Jan-2021 12:02                2498
ev.verify.php                                      24-Jan-2021 12:02                2117
ev.watcher-callbacks.php                           24-Jan-2021 12:02                3896
ev.watchers.php                                    24-Jan-2021 12:02                3380
evcheck.construct.php                              24-Jan-2021 12:02                3679
evcheck.createstopped.php                          24-Jan-2021 12:02                3391
evchild.construct.php                              24-Jan-2021 12:02                6300
evchild.createstopped.php                          24-Jan-2021 12:02                4730
evchild.set.php                                    24-Jan-2021 12:02                2968
evembed.construct.php                              24-Jan-2021 12:02                8437
evembed.createstopped.php                          24-Jan-2021 12:02                4483
evembed.set.php                                    24-Jan-2021 12:02                2355
evembed.sweep.php                                  24-Jan-2021 12:02                2913
event.add.php                                      24-Jan-2021 12:02                3517
event.addsignal.php                                24-Jan-2021 12:02                7925
event.addtimer.php                                 24-Jan-2021 12:02                5157
event.callbacks.php                                24-Jan-2021 12:02                5373
event.configuration.php                            24-Jan-2021 12:02                1088
event.construct.php                                24-Jan-2021 12:02                4530
event.constructing.signal.events.php               24-Jan-2021 12:02                6749
event.del.php                                      24-Jan-2021 12:02                2332
event.delsignal.php                                24-Jan-2021 12:02                2069
event.deltimer.php                                 24-Jan-2021 12:02                2068
event.examples.php                                 24-Jan-2021 12:02              198785
event.flags.php                                    24-Jan-2021 12:02                2235
event.free.php                                     24-Jan-2021 12:02                2821
event.getsupportedmethods.php                      24-Jan-2021 12:02                2443
event.installation.php                             24-Jan-2021 12:02                1521
event.pending.php                                  24-Jan-2021 12:02                2574
event.persistence.php                              24-Jan-2021 12:02                2664
event.requirements.php                             24-Jan-2021 12:02                1319
event.resources.php                                24-Jan-2021 12:02                1035
event.set.php                                      24-Jan-2021 12:02                4272
event.setpriority.php                              24-Jan-2021 12:02                2256
event.settimer.php                                 24-Jan-2021 12:02                3911
event.setup.php                                    24-Jan-2021 12:02                1382
event.signal.php                                   24-Jan-2021 12:02                4047
event.timer.php                                    24-Jan-2021 12:02                3492
eventbase.construct.php                            24-Jan-2021 12:02                2633
eventbase.dispatch.php                             24-Jan-2021 12:02                3037
eventbase.exit.php                                 24-Jan-2021 12:02                2767
eventbase.free.php                                 24-Jan-2021 12:02                3106
eventbase.getfeatures.php                          24-Jan-2021 12:02                5836
eventbase.getmethod.php                            24-Jan-2021 12:02                4470
eventbase.gettimeofdaycached.php                   24-Jan-2021 12:02                2516
eventbase.gotexit.php                              24-Jan-2021 12:02                3099
eventbase.gotstop.php                              24-Jan-2021 12:02                3071
eventbase.loop.php                                 24-Jan-2021 12:02                3295
eventbase.priorityinit.php                         24-Jan-2021 12:02                2736
eventbase.reinit.php                               24-Jan-2021 12:02                2101
eventbase.stop.php                                 24-Jan-2021 12:02                2596
eventbuffer.add.php                                24-Jan-2021 12:02                2742
eventbuffer.addbuffer.php                          24-Jan-2021 12:02                3117
eventbuffer.appendfrom.php                         24-Jan-2021 12:02                4767
eventbuffer.construct.php                          24-Jan-2021 12:02                2023
eventbuffer.copyout.php                            24-Jan-2021 12:02                3723
eventbuffer.drain.php                              24-Jan-2021 12:02                3232
eventbuffer.enablelocking.php                      24-Jan-2021 12:02                2705
eventbuffer.expand.php                             24-Jan-2021 12:02                2528
eventbuffer.freeze.php                             24-Jan-2021 12:02                2788
eventbuffer.lock.php                               24-Jan-2021 12:02                2887
eventbuffer.prepend.php                            24-Jan-2021 12:02                3243
eventbuffer.prependbuffer.php                      24-Jan-2021 12:02                3459
eventbuffer.pullup.php                             24-Jan-2021 12:02                4471
eventbuffer.read.php                               24-Jan-2021 12:02                4736
eventbuffer.readfrom.php                           24-Jan-2021 12:02                4225
eventbuffer.readline.php                           24-Jan-2021 12:02                4045
eventbuffer.search.php                             24-Jan-2021 12:02                8480
eventbuffer.searcheol.php                          24-Jan-2021 12:02                4434
eventbuffer.substr.php                             24-Jan-2021 12:02                3213
eventbuffer.unfreeze.php                           24-Jan-2021 12:02                2800
eventbuffer.unlock.php                             24-Jan-2021 12:02                2552
eventbuffer.write.php                              24-Jan-2021 12:02                3281
eventbufferevent.about.callbacks.php               24-Jan-2021 12:02                5451
eventbufferevent.close.php                         24-Jan-2021 12:02                2333
eventbufferevent.connect.php                       24-Jan-2021 12:02               26859
eventbufferevent.connecthost.php                   24-Jan-2021 12:02               18186
eventbufferevent.construct.php                     24-Jan-2021 12:02                6319
eventbufferevent.createpair.php                    24-Jan-2021 12:02                3873
eventbufferevent.disable.php                       24-Jan-2021 12:02                3032
eventbufferevent.enable.php                        24-Jan-2021 12:02                3297
eventbufferevent.free.php                          24-Jan-2021 12:02                2641
eventbufferevent.getdnserrorstring.php             24-Jan-2021 12:02                2933
eventbufferevent.getenabled.php                    24-Jan-2021 12:02                2906
eventbufferevent.getinput.php                      24-Jan-2021 12:02                5013
eventbufferevent.getoutput.php                     24-Jan-2021 12:02                8168
eventbufferevent.read.php                          24-Jan-2021 12:02                2874
eventbufferevent.readbuffer.php                    24-Jan-2021 12:02                2979
eventbufferevent.setcallbacks.php                  24-Jan-2021 12:02                4297
eventbufferevent.setpriority.php                   24-Jan-2021 12:02                2627
eventbufferevent.settimeouts.php                   24-Jan-2021 12:02                2802
eventbufferevent.setwatermark.php                  24-Jan-2021 12:02                3723
eventbufferevent.sslerror.php                      24-Jan-2021 12:02                6216
eventbufferevent.sslfilter.php                     24-Jan-2021 12:02               40736
eventbufferevent.sslgetcipherinfo.php              24-Jan-2021 12:02                2703
eventbufferevent.sslgetciphername.php              24-Jan-2021 12:02                2589
eventbufferevent.sslgetcipherversion.php           24-Jan-2021 12:02                2615
eventbufferevent.sslgetprotocol.php                24-Jan-2021 12:02                2549
eventbufferevent.sslrenegotiate.php                24-Jan-2021 12:02                2666
eventbufferevent.sslsocket.php                     24-Jan-2021 12:02                5221
eventbufferevent.write.php                         24-Jan-2021 12:02                2920
eventbufferevent.writebuffer.php                   24-Jan-2021 12:02                3065
eventconfig.avoidmethod.php                        24-Jan-2021 12:02                4153
eventconfig.construct.php                          24-Jan-2021 12:02                4369
eventconfig.requirefeatures.php                    24-Jan-2021 12:02                5846
eventconfig.setmaxdispatchinterval.php             24-Jan-2021 12:02                4194
eventdnsbase.addnameserverip.php                   24-Jan-2021 12:02                2652
eventdnsbase.addsearch.php                         24-Jan-2021 12:02                2371
eventdnsbase.clearsearch.php                       24-Jan-2021 12:02                2668
eventdnsbase.construct.php                         24-Jan-2021 12:02                3127
eventdnsbase.countnameservers.php                  24-Jan-2021 12:02                2358
eventdnsbase.loadhosts.php                         24-Jan-2021 12:02                2535
eventdnsbase.parseresolvconf.php                   24-Jan-2021 12:02                3947
eventdnsbase.setoption.php                         24-Jan-2021 12:02                3053
eventdnsbase.setsearchndots.php                    24-Jan-2021 12:02                2590
eventhttp.accept.php                               24-Jan-2021 12:02               13126
eventhttp.addserveralias.php                       24-Jan-2021 12:02                6349
eventhttp.bind.php                                 24-Jan-2021 12:02                7732
eventhttp.construct.php                            24-Jan-2021 12:02               19754
eventhttp.removeserveralias.php                    24-Jan-2021 12:02                2925
eventhttp.setallowedmethods.php                    24-Jan-2021 12:02                3207
eventhttp.setcallback.php                          24-Jan-2021 12:02               19636
eventhttp.setdefaultcallback.php                   24-Jan-2021 12:02                7723
eventhttp.setmaxbodysize.php                       24-Jan-2021 12:02                2734
eventhttp.setmaxheaderssize.php                    24-Jan-2021 12:02                2643
eventhttp.settimeout.php                           24-Jan-2021 12:02                2328
eventhttpconnection.construct.php                  24-Jan-2021 12:02                4916
eventhttpconnection.getbase.php                    24-Jan-2021 12:02                2410
eventhttpconnection.getpeer.php                    24-Jan-2021 12:02                2785
eventhttpconnection.makerequest.php                24-Jan-2021 12:02               12421
eventhttpconnection.setclosecallback.php           24-Jan-2021 12:02               11725
eventhttpconnection.setlocaladdress.php            24-Jan-2021 12:02                3020
eventhttpconnection.setlocalport.php               24-Jan-2021 12:02                2919
eventhttpconnection.setmaxbodysize.php             24-Jan-2021 12:02                2946
eventhttpconnection.setmaxheaderssize.php          24-Jan-2021 12:02                2964
eventhttpconnection.setretries.php                 24-Jan-2021 12:02                2548
eventhttpconnection.settimeout.php                 24-Jan-2021 12:02                2445
eventhttprequest.addheader.php                     24-Jan-2021 12:02                3546
eventhttprequest.cancel.php                        24-Jan-2021 12:02                2662
eventhttprequest.clearheaders.php                  24-Jan-2021 12:02                2648
eventhttprequest.closeconnection.php               24-Jan-2021 12:02                2239
eventhttprequest.construct.php                     24-Jan-2021 12:02               12641
eventhttprequest.findheader.php                    24-Jan-2021 12:02                3261
eventhttprequest.free.php                          24-Jan-2021 12:02                2158
eventhttprequest.getbufferevent.php                24-Jan-2021 12:02                3468
eventhttprequest.getcommand.php                    24-Jan-2021 12:02                2532
eventhttprequest.getconnection.php                 24-Jan-2021 12:02                4172
eventhttprequest.gethost.php                       24-Jan-2021 12:02                2701
eventhttprequest.getinputbuffer.php                24-Jan-2021 12:02                2641
eventhttprequest.getinputheaders.php               24-Jan-2021 12:02                2673
eventhttprequest.getoutputbuffer.php               24-Jan-2021 12:02                2699
eventhttprequest.getoutputheaders.php              24-Jan-2021 12:02                2656
eventhttprequest.getresponsecode.php               24-Jan-2021 12:02                2990
eventhttprequest.geturi.php                        24-Jan-2021 12:02                2910
eventhttprequest.removeheader.php                  24-Jan-2021 12:02                3270
eventhttprequest.senderror.php                     24-Jan-2021 12:02                5587
eventhttprequest.sendreply.php                     24-Jan-2021 12:02                3838
eventhttprequest.sendreplychunk.php                24-Jan-2021 12:02                3307
eventhttprequest.sendreplyend.php                  24-Jan-2021 12:02                2896
eventhttprequest.sendreplystart.php                24-Jan-2021 12:02                4084
eventlistener.construct.php                        24-Jan-2021 12:02               27369
eventlistener.disable.php                          24-Jan-2021 12:02                2525
eventlistener.enable.php                           24-Jan-2021 12:02                2512
eventlistener.getbase.php                          24-Jan-2021 12:02                2177
eventlistener.getsocketname.php                    24-Jan-2021 12:02                3074
eventlistener.setcallback.php                      24-Jan-2021 12:02                5516
eventlistener.seterrorcallback.php                 24-Jan-2021 12:02                4134
eventsslcontext.construct.php                      24-Jan-2021 12:02                5688
eventutil.construct.php                            24-Jan-2021 12:02                2177
eventutil.getlastsocketerrno.php                   24-Jan-2021 12:02                3129
eventutil.getlastsocketerror.php                   24-Jan-2021 12:02                2994
eventutil.getsocketfd.php                          24-Jan-2021 12:02                3044
eventutil.getsocketname.php                        24-Jan-2021 12:02                3526
eventutil.setsocketoption.php                      24-Jan-2021 12:02                5252
eventutil.sslrandpoll.php                          24-Jan-2021 12:02                2200
evfork.construct.php                               24-Jan-2021 12:02                3684
evfork.createstopped.php                           24-Jan-2021 12:02                3625
evidle.construct.php                               24-Jan-2021 12:02                3770
evidle.createstopped.php                           24-Jan-2021 12:02                3941
evio.construct.php                                 24-Jan-2021 12:02                4684
evio.createstopped.php                             24-Jan-2021 12:02                4877
evio.set.php                                       24-Jan-2021 12:02                2704
evloop.backend.php                                 24-Jan-2021 12:02                2547
evloop.check.php                                   24-Jan-2021 12:02                3034
evloop.child.php                                   24-Jan-2021 12:02                3264
evloop.construct.php                               24-Jan-2021 12:02                3894
evloop.defaultloop.php                             24-Jan-2021 12:02                4313
evloop.embed.php                                   24-Jan-2021 12:02                3328
evloop.fork.php                                    24-Jan-2021 12:02                3229
evloop.idle.php                                    24-Jan-2021 12:02                3249
evloop.invokepending.php                           24-Jan-2021 12:02                2069
evloop.io.php                                      24-Jan-2021 12:02                3542
evloop.loopfork.php                                24-Jan-2021 12:02                2374
evloop.now.php                                     24-Jan-2021 12:02                2665
evloop.nowupdate.php                               24-Jan-2021 12:02                3016
evloop.periodic.php                                24-Jan-2021 12:02                3571
evloop.prepare.php                                 24-Jan-2021 12:02                3244
evloop.resume.php                                  24-Jan-2021 12:02                2679
evloop.run.php                                     24-Jan-2021 12:02                4644
evloop.signal.php                                  24-Jan-2021 12:02                3383
evloop.stat.php                                    24-Jan-2021 12:02                3483
evloop.stop.php                                    24-Jan-2021 12:02                2826
evloop.suspend.php                                 24-Jan-2021 12:02                2670
evloop.timer.php                                   24-Jan-2021 12:02                3501
evloop.verify.php                                  24-Jan-2021 12:02                2446
evperiodic.again.php                               24-Jan-2021 12:02                2416
evperiodic.at.php                                  24-Jan-2021 12:02                2456
evperiodic.construct.php                           24-Jan-2021 12:02               10082
evperiodic.createstopped.php                       24-Jan-2021 12:02                5404
evperiodic.set.php                                 24-Jan-2021 12:02                2956
evprepare.construct.php                            24-Jan-2021 12:02                3467
evprepare.createstopped.php                        24-Jan-2021 12:02                4170
evsignal.construct.php                             24-Jan-2021 12:02                5477
evsignal.createstopped.php                         24-Jan-2021 12:02                4550
evsignal.set.php                                   24-Jan-2021 12:02                2308
evstat.attr.php                                    24-Jan-2021 12:02                8560
evstat.construct.php                               24-Jan-2021 12:02                7387
evstat.createstopped.php                           24-Jan-2021 12:02                4825
evstat.prev.php                                    24-Jan-2021 12:02                2810
evstat.set.php                                     24-Jan-2021 12:02                2635
evstat.stat.php                                    24-Jan-2021 12:02                2730
evtimer.again.php                                  24-Jan-2021 12:02                2914
evtimer.construct.php                              24-Jan-2021 12:02               13425
evtimer.createstopped.php                          24-Jan-2021 12:02                8250
evtimer.set.php                                    24-Jan-2021 12:02                2776
evwatcher.clear.php                                24-Jan-2021 12:02                2643
evwatcher.construct.php                            24-Jan-2021 12:02                1800
evwatcher.feed.php                                 24-Jan-2021 12:02                2423
evwatcher.getloop.php                              24-Jan-2021 12:02                2152
evwatcher.invoke.php                               24-Jan-2021 12:02                2424
evwatcher.keepalive.php                            24-Jan-2021 12:02                5028
evwatcher.setcallback.php                          24-Jan-2021 12:02                2432
evwatcher.start.php                                24-Jan-2021 12:02                2359
evwatcher.stop.php                                 24-Jan-2021 12:02                2329
example.xml-external-entity.php                    24-Jan-2021 12:02               25646
example.xml-map-tags.php                           24-Jan-2021 12:02                8965
example.xml-structure.php                          24-Jan-2021 12:02                6984
example.xmlwriter-namespace.php                    24-Jan-2021 12:02                5361
example.xmlwriter-oop.php                          24-Jan-2021 12:02                3289
example.xmlwriter-simple.php                       24-Jan-2021 12:02                8809
exception.clone.php                                24-Jan-2021 12:01                2249
exception.construct.php                            24-Jan-2021 12:01                4048
exception.getcode.php                              24-Jan-2021 12:01                4199
exception.getfile.php                              24-Jan-2021 12:01                3562
exception.getline.php                              24-Jan-2021 12:01                3855
exception.getmessage.php                           24-Jan-2021 12:01                3693
exception.getprevious.php                          24-Jan-2021 12:01                7182
exception.gettrace.php                             24-Jan-2021 12:01                4103
exception.gettraceasstring.php                     24-Jan-2021 12:01                3966
exception.tostring.php                             24-Jan-2021 12:01                3770
exec.configuration.php                             24-Jan-2021 12:02                1082
exec.constants.php                                 24-Jan-2021 12:02                1009
exec.installation.php                              24-Jan-2021 12:02                1061
exec.requirements.php                              24-Jan-2021 12:02                1021
exec.resources.php                                 24-Jan-2021 12:02                1203
exec.setup.php                                     24-Jan-2021 12:02                1398
exif.configuration.php                             24-Jan-2021 12:02                6339
exif.constants.php                                 24-Jan-2021 12:02                1688
exif.installation.php                              24-Jan-2021 12:02                1520
exif.requirements.php                              24-Jan-2021 12:02                1638
exif.resources.php                                 24-Jan-2021 12:02                1039
exif.setup.php                                     24-Jan-2021 12:02                1405
expect.configuration.php                           24-Jan-2021 12:02                4863
expect.constants.php                               24-Jan-2021 12:02                3055
expect.examples-usage.php                          24-Jan-2021 12:02               17078
expect.examples.php                                24-Jan-2021 12:02                1253
expect.installation.php                            24-Jan-2021 12:02                2150
expect.requirements.php                            24-Jan-2021 12:02                1171
expect.resources.php                               24-Jan-2021 12:02                1268
expect.setup.php                                   24-Jan-2021 12:02                1425
extensions.alphabetical.php                        24-Jan-2021 12:02               22019
extensions.membership.php                          24-Jan-2021 12:02               19891
extensions.php                                     24-Jan-2021 12:02                1494
extensions.state.php                               24-Jan-2021 12:02                3015
fann.configuration.php                             24-Jan-2021 12:02                1082
fann.constants.php                                 24-Jan-2021 12:02               16812
fann.examples-1.php                                24-Jan-2021 12:02                9022
fann.examples.php                                  24-Jan-2021 12:02                1221
fann.installation.php                              24-Jan-2021 12:02                4775
fann.requirements.php                              24-Jan-2021 12:02                1028
fann.resources.php                                 24-Jan-2021 12:02                1007
fann.setup.php                                     24-Jan-2021 12:02                1374
fannconnection.construct.php                       24-Jan-2021 12:02                2677
fannconnection.getfromneuron.php                   24-Jan-2021 12:02                2143
fannconnection.gettoneuron.php                     24-Jan-2021 12:02                2127
fannconnection.getweight.php                       24-Jan-2021 12:02                2101
fannconnection.setweight.php                       24-Jan-2021 12:02                2756
faq.build.php                                      24-Jan-2021 12:02               23023
faq.com.php                                        24-Jan-2021 12:02               10589
faq.databases.php                                  24-Jan-2021 12:02               11265
faq.general.php                                    24-Jan-2021 12:02                4448
faq.html.php                                       24-Jan-2021 12:02               19028
faq.installation.php                               24-Jan-2021 12:02               29981
faq.mailinglist.php                                24-Jan-2021 12:02                9605
faq.misc.php                                       24-Jan-2021 12:02               14939
faq.obtaining.php                                  24-Jan-2021 12:02                9550
faq.passwords.php                                  24-Jan-2021 12:02                9614
faq.php                                            24-Jan-2021 12:02                1862
faq.using.php                                      24-Jan-2021 12:02               30420
fbsql.configuration.php                            24-Jan-2021 12:02                3474
fbsql.constants.php                                24-Jan-2021 12:02                5065
fbsql.installation.php                             24-Jan-2021 12:02                2058
fbsql.requirements.php                             24-Jan-2021 12:02                1238
fbsql.resources.php                                24-Jan-2021 12:02                1045
fbsql.setup.php                                    24-Jan-2021 12:02                1417
fdf.configuration.php                              24-Jan-2021 12:02                1076
fdf.constants.php                                  24-Jan-2021 12:02                6172
fdf.examples.php                                   24-Jan-2021 12:02                6501
fdf.installation.php                               24-Jan-2021 12:02                3125
fdf.requirements.php                               24-Jan-2021 12:02                1366
fdf.resources.php                                  24-Jan-2021 12:02                1568
fdf.setup.php                                      24-Jan-2021 12:02                1383
features.commandline.ini.php                       24-Jan-2021 12:01                2039
features.commandline.php                           24-Jan-2021 12:01               45290
features.commandline.webserver.php                 24-Jan-2021 12:01                6134
features.connection-handling.php                   24-Jan-2021 12:01                4376
features.cookies.php                               24-Jan-2021 12:01                2984
features.dtrace.dtrace.php                         24-Jan-2021 12:01               13542
features.dtrace.introduction.php                   24-Jan-2021 12:01                3016
features.dtrace.php                                24-Jan-2021 12:01                1499
features.dtrace.systemtap.php                      24-Jan-2021 12:01                7873
features.file-upload.common-pitfalls.php           24-Jan-2021 12:01                4050
features.file-upload.errors.php                    24-Jan-2021 12:01                3243
features.file-upload.multiple.php                  24-Jan-2021 12:01                4388
features.file-upload.php                           24-Jan-2021 12:01                1617
features.file-upload.post-method.php               24-Jan-2021 12:01               14990
features.file-upload.put-method.php                24-Jan-2021 12:01                7200
features.gc.collecting-cycles.php                  24-Jan-2021 12:01                7087
features.gc.performance-considerations.php         24-Jan-2021 12:01               12929
features.gc.php                                    24-Jan-2021 12:01                1593
features.gc.refcounting-basics.php                 24-Jan-2021 12:01               19900
features.http-auth.php                             24-Jan-2021 12:01               23907
features.persistent-connections.php                24-Jan-2021 12:01                7996
features.php                                       24-Jan-2021 12:01                3232
features.remote-files.php                          24-Jan-2021 12:01                9086
features.session.security.management.php           24-Jan-2021 12:02               24329
features.sessions.php                              24-Jan-2021 12:01                1240
features.xforms.php                                24-Jan-2021 12:01                4702
ffi.addr.php                                       24-Jan-2021 12:01                2601
ffi.alignof.php                                    24-Jan-2021 12:01                2608
ffi.arraytype.php                                  24-Jan-2021 12:01                4291
ffi.cast.php                                       24-Jan-2021 12:01                4707
ffi.cdef.php                                       24-Jan-2021 12:01                3985
ffi.configuration.php                              24-Jan-2021 12:01                3772
ffi.constants.php                                  24-Jan-2021 12:01                 987
ffi.examples-basic.php                             24-Jan-2021 12:01               16964
ffi.examples-callback.php                          24-Jan-2021 12:01                4962
ffi.examples-complete.php                          24-Jan-2021 12:01                5742
ffi.examples.php                                   24-Jan-2021 12:01                1367
ffi.free.php                                       24-Jan-2021 12:01                2272
ffi.installation.php                               24-Jan-2021 12:01                1271
ffi.isnull.php                                     24-Jan-2021 12:01                2262
ffi.load.php                                       24-Jan-2021 12:01                4025
ffi.memcmp.php                                     24-Jan-2021 12:01                3629
ffi.memcpy.php                                     24-Jan-2021 12:01                3020
ffi.memset.php                                     24-Jan-2021 12:01                2862
ffi.new.php                                        24-Jan-2021 12:01                5132
ffi.requirements.php                               24-Jan-2021 12:01                1125
ffi.resources.php                                  24-Jan-2021 12:01                1033
ffi.scope.php                                      24-Jan-2021 12:01                2932
ffi.setup.php                                      24-Jan-2021 12:01                1373
ffi.sizeof.php                                     24-Jan-2021 12:01                2512
ffi.string.php                                     24-Jan-2021 12:01                3523
ffi.type.php                                       24-Jan-2021 12:01                3358
ffi.typeof.php                                     24-Jan-2021 12:01                2601
fileinfo.configuration.php                         24-Jan-2021 12:02                1106
fileinfo.constants.php                             24-Jan-2021 12:02                4628
fileinfo.installation.php                          24-Jan-2021 12:02                2328
fileinfo.requirements.php                          24-Jan-2021 12:02                1118
fileinfo.resources.php                             24-Jan-2021 12:02                1228
fileinfo.setup.php                                 24-Jan-2021 12:02                1445
filepro.configuration.php                          24-Jan-2021 12:02                1100
filepro.constants.php                              24-Jan-2021 12:02                1018
filepro.installation.php                           24-Jan-2021 12:02                1556
filepro.requirements.php                           24-Jan-2021 12:02                1039
filepro.resources.php                              24-Jan-2021 12:02                1057
filepro.setup.php                                  24-Jan-2021 12:02                1431
filesystem.configuration.php                       24-Jan-2021 12:02                7079
filesystem.constants.php                           24-Jan-2021 12:02                8775
filesystem.installation.php                        24-Jan-2021 12:02                1097
filesystem.requirements.php                        24-Jan-2021 12:02                1057
filesystem.resources.php                           24-Jan-2021 12:02                1218
filesystem.setup.php                               24-Jan-2021 12:02                1471
filesystemiterator.construct.php                   24-Jan-2021 12:02                5992
filesystemiterator.current.php                     24-Jan-2021 12:02                5057
filesystemiterator.getflags.php                    24-Jan-2021 12:02                3006
filesystemiterator.key.php                         24-Jan-2021 12:02                5100
filesystemiterator.next.php                        24-Jan-2021 12:02                4369
filesystemiterator.rewind.php                      24-Jan-2021 12:02                4986
filesystemiterator.setflags.php                    24-Jan-2021 12:02                6591
filter.configuration.php                           24-Jan-2021 12:02                4719
filter.constants.php                               24-Jan-2021 12:02               15294
filter.examples.php                                24-Jan-2021 12:02                1314
filter.examples.sanitization.php                   24-Jan-2021 12:02                5961
filter.examples.validation.php                     24-Jan-2021 12:02               10994
filter.filters.flags.php                           24-Jan-2021 12:02               11442
filter.filters.misc.php                            24-Jan-2021 12:02                1748
filter.filters.php                                 24-Jan-2021 12:02                1474
filter.filters.sanitize.php                        24-Jan-2021 12:02                8502
filter.filters.validate.php                        24-Jan-2021 12:02                9353
filter.installation.php                            24-Jan-2021 12:02                1311
filter.requirements.php                            24-Jan-2021 12:02                1033
filter.resources.php                               24-Jan-2021 12:02                1050
filter.setup.php                                   24-Jan-2021 12:02                1409
filteriterator.accept.php                          24-Jan-2021 12:02                5374
filteriterator.construct.php                       24-Jan-2021 12:02                3125
filteriterator.current.php                         24-Jan-2021 12:02                2866
filteriterator.getinneriterator.php                24-Jan-2021 12:02                2314
filteriterator.key.php                             24-Jan-2021 12:02                2802
filteriterator.next.php                            24-Jan-2021 12:02                2727
filteriterator.rewind.php                          24-Jan-2021 12:02                2918
filteriterator.valid.php                           24-Jan-2021 12:02                2282
filters.compression.php                            24-Jan-2021 12:02               16206
filters.convert.php                                24-Jan-2021 12:02                9365
filters.encryption.php                             24-Jan-2021 12:02               11473
filters.php                                        24-Jan-2021 12:02                3008
filters.string.php                                 24-Jan-2021 12:02                5917
filters.string.strip_tags.php                      24-Jan-2021 12:02                5195
finfo.buffer.php                                   24-Jan-2021 12:02                2343
finfo.construct.php                                24-Jan-2021 12:02                2123
finfo.file.php                                     24-Jan-2021 12:02                2336
finfo.set-flags.php                                24-Jan-2021 12:02                1852
fpm.setup.php                                      24-Jan-2021 12:02                1115
ftp.configuration.php                              24-Jan-2021 12:02                1076
ftp.constants.php                                  24-Jan-2021 12:02                3865
ftp.examples-basic.php                             24-Jan-2021 12:02                5114
ftp.examples.php                                   24-Jan-2021 12:02                1208
ftp.installation.php                               24-Jan-2021 12:02                1439
ftp.requirements.php                               24-Jan-2021 12:02                1015
ftp.resources.php                                  24-Jan-2021 12:02                1301
ftp.setup.php                                      24-Jan-2021 12:02                1385
funchand.configuration.php                         24-Jan-2021 12:02                1106
funchand.constants.php                             24-Jan-2021 12:02                1034
funchand.installation.php                          24-Jan-2021 12:02                1085
funchand.requirements.php                          24-Jan-2021 12:02                1045
funchand.resources.php                             24-Jan-2021 12:02                1063
funchand.setup.php                                 24-Jan-2021 12:02                1426
funcref.php                                        24-Jan-2021 12:02               14016
function.abs.php                                   24-Jan-2021 12:02                4576
function.acos.php                                  24-Jan-2021 12:02                3228
function.acosh.php                                 24-Jan-2021 12:02                3511
function.addcslashes.php                           24-Jan-2021 12:02                7812
function.addslashes.php                            24-Jan-2021 12:02                6691
function.apache-child-terminate.php                24-Jan-2021 12:02                2934
function.apache-get-modules.php                    24-Jan-2021 12:02                3550
function.apache-get-version.php                    24-Jan-2021 12:02                3931
function.apache-getenv.php                         24-Jan-2021 12:02                4601
function.apache-lookup-uri.php                     24-Jan-2021 12:02                5479
function.apache-note.php                           24-Jan-2021 12:02                6006
function.apache-request-headers.php                24-Jan-2021 12:02                5189
function.apache-reset-timeout.php                  24-Jan-2021 12:02                2915
function.apache-response-headers.php               24-Jan-2021 12:02                3872
function.apache-setenv.php                         24-Jan-2021 12:02                5109
function.apcu-add.php                              24-Jan-2021 12:01                8132
function.apcu-cache-info.php                       24-Jan-2021 12:01                6291
function.apcu-cas.php                              24-Jan-2021 12:01                8738
function.apcu-clear-cache.php                      24-Jan-2021 12:01                2351
function.apcu-dec.php                              24-Jan-2021 12:01                8224
function.apcu-delete.php                           24-Jan-2021 12:01                5757
function.apcu-enabled.php                          24-Jan-2021 12:01                2083
function.apcu-entry.php                            24-Jan-2021 12:01                8672
function.apcu-exists.php                           24-Jan-2021 12:01                6884
function.apcu-fetch.php                            24-Jan-2021 12:01                5514
function.apcu-inc.php                              24-Jan-2021 12:01                8208
function.apcu-key-info.php                         24-Jan-2021 12:01                4460
function.apcu-sma-info.php                         24-Jan-2021 12:01                4069
function.apcu-store.php                            24-Jan-2021 12:01                6920
function.array-change-key-case.php                 24-Jan-2021 12:02                5398
function.array-chunk.php                           24-Jan-2021 12:02                6476
function.array-column.php                          24-Jan-2021 12:02               17396
function.array-combine.php                         24-Jan-2021 12:02                6663
function.array-count-values.php                    24-Jan-2021 12:02                5405
function.array-diff-assoc.php                      24-Jan-2021 12:02               10361
function.array-diff-key.php                        24-Jan-2021 12:02                9491
function.array-diff-uassoc.php                     24-Jan-2021 12:02               11387
function.array-diff-ukey.php                       24-Jan-2021 12:02               11839
function.array-diff.php                            24-Jan-2021 12:02               11576
function.array-fill-keys.php                       24-Jan-2021 12:02                5142
function.array-fill.php                            24-Jan-2021 12:02                7518
function.array-filter.php                          24-Jan-2021 12:02               16539
function.array-flip.php                            24-Jan-2021 12:02                6893
function.array-intersect-assoc.php                 24-Jan-2021 12:02                8221
function.array-intersect-key.php                   24-Jan-2021 12:02                9442
function.array-intersect-uassoc.php                24-Jan-2021 12:02                8406
function.array-intersect-ukey.php                  24-Jan-2021 12:02               11498
function.array-intersect.php                       24-Jan-2021 12:02                6494
function.array-key-exists.php                      24-Jan-2021 12:02                8494
function.array-key-first.php                       24-Jan-2021 12:02                6973
function.array-key-last.php                        24-Jan-2021 12:02                3017
function.array-keys.php                            24-Jan-2021 12:02                7988
function.array-map.php                             24-Jan-2021 12:02               22488
function.array-merge-recursive.php                 24-Jan-2021 12:02                6643
function.array-merge.php                           24-Jan-2021 12:02               12331
function.array-multisort.php                       24-Jan-2021 12:02               22534
function.array-pad.php                             24-Jan-2021 12:02                6892
function.array-pop.php                             24-Jan-2021 12:02                5805
function.array-product.php                         24-Jan-2021 12:02                4678
function.array-push.php                            24-Jan-2021 12:02                6645
function.array-rand.php                            24-Jan-2021 12:02                6343
function.array-reduce.php                          24-Jan-2021 12:02                9492
function.array-replace-recursive.php               24-Jan-2021 12:02               11172
function.array-replace.php                         24-Jan-2021 12:02                6675
function.array-reverse.php                         24-Jan-2021 12:02                5853
function.array-search.php                          24-Jan-2021 12:02                8570
function.array-shift.php                           24-Jan-2021 12:02                5555
function.array-slice.php                           24-Jan-2021 12:02               13327
function.array-splice.php                          24-Jan-2021 12:02               16800
function.array-sum.php                             24-Jan-2021 12:02                4892
function.array-udiff-assoc.php                     24-Jan-2021 12:02               14109
function.array-udiff-uassoc.php                    24-Jan-2021 12:02               15685
function.array-udiff.php                           24-Jan-2021 12:02               28806
function.array-uintersect-assoc.php                24-Jan-2021 12:02                7868
function.array-uintersect-uassoc.php               24-Jan-2021 12:02                8023
function.array-uintersect.php                      24-Jan-2021 12:02                7797
function.array-unique.php                          24-Jan-2021 12:02                9297
function.array-unshift.php                         24-Jan-2021 12:02                5768
function.array-values.php                          24-Jan-2021 12:02                4379
function.array-walk-recursive.php                  24-Jan-2021 12:02                7154
function.array-walk.php                            24-Jan-2021 12:02               10964
function.array.php                                 24-Jan-2021 12:02               11618
function.arsort.php                                24-Jan-2021 12:02                5939
function.asin.php                                  24-Jan-2021 12:02                3232
function.asinh.php                                 24-Jan-2021 12:02                3500
function.asort.php                                 24-Jan-2021 12:02                5876
function.assert-options.php                        24-Jan-2021 12:01                7818
function.assert.php                                24-Jan-2021 12:01               23615
function.atan.php                                  24-Jan-2021 12:02                3231
function.atan2.php                                 24-Jan-2021 12:02                3124
function.atanh.php                                 24-Jan-2021 12:02                3528
function.autoload.php                              24-Jan-2021 12:02                2865
function.base-convert.php                          24-Jan-2021 12:02                5255
function.base64-decode.php                         24-Jan-2021 12:02                4907
function.base64-encode.php                         24-Jan-2021 12:02                4529
function.basename.php                              24-Jan-2021 12:02                7046
function.bcadd.php                                 24-Jan-2021 12:02                4940
function.bccomp.php                                24-Jan-2021 12:02                4892
function.bcdiv.php                                 24-Jan-2021 12:02                4366
function.bcmod.php                                 24-Jan-2021 12:02                3973
function.bcmul.php                                 24-Jan-2021 12:02                4616
function.bcpow.php                                 24-Jan-2021 12:02                5949
function.bcpowmod.php                              24-Jan-2021 12:02                6740
function.bcscale.php                               24-Jan-2021 12:02                3880
function.bcsqrt.php                                24-Jan-2021 12:02                3925
function.bcsub.php                                 24-Jan-2021 12:02                4924
function.bin2hex.php                               24-Jan-2021 12:02                2853
function.bind-textdomain-codeset.php               24-Jan-2021 12:02                2993
function.bindec.php                                24-Jan-2021 12:02               14805
function.bindtextdomain.php                        24-Jan-2021 12:02                3859
function.blenc-encrypt.php                         24-Jan-2021 12:01                5477
function.boolval.php                               24-Jan-2021 12:02               10423
function.bson-decode.php                           24-Jan-2021 12:02                2349
function.bson-encode.php                           24-Jan-2021 12:02                2453
function.bzclose.php                               24-Jan-2021 12:02                2707
function.bzcompress.php                            24-Jan-2021 12:02                4786
function.bzdecompress.php                          24-Jan-2021 12:02                5286
function.bzerrno.php                               24-Jan-2021 12:02                2877
function.bzerror.php                               24-Jan-2021 12:02                4107
function.bzerrstr.php                              24-Jan-2021 12:02                2891
function.bzflush.php                               24-Jan-2021 12:02                2963
function.bzopen.php                                24-Jan-2021 12:02                4660
function.bzread.php                                24-Jan-2021 12:02                6183
function.bzwrite.php                               24-Jan-2021 12:02                5238
function.cal-days-in-month.php                     24-Jan-2021 12:02                4165
function.cal-from-jd.php                           24-Jan-2021 12:02                6374
function.cal-info.php                              24-Jan-2021 12:02                6001
function.cal-to-jd.php                             24-Jan-2021 12:02                5056
function.call-user-func-array.php                  24-Jan-2021 12:02               15733
function.call-user-func.php                        24-Jan-2021 12:02               15318
function.ceil.php                                  24-Jan-2021 12:02                4292
function.chdir.php                                 24-Jan-2021 12:02                5114
function.checkdate.php                             24-Jan-2021 12:02                5082
function.checkdnsrr.php                            24-Jan-2021 12:02                5447
function.chgrp.php                                 24-Jan-2021 12:02                6389
function.chmod.php                                 24-Jan-2021 12:02                8114
function.chop.php                                  24-Jan-2021 12:02                1901
function.chown.php                                 24-Jan-2021 12:02                6462
function.chr.php                                   24-Jan-2021 12:02                4435
function.chroot.php                                24-Jan-2021 12:02                3600
function.chunk-split.php                           24-Jan-2021 12:02                5109
function.class-alias.php                           24-Jan-2021 12:02                7073
function.class-exists.php                          24-Jan-2021 12:02                6813
function.class-implements.php                      24-Jan-2021 12:02                6922
function.class-parents.php                         24-Jan-2021 12:02                6587
function.class-uses.php                            24-Jan-2021 12:02                6177
function.classkit-import.php                       24-Jan-2021 12:02                6345
function.classkit-method-add.php                   24-Jan-2021 12:02                8204
function.classkit-method-copy.php                  24-Jan-2021 12:02                6986
function.classkit-method-redefine.php              24-Jan-2021 12:02                8640
function.classkit-method-remove.php                24-Jan-2021 12:02                6482
function.classkit-method-rename.php                24-Jan-2021 12:02                6446
function.clearstatcache.php                        24-Jan-2021 12:02               10872
function.cli-get-process-title.php                 24-Jan-2021 12:01                4157
function.cli-set-process-title.php                 24-Jan-2021 12:01                5621
function.closedir.php                              24-Jan-2021 12:02                4409
function.closelog.php                              24-Jan-2021 12:02                2511
function.com-create-guid.php                       24-Jan-2021 12:02                2406
function.com-event-sink.php                        24-Jan-2021 12:02               10327
function.com-get-active-object.php                 24-Jan-2021 12:02                5267
function.com-load-typelib.php                      24-Jan-2021 12:02                4692
function.com-message-pump.php                      24-Jan-2021 12:02                3663
function.com-print-typeinfo.php                    24-Jan-2021 12:02                4514
function.commonmark-parse.php                      24-Jan-2021 12:02                3414
function.commonmark-render-html.php                24-Jan-2021 12:02                3797
function.commonmark-render-latex.php               24-Jan-2021 12:02                4076
function.commonmark-render-man.php                 24-Jan-2021 12:02                4060
function.commonmark-render-xml.php                 24-Jan-2021 12:02                3755
function.commonmark-render.php                     24-Jan-2021 12:02                4010
function.compact.php                               24-Jan-2021 12:02                7409
function.connection-aborted.php                    24-Jan-2021 12:02                2593
function.connection-status.php                     24-Jan-2021 12:02                2668
function.constant.php                              24-Jan-2021 12:02                6396
function.convert-cyr-string.php                    24-Jan-2021 12:02                3868
function.convert-uudecode.php                      24-Jan-2021 12:02                3650
function.convert-uuencode.php                      24-Jan-2021 12:02                4124
function.copy.php                                  24-Jan-2021 12:02                5464
function.cos.php                                   24-Jan-2021 12:02                3772
function.cosh.php                                  24-Jan-2021 12:02                2920
function.count-chars.php                           24-Jan-2021 12:02                6607
function.count.php                                 24-Jan-2021 12:02               11383
function.crc32.php                                 24-Jan-2021 12:02                6612
function.create-function.php                       24-Jan-2021 12:02               17966
function.crypt.php                                 24-Jan-2021 12:02               20480
function.ctype-alnum.php                           24-Jan-2021 12:02                5790
function.ctype-alpha.php                           24-Jan-2021 12:02                6190
function.ctype-cntrl.php                           24-Jan-2021 12:02                5831
function.ctype-digit.php                           24-Jan-2021 12:02                9255
function.ctype-graph.php                           24-Jan-2021 12:02                6508
function.ctype-lower.php                           24-Jan-2021 12:02                5969
function.ctype-print.php                           24-Jan-2021 12:02                6592
function.ctype-punct.php                           24-Jan-2021 12:02                5867
function.ctype-space.php                           24-Jan-2021 12:02                6560
function.ctype-upper.php                           24-Jan-2021 12:02                5921
function.ctype-xdigit.php                          24-Jan-2021 12:02                5672
function.cubrid-affected-rows.php                  24-Jan-2021 12:02                9179
function.cubrid-bind.php                           24-Jan-2021 12:02               21149
function.cubrid-client-encoding.php                24-Jan-2021 12:02                5018
function.cubrid-close-prepare.php                  24-Jan-2021 12:02                6557
function.cubrid-close-request.php                  24-Jan-2021 12:02                6568
function.cubrid-close.php                          24-Jan-2021 12:02                6391
function.cubrid-col-get.php                        24-Jan-2021 12:02                8362
function.cubrid-col-size.php                       24-Jan-2021 12:02                8510
function.cubrid-column-names.php                   24-Jan-2021 12:02                8540
function.cubrid-column-types.php                   24-Jan-2021 12:02                8521
function.cubrid-commit.php                         24-Jan-2021 12:02               16092
function.cubrid-connect-with-url.php               24-Jan-2021 12:02               15307
function.cubrid-connect.php                        24-Jan-2021 12:02               11900
function.cubrid-current-oid.php                    24-Jan-2021 12:02                5751
function.cubrid-data-seek.php                      24-Jan-2021 12:02                7117
function.cubrid-db-name.php                        24-Jan-2021 12:02                6265
function.cubrid-disconnect.php                     24-Jan-2021 12:02                7383
function.cubrid-drop.php                           24-Jan-2021 12:02               11472
function.cubrid-errno.php                          24-Jan-2021 12:02                6809
function.cubrid-error-code-facility.php            24-Jan-2021 12:02                5693
function.cubrid-error-code.php                     24-Jan-2021 12:02                5746
function.cubrid-error-msg.php                      24-Jan-2021 12:02                5145
function.cubrid-error.php                          24-Jan-2021 12:02                6367
function.cubrid-execute.php                        24-Jan-2021 12:02               13946
function.cubrid-fetch-array.php                    24-Jan-2021 12:02                9803
function.cubrid-fetch-assoc.php                    24-Jan-2021 12:02                9011
function.cubrid-fetch-field.php                    24-Jan-2021 12:02               14061
function.cubrid-fetch-lengths.php                  24-Jan-2021 12:02                5886
function.cubrid-fetch-object.php                   24-Jan-2021 12:02               11993
function.cubrid-fetch-row.php                      24-Jan-2021 12:02                8897
function.cubrid-fetch.php                          24-Jan-2021 12:02               10089
function.cubrid-field-flags.php                    24-Jan-2021 12:02                7555
function.cubrid-field-len.php                      24-Jan-2021 12:02                8138
function.cubrid-field-name.php                     24-Jan-2021 12:02                6971
function.cubrid-field-seek.php                     24-Jan-2021 12:02               10711
function.cubrid-field-table.php                    24-Jan-2021 12:02                7193
function.cubrid-field-type.php                     24-Jan-2021 12:02                7257
function.cubrid-free-result.php                    24-Jan-2021 12:02                5483
function.cubrid-get-autocommit.php                 24-Jan-2021 12:02                3419
function.cubrid-get-charset.php                    24-Jan-2021 12:02                4767
function.cubrid-get-class-name.php                 24-Jan-2021 12:02                6086
function.cubrid-get-client-info.php                24-Jan-2021 12:02                8133
function.cubrid-get-db-parameter.php               24-Jan-2021 12:02               14225
function.cubrid-get-query-timeout.php              24-Jan-2021 12:02                6445
function.cubrid-get-server-info.php                24-Jan-2021 12:02                8369
function.cubrid-get.php                            24-Jan-2021 12:02                9916
function.cubrid-insert-id.php                      24-Jan-2021 12:02                6963
function.cubrid-is-instance.php                    24-Jan-2021 12:02                7219
function.cubrid-list-dbs.php                       24-Jan-2021 12:02                4239
function.cubrid-load-from-glo.php                  24-Jan-2021 12:02                6665
function.cubrid-lob-close.php                      24-Jan-2021 12:02                7083
function.cubrid-lob-export.php                     24-Jan-2021 12:02                7644
function.cubrid-lob-get.php                        24-Jan-2021 12:02                7547
function.cubrid-lob-send.php                       24-Jan-2021 12:02                6846
function.cubrid-lob-size.php                       24-Jan-2021 12:02                5673
function.cubrid-lob2-bind.php                      24-Jan-2021 12:02                9481
function.cubrid-lob2-close.php                     24-Jan-2021 12:02                3073
function.cubrid-lob2-export.php                    24-Jan-2021 12:02                8555
function.cubrid-lob2-import.php                    24-Jan-2021 12:02                8419
function.cubrid-lob2-new.php                       24-Jan-2021 12:02                3599
function.cubrid-lob2-read.php                      24-Jan-2021 12:02               14343
function.cubrid-lob2-seek.php                      24-Jan-2021 12:02               11025
function.cubrid-lob2-seek64.php                    24-Jan-2021 12:02               12563
function.cubrid-lob2-size.php                      24-Jan-2021 12:02                4124
function.cubrid-lob2-size64.php                    24-Jan-2021 12:02                4300
function.cubrid-lob2-tell.php                      24-Jan-2021 12:02                4144
function.cubrid-lob2-tell64.php                    24-Jan-2021 12:02                4338
function.cubrid-lob2-write.php                     24-Jan-2021 12:02               14206
function.cubrid-lock-read.php                      24-Jan-2021 12:02                9051
function.cubrid-lock-write.php                     24-Jan-2021 12:02                9468
function.cubrid-move-cursor.php                    24-Jan-2021 12:02                8957
function.cubrid-new-glo.php                        24-Jan-2021 12:02                6832
function.cubrid-next-result.php                    24-Jan-2021 12:02               17078
function.cubrid-num-cols.php                       24-Jan-2021 12:02                5743
function.cubrid-num-fields.php                     24-Jan-2021 12:02                5452
function.cubrid-num-rows.php                       24-Jan-2021 12:02                6933
function.cubrid-pconnect-with-url.php              24-Jan-2021 12:02               14817
function.cubrid-pconnect.php                       24-Jan-2021 12:02               11809
function.cubrid-ping.php                           24-Jan-2021 12:02                6133
function.cubrid-prepare.php                        24-Jan-2021 12:02               10200
function.cubrid-put.php                            24-Jan-2021 12:02               11265
function.cubrid-query.php                          24-Jan-2021 12:02               15120
function.cubrid-real-escape-string.php             24-Jan-2021 12:02                7973
function.cubrid-result.php                         24-Jan-2021 12:02                7189
function.cubrid-rollback.php                       24-Jan-2021 12:02               15373
function.cubrid-save-to-glo.php                    24-Jan-2021 12:02                6586
function.cubrid-schema.php                         24-Jan-2021 12:02               19981
function.cubrid-send-glo.php                       24-Jan-2021 12:02                6016
function.cubrid-seq-drop.php                       24-Jan-2021 12:02                9470
function.cubrid-seq-insert.php                     24-Jan-2021 12:02                9902
function.cubrid-seq-put.php                        24-Jan-2021 12:02                9832
function.cubrid-set-add.php                        24-Jan-2021 12:02                9225
function.cubrid-set-autocommit.php                 24-Jan-2021 12:02                3862
function.cubrid-set-db-parameter.php               24-Jan-2021 12:02                7813
function.cubrid-set-drop.php                       24-Jan-2021 12:02                9201
function.cubrid-set-query-timeout.php              24-Jan-2021 12:02                3201
function.cubrid-unbuffered-query.php               24-Jan-2021 12:02                6985
function.cubrid-version.php                        24-Jan-2021 12:02                8731
function.curl-close.php                            24-Jan-2021 12:02                4915
function.curl-copy-handle.php                      24-Jan-2021 12:02                4886
function.curl-errno.php                            24-Jan-2021 12:02                5169
function.curl-error.php                            24-Jan-2021 12:02                5129
function.curl-escape.php                           24-Jan-2021 12:02                6523
function.curl-exec.php                             24-Jan-2021 12:02                6079
function.curl-file-create.php                      24-Jan-2021 12:02                1540
function.curl-getinfo.php                          24-Jan-2021 12:02               12728
function.curl-init.php                             24-Jan-2021 12:02                5779
function.curl-multi-add-handle.php                 24-Jan-2021 12:02                8598
function.curl-multi-close.php                      24-Jan-2021 12:02                7878
function.curl-multi-errno.php                      24-Jan-2021 12:02                2773
function.curl-multi-exec.php                       24-Jan-2021 12:02               10322
function.curl-multi-getcontent.php                 24-Jan-2021 12:02                3054
function.curl-multi-info-read.php                  24-Jan-2021 12:02               11309
function.curl-multi-init.php                       24-Jan-2021 12:02                7806
function.curl-multi-remove-handle.php              24-Jan-2021 12:02                3944
function.curl-multi-select.php                     24-Jan-2021 12:02                3196
function.curl-multi-setopt.php                     24-Jan-2021 12:02                4558
function.curl-multi-strerror.php                   24-Jan-2021 12:02                6801
function.curl-pause.php                            24-Jan-2021 12:02                2693
function.curl-reset.php                            24-Jan-2021 12:02                5539
function.curl-setopt-array.php                     24-Jan-2021 12:02                8946
function.curl-setopt.php                           24-Jan-2021 12:02               90449
function.curl-share-close.php                      24-Jan-2021 12:02                7190
function.curl-share-errno.php                      24-Jan-2021 12:02                2830
function.curl-share-init.php                       24-Jan-2021 12:02                6830
function.curl-share-setopt.php                     24-Jan-2021 12:02                9271
function.curl-share-strerror.php                   24-Jan-2021 12:02                2978
function.curl-strerror.php                         24-Jan-2021 12:02                5883
function.curl-unescape.php                         24-Jan-2021 12:02                6954
function.curl-version.php                          24-Jan-2021 12:02                6390
function.current.php                               24-Jan-2021 12:02                8846
function.date-add.php                              24-Jan-2021 12:02                1588
function.date-create-from-format.php               24-Jan-2021 12:02                1748
function.date-create-immutable-from-format.php     24-Jan-2021 12:02                1850
function.date-create-immutable.php                 24-Jan-2021 12:02                1754
function.date-create.php                           24-Jan-2021 12:02                1638
function.date-date-set.php                         24-Jan-2021 12:02                1642
function.date-default-timezone-get.php             24-Jan-2021 12:02                8064
function.date-default-timezone-set.php             24-Jan-2021 12:02                6371
function.date-diff.php                             24-Jan-2021 12:02                1606
function.date-format.php                           24-Jan-2021 12:02                1612
function.date-get-last-errors.php                  24-Jan-2021 12:02                1732
function.date-interval-create-from-date-string.php 24-Jan-2021 12:02                1862
function.date-interval-format.php                  24-Jan-2021 12:02                1730
function.date-isodate-set.php                      24-Jan-2021 12:02                1662
function.date-modify.php                           24-Jan-2021 12:02                1616
function.date-offset-get.php                       24-Jan-2021 12:02                1656
function.date-parse-from-format.php                24-Jan-2021 12:02                5660
function.date-parse.php                            24-Jan-2021 12:02                6673
function.date-sub.php                              24-Jan-2021 12:02                1570
function.date-sun-info.php                         24-Jan-2021 12:02               11140
function.date-sunrise.php                          24-Jan-2021 12:02                8869
function.date-sunset.php                           24-Jan-2021 12:02                8900
function.date-time-set.php                         24-Jan-2021 12:02                1628
function.date-timestamp-get.php                    24-Jan-2021 12:02                1682
function.date-timestamp-set.php                    24-Jan-2021 12:02                1690
function.date-timezone-get.php                     24-Jan-2021 12:02                1680
function.date-timezone-set.php                     24-Jan-2021 12:02                1652
function.date.php                                  24-Jan-2021 12:02               61421
function.db2-autocommit.php                        24-Jan-2021 12:02               10798
function.db2-bind-param.php                        24-Jan-2021 12:02               22382
function.db2-client-info.php                       24-Jan-2021 12:02               12021
function.db2-close.php                             24-Jan-2021 12:02                5380
function.db2-column-privileges.php                 24-Jan-2021 12:02                7684
function.db2-columns.php                           24-Jan-2021 12:02                9590
function.db2-commit.php                            24-Jan-2021 12:02                3389
function.db2-conn-error.php                        24-Jan-2021 12:02                6524
function.db2-conn-errormsg.php                     24-Jan-2021 12:02                6293
function.db2-connect.php                           24-Jan-2021 12:02               40292
function.db2-cursor-type.php                       24-Jan-2021 12:02                2946
function.db2-escape-string.php                     24-Jan-2021 12:02                7842
function.db2-exec.php                              24-Jan-2021 12:02               28608
function.db2-execute.php                           24-Jan-2021 12:02               27512
function.db2-fetch-array.php                       24-Jan-2021 12:02               11257
function.db2-fetch-assoc.php                       24-Jan-2021 12:02               11273
function.db2-fetch-both.php                        24-Jan-2021 12:02               11807
function.db2-fetch-object.php                      24-Jan-2021 12:02                8897
function.db2-fetch-row.php                         24-Jan-2021 12:02               16555
function.db2-field-display-size.php                24-Jan-2021 12:02                4696
function.db2-field-name.php                        24-Jan-2021 12:02                4590
function.db2-field-num.php                         24-Jan-2021 12:02                4601
function.db2-field-precision.php                   24-Jan-2021 12:02                4627
function.db2-field-scale.php                       24-Jan-2021 12:02                4593
function.db2-field-type.php                        24-Jan-2021 12:02                4595
function.db2-field-width.php                       24-Jan-2021 12:02                4801
function.db2-foreign-keys.php                      24-Jan-2021 12:02                8329
function.db2-free-result.php                       24-Jan-2021 12:02                3027
function.db2-free-stmt.php                         24-Jan-2021 12:02                3017
function.db2-get-option.php                        24-Jan-2021 12:02               24824
function.db2-last-insert-id.php                    24-Jan-2021 12:02                8430
function.db2-lob-read.php                          24-Jan-2021 12:02               17627
function.db2-next-result.php                       24-Jan-2021 12:02                8853
function.db2-num-fields.php                        24-Jan-2021 12:02                6944
function.db2-num-rows.php                          24-Jan-2021 12:02                4142
function.db2-pclose.php                            24-Jan-2021 12:02                5563
function.db2-pconnect.php                          24-Jan-2021 12:02               32271
function.db2-prepare.php                           24-Jan-2021 12:02               10478
function.db2-primary-keys.php                      24-Jan-2021 12:02                6963
function.db2-procedure-columns.php                 24-Jan-2021 12:02               10990
function.db2-procedures.php                        24-Jan-2021 12:02                7403
function.db2-result.php                            24-Jan-2021 12:02                7770
function.db2-rollback.php                          24-Jan-2021 12:02                9679
function.db2-server-info.php                       24-Jan-2021 12:02               24152
function.db2-set-option.php                        24-Jan-2021 12:02               70410
function.db2-special-columns.php                   24-Jan-2021 12:02                9522
function.db2-statistics.php                        24-Jan-2021 12:02               11664
function.db2-stmt-error.php                        24-Jan-2021 12:02                4205
function.db2-stmt-errormsg.php                     24-Jan-2021 12:02                3833
function.db2-table-privileges.php                  24-Jan-2021 12:02                7488
function.db2-tables.php                            24-Jan-2021 12:02                7504
function.dba-close.php                             24-Jan-2021 12:02                2976
function.dba-delete.php                            24-Jan-2021 12:02                3710
function.dba-exists.php                            24-Jan-2021 12:02                3742
function.dba-fetch.php                             24-Jan-2021 12:02                5143
function.dba-firstkey.php                          24-Jan-2021 12:02                3349
function.dba-handlers.php                          24-Jan-2021 12:02                5251
function.dba-insert.php                            24-Jan-2021 12:02                4296
function.dba-key-split.php                         24-Jan-2021 12:02                3468
function.dba-list.php                              24-Jan-2021 12:02                1851
function.dba-nextkey.php                           24-Jan-2021 12:02                3272
function.dba-open.php                              24-Jan-2021 12:02               11089
function.dba-optimize.php                          24-Jan-2021 12:02                2857
function.dba-popen.php                             24-Jan-2021 12:02                6088
function.dba-replace.php                           24-Jan-2021 12:02                4123
function.dba-sync.php                              24-Jan-2021 12:02                2878
function.dbase-add-record.php                      24-Jan-2021 12:02                6650
function.dbase-close.php                           24-Jan-2021 12:02                4885
function.dbase-create.php                          24-Jan-2021 12:02                7859
function.dbase-delete-record.php                   24-Jan-2021 12:02                4473
function.dbase-get-header-info.php                 24-Jan-2021 12:02                6726
function.dbase-get-record-with-names.php           24-Jan-2021 12:02                8543
function.dbase-get-record.php                      24-Jan-2021 12:02                5166
function.dbase-numfields.php                       24-Jan-2021 12:02                5629
function.dbase-numrecords.php                      24-Jan-2021 12:02                6936
function.dbase-open.php                            24-Jan-2021 12:02                6066
function.dbase-pack.php                            24-Jan-2021 12:02                6063
function.dbase-replace-record.php                  24-Jan-2021 12:02                9198
function.dbplus-add.php                            24-Jan-2021 12:02                3613
function.dbplus-aql.php                            24-Jan-2021 12:02                3701
function.dbplus-chdir.php                          24-Jan-2021 12:02                2931
function.dbplus-close.php                          24-Jan-2021 12:02                3006
function.dbplus-curr.php                           24-Jan-2021 12:02                4311
function.dbplus-errcode.php                        24-Jan-2021 12:02                2782
function.dbplus-errno.php                          24-Jan-2021 12:02                2620
function.dbplus-find.php                           24-Jan-2021 12:02                4704
function.dbplus-first.php                          24-Jan-2021 12:02                4309
function.dbplus-flush.php                          24-Jan-2021 12:02                3272
function.dbplus-freealllocks.php                   24-Jan-2021 12:02                2998
function.dbplus-freelock.php                       24-Jan-2021 12:02                3908
function.dbplus-freerlocks.php                     24-Jan-2021 12:02                3559
function.dbplus-getlock.php                        24-Jan-2021 12:02                3895
function.dbplus-getunique.php                      24-Jan-2021 12:02                3233
function.dbplus-info.php                           24-Jan-2021 12:02                3066
function.dbplus-last.php                           24-Jan-2021 12:02                4097
function.dbplus-lockrel.php                        24-Jan-2021 12:02                2869
function.dbplus-next.php                           24-Jan-2021 12:02                4102
function.dbplus-open.php                           24-Jan-2021 12:02                3049
function.dbplus-prev.php                           24-Jan-2021 12:02                4106
function.dbplus-rchperm.php                        24-Jan-2021 12:02                3572
function.dbplus-rcreate.php                        24-Jan-2021 12:02                4227
function.dbplus-rcrtexact.php                      24-Jan-2021 12:02                3890
function.dbplus-rcrtlike.php                       24-Jan-2021 12:02                3935
function.dbplus-resolve.php                        24-Jan-2021 12:02                3422
function.dbplus-restorepos.php                     24-Jan-2021 12:02                3026
function.dbplus-rkeys.php                          24-Jan-2021 12:02                3558
function.dbplus-ropen.php                          24-Jan-2021 12:02                2990
function.dbplus-rquery.php                         24-Jan-2021 12:02                3185
function.dbplus-rrename.php                        24-Jan-2021 12:02                3072
function.dbplus-rsecindex.php                      24-Jan-2021 12:02                3874
function.dbplus-runlink.php                        24-Jan-2021 12:02                2818
function.dbplus-rzap.php                           24-Jan-2021 12:02                2789
function.dbplus-savepos.php                        24-Jan-2021 12:02                2765
function.dbplus-setindex.php                       24-Jan-2021 12:02                3028
function.dbplus-setindexbynumber.php               24-Jan-2021 12:02                3095
function.dbplus-sql.php                            24-Jan-2021 12:02                3147
function.dbplus-tcl.php                            24-Jan-2021 12:02                3865
function.dbplus-tremove.php                        24-Jan-2021 12:02                3588
function.dbplus-undo.php                           24-Jan-2021 12:02                2738
function.dbplus-undoprepare.php                    24-Jan-2021 12:02                2806
function.dbplus-unlockrel.php                      24-Jan-2021 12:02                2869
function.dbplus-unselect.php                       24-Jan-2021 12:02                2966
function.dbplus-update.php                         24-Jan-2021 12:02                3486
function.dbplus-xlockrel.php                       24-Jan-2021 12:02                3199
function.dbplus-xunlockrel.php                     24-Jan-2021 12:02                2858
function.dbx-close.php                             24-Jan-2021 12:02                4306
function.dbx-compare.php                           24-Jan-2021 12:02                9366
function.dbx-connect.php                           24-Jan-2021 12:02               10487
function.dbx-error.php                             24-Jan-2021 12:02                5599
function.dbx-escape-string.php                     24-Jan-2021 12:02                6017
function.dbx-fetch-row.php                         24-Jan-2021 12:02                6305
function.dbx-query.php                             24-Jan-2021 12:02               22782
function.dbx-sort.php                              24-Jan-2021 12:02                8003
function.dcgettext.php                             24-Jan-2021 12:02                3106
function.dcngettext.php                            24-Jan-2021 12:02                3515
function.debug-backtrace.php                       24-Jan-2021 12:01               10275
function.debug-print-backtrace.php                 24-Jan-2021 12:01                6933
function.debug-zval-dump.php                       24-Jan-2021 12:02                9803
function.decbin.php                                24-Jan-2021 12:02                8679
function.dechex.php                                24-Jan-2021 12:02                6912
function.decoct.php                                24-Jan-2021 12:02                4379
function.define-syslog-variables.php               24-Jan-2021 12:02               11976
function.define.php                                24-Jan-2021 12:02               10294
function.defined.php                               24-Jan-2021 12:02                5008
function.deflate-add.php                           24-Jan-2021 12:02                4925
function.deflate-init.php                          24-Jan-2021 12:02                6980
function.deg2rad.php                               24-Jan-2021 12:02                3771
function.delete.php                                24-Jan-2021 12:02                2283
function.dgettext.php                              24-Jan-2021 12:02                2909
function.die.php                                   24-Jan-2021 12:02                1464
function.dio-close.php                             24-Jan-2021 12:02                3787
function.dio-fcntl.php                             24-Jan-2021 12:02                8770
function.dio-open.php                              24-Jan-2021 12:02                7384
function.dio-read.php                              24-Jan-2021 12:02                3221
function.dio-seek.php                              24-Jan-2021 12:02                7287
function.dio-stat.php                              24-Jan-2021 12:02                3981
function.dio-tcsetattr.php                         24-Jan-2021 12:02                6811
function.dio-truncate.php                          24-Jan-2021 12:02                3325
function.dio-write.php                             24-Jan-2021 12:02                3489
function.dir.php                                   24-Jan-2021 12:02                6231
function.dirname.php                               24-Jan-2021 12:02                7226
function.disk-free-space.php                       24-Jan-2021 12:02                4970
function.disk-total-space.php                      24-Jan-2021 12:02                5069
function.diskfreespace.php                         24-Jan-2021 12:02                1626
function.dl.php                                    24-Jan-2021 12:01                9309
function.dngettext.php                             24-Jan-2021 12:02                3357
function.dns-check-record.php                      24-Jan-2021 12:02                1621
function.dns-get-mx.php                            24-Jan-2021 12:02                1567
function.dns-get-record.php                        24-Jan-2021 12:02               26957
function.dom-import-simplexml.php                  24-Jan-2021 12:02                6434
function.doubleval.php                             24-Jan-2021 12:02                2064
function.each.php                                  24-Jan-2021 12:02               11046
function.easter-date.php                           24-Jan-2021 12:02                6101
function.easter-days.php                           24-Jan-2021 12:02                6395
function.echo.php                                  24-Jan-2021 12:02               11569
function.eio-busy.php                              24-Jan-2021 12:02                4173
function.eio-cancel.php                            24-Jan-2021 12:02                7110
function.eio-chmod.php                             24-Jan-2021 12:02                5337
function.eio-chown.php                             24-Jan-2021 12:02                5461
function.eio-close.php                             24-Jan-2021 12:02                4946
function.eio-custom.php                            24-Jan-2021 12:02                9987
function.eio-dup2.php                              24-Jan-2021 12:02                5011
function.eio-event-loop.php                        24-Jan-2021 12:02                5658
function.eio-fallocate.php                         24-Jan-2021 12:02                6403
function.eio-fchmod.php                            24-Jan-2021 12:02                5395
function.eio-fchown.php                            24-Jan-2021 12:02                5280
function.eio-fdatasync.php                         24-Jan-2021 12:02                4847
function.eio-fstat.php                             24-Jan-2021 12:02               11264
function.eio-fstatvfs.php                          24-Jan-2021 12:02                4985
function.eio-fsync.php                             24-Jan-2021 12:02                4962
function.eio-ftruncate.php                         24-Jan-2021 12:02                5410
function.eio-futime.php                            24-Jan-2021 12:02                5643
function.eio-get-event-stream.php                  24-Jan-2021 12:02                8345
function.eio-get-last-error.php                    24-Jan-2021 12:02                2841
function.eio-grp-add.php                           24-Jan-2021 12:02               12038
function.eio-grp-cancel.php                        24-Jan-2021 12:02                2918
function.eio-grp-limit.php                         24-Jan-2021 12:02                2768
function.eio-grp.php                               24-Jan-2021 12:02               11963
function.eio-init.php                              24-Jan-2021 12:02                2986
function.eio-link.php                              24-Jan-2021 12:02               12215
function.eio-lstat.php                             24-Jan-2021 12:02                9304
function.eio-mkdir.php                             24-Jan-2021 12:02                8597
function.eio-mknod.php                             24-Jan-2021 12:02               10438
function.eio-nop.php                               24-Jan-2021 12:02                4685
function.eio-npending.php                          24-Jan-2021 12:02                2829
function.eio-nready.php                            24-Jan-2021 12:02                2579
function.eio-nreqs.php                             24-Jan-2021 12:02                5429
function.eio-nthreads.php                          24-Jan-2021 12:02                3296
function.eio-open.php                              24-Jan-2021 12:02               11170
function.eio-poll.php                              24-Jan-2021 12:02                5591
function.eio-read.php                              24-Jan-2021 12:02               12486
function.eio-readahead.php                         24-Jan-2021 12:02                5362
function.eio-readdir.php                           24-Jan-2021 12:02               15299
function.eio-readlink.php                          24-Jan-2021 12:02               11814
function.eio-realpath.php                          24-Jan-2021 12:02                4883
function.eio-rename.php                            24-Jan-2021 12:02                8710
function.eio-rmdir.php                             24-Jan-2021 12:02                7660
function.eio-seek.php                              24-Jan-2021 12:02                6060
function.eio-sendfile.php                          24-Jan-2021 12:02                5609
function.eio-set-max-idle.php                      24-Jan-2021 12:02                2940
function.eio-set-max-parallel.php                  24-Jan-2021 12:02                2985
function.eio-set-max-poll-reqs.php                 24-Jan-2021 12:02                2263
function.eio-set-max-poll-time.php                 24-Jan-2021 12:02                2333
function.eio-set-min-parallel.php                  24-Jan-2021 12:02                2974
function.eio-stat.php                              24-Jan-2021 12:02                9277
function.eio-statvfs.php                           24-Jan-2021 12:02                7625
function.eio-symlink.php                           24-Jan-2021 12:02               10324
function.eio-sync-file-range.php                   24-Jan-2021 12:02                6189
function.eio-sync.php                              24-Jan-2021 12:02                2603
function.eio-syncfs.php                            24-Jan-2021 12:02                4533
function.eio-truncate.php                          24-Jan-2021 12:02                5287
function.eio-unlink.php                            24-Jan-2021 12:02                4538
function.eio-utime.php                             24-Jan-2021 12:02                5251
function.eio-write.php                             24-Jan-2021 12:02                5991
function.empty.php                                 24-Jan-2021 12:02               11485
function.enchant-broker-describe.php               24-Jan-2021 12:02                5721
function.enchant-broker-dict-exists.php            24-Jan-2021 12:02                5432
function.enchant-broker-free-dict.php              24-Jan-2021 12:02                4477
function.enchant-broker-free.php                   24-Jan-2021 12:02                4019
function.enchant-broker-get-dict-path.php          24-Jan-2021 12:02                4829
function.enchant-broker-get-error.php              24-Jan-2021 12:02                3364
function.enchant-broker-init.php                   24-Jan-2021 12:02                3243
function.enchant-broker-list-dicts.php             24-Jan-2021 12:02                6579
function.enchant-broker-request-dict.php           24-Jan-2021 12:02                6834
function.enchant-broker-request-pwl-dict.php       24-Jan-2021 12:02                5076
function.enchant-broker-set-dict-path.php          24-Jan-2021 12:02                5036
function.enchant-broker-set-ordering.php           24-Jan-2021 12:02                4363
function.enchant-dict-add-to-personal.php          24-Jan-2021 12:02                2031
function.enchant-dict-add-to-session.php           24-Jan-2021 12:02                4188
function.enchant-dict-add.php                      24-Jan-2021 12:02                6101
function.enchant-dict-check.php                    24-Jan-2021 12:02                3772
function.enchant-dict-describe.php                 24-Jan-2021 12:02                6232
function.enchant-dict-get-error.php                24-Jan-2021 12:02                3569
function.enchant-dict-is-added.php                 24-Jan-2021 12:02                4119
function.enchant-dict-is-in-session.php            24-Jan-2021 12:02                2019
function.enchant-dict-quick-check.php              24-Jan-2021 12:02                7812
function.enchant-dict-store-replacement.php        24-Jan-2021 12:02                4305
function.enchant-dict-suggest.php                  24-Jan-2021 12:02                7524
function.end.php                                   24-Jan-2021 12:02                4826
function.ereg-replace.php                          24-Jan-2021 12:02                9437
function.ereg.php                                  24-Jan-2021 12:02                6290
function.eregi-replace.php                         24-Jan-2021 12:02                3935
function.eregi.php                                 24-Jan-2021 12:02                3701
function.error-clear-last.php                      24-Jan-2021 12:01                4198
function.error-get-last.php                        24-Jan-2021 12:01                4327
function.error-log.php                             24-Jan-2021 12:01                9528
function.error-reporting.php                       24-Jan-2021 12:01                9034
function.escapeshellarg.php                        24-Jan-2021 12:02                4609
function.escapeshellcmd.php                        24-Jan-2021 12:02                6635
function.eval.php                                  24-Jan-2021 12:02                8004
function.exec.php                                  24-Jan-2021 12:02                7238
function.exif-imagetype.php                        24-Jan-2021 12:02                7597
function.exif-read-data.php                        24-Jan-2021 12:02               14879
function.exif-tagname.php                          24-Jan-2021 12:02                4345
function.exif-thumbnail.php                        24-Jan-2021 12:02                8645
function.exit.php                                  24-Jan-2021 12:02                9078
function.exp.php                                   24-Jan-2021 12:02                4058
function.expect-expectl.php                        24-Jan-2021 12:02               11355
function.expect-popen.php                          24-Jan-2021 12:02                4406
function.explode.php                               24-Jan-2021 12:02               13754
function.expm1.php                                 24-Jan-2021 12:02                3576
function.extension-loaded.php                      24-Jan-2021 12:01                5180
function.extract.php                               24-Jan-2021 12:02               12306
function.ezmlm-hash.php                            24-Jan-2021 12:02                4015
function.fann-cascadetrain-on-data.php             24-Jan-2021 12:02                5711
function.fann-cascadetrain-on-file.php             24-Jan-2021 12:02                4965
function.fann-clear-scaling-params.php             24-Jan-2021 12:02                2384
function.fann-copy.php                             24-Jan-2021 12:02                2677
function.fann-create-from-file.php                 24-Jan-2021 12:02                2953
function.fann-create-shortcut-array.php            24-Jan-2021 12:02                3708
function.fann-create-shortcut.php                  24-Jan-2021 12:02                4492
function.fann-create-sparse-array.php              24-Jan-2021 12:02                4399
function.fann-create-sparse.php                    24-Jan-2021 12:02                4878
function.fann-create-standard-array.php            24-Jan-2021 12:02                4041
function.fann-create-standard.php                  24-Jan-2021 12:02                4611
function.fann-create-train-from-callback.php       24-Jan-2021 12:02                8502
function.fann-create-train.php                     24-Jan-2021 12:02                3923
function.fann-descale-input.php                    24-Jan-2021 12:02                3383
function.fann-descale-output.php                   24-Jan-2021 12:02                3395
function.fann-descale-train.php                    24-Jan-2021 12:02                3382
function.fann-destroy-train.php                    24-Jan-2021 12:02                2345
function.fann-destroy.php                          24-Jan-2021 12:02                2376
function.fann-duplicate-train-data.php             24-Jan-2021 12:02                2538
function.fann-get-activation-function.php          24-Jan-2021 12:02                4770
function.fann-get-activation-steepness.php         24-Jan-2021 12:02                5005
function.fann-get-bias-array.php                   24-Jan-2021 12:02                2337
function.fann-get-bit-fail-limit.php               24-Jan-2021 12:02                3370
function.fann-get-bit-fail.php                     24-Jan-2021 12:02                4625
function.fann-get-cascade-activation-functions-..> 24-Jan-2021 12:02                3509
function.fann-get-cascade-activation-functions.php 24-Jan-2021 12:02                3929
function.fann-get-cascade-activation-steepnesse..> 24-Jan-2021 12:02                3550
function.fann-get-cascade-activation-steepnesse..> 24-Jan-2021 12:02                3664
function.fann-get-cascade-candidate-change-frac..> 24-Jan-2021 12:02                4699
function.fann-get-cascade-candidate-limit.php      24-Jan-2021 12:02                3247
function.fann-get-cascade-candidate-stagnation-..> 24-Jan-2021 12:02                3878
function.fann-get-cascade-max-cand-epochs.php      24-Jan-2021 12:02                3103
function.fann-get-cascade-max-out-epochs.php       24-Jan-2021 12:02                3070
function.fann-get-cascade-min-cand-epochs.php      24-Jan-2021 12:02                3082
function.fann-get-cascade-min-out-epochs.php       24-Jan-2021 12:02                3059
function.fann-get-cascade-num-candidate-groups.php 24-Jan-2021 12:02                3438
function.fann-get-cascade-num-candidates.php       24-Jan-2021 12:02                5517
function.fann-get-cascade-output-change-fractio..> 24-Jan-2021 12:02                4617
function.fann-get-cascade-output-stagnation-epo..> 24-Jan-2021 12:02                3824
function.fann-get-cascade-weight-multiplier.php    24-Jan-2021 12:02                3147
function.fann-get-connection-array.php             24-Jan-2021 12:02                2385
function.fann-get-connection-rate.php              24-Jan-2021 12:02                2444
function.fann-get-errno.php                        24-Jan-2021 12:02                2916
function.fann-get-errstr.php                       24-Jan-2021 12:02                2937
function.fann-get-layer-array.php                  24-Jan-2021 12:02                2453
function.fann-get-learning-momentum.php            24-Jan-2021 12:02                3371
function.fann-get-learning-rate.php                24-Jan-2021 12:02                3298
function.fann-get-mse.php                          24-Jan-2021 12:02                2878
function.fann-get-network-type.php                 24-Jan-2021 12:02                2441
function.fann-get-num-input.php                    24-Jan-2021 12:02                2353
function.fann-get-num-layers.php                   24-Jan-2021 12:02                2349
function.fann-get-num-output.php                   24-Jan-2021 12:02                2369
function.fann-get-quickprop-decay.php              24-Jan-2021 12:02                2982
function.fann-get-quickprop-mu.php                 24-Jan-2021 12:02                2950
function.fann-get-rprop-decrease-factor.php        24-Jan-2021 12:02                3008
function.fann-get-rprop-delta-max.php              24-Jan-2021 12:02                3072
function.fann-get-rprop-delta-min.php              24-Jan-2021 12:02                2884
function.fann-get-rprop-delta-zero.php             24-Jan-2021 12:02                3308
function.fann-get-rprop-increase-factor.php        24-Jan-2021 12:02                3024
function.fann-get-sarprop-step-error-shift.php     24-Jan-2021 12:02                3073
function.fann-get-sarprop-step-error-threshold-..> 24-Jan-2021 12:02                3201
function.fann-get-sarprop-temperature.php          24-Jan-2021 12:02                2966
function.fann-get-sarprop-weight-decay-shift.php   24-Jan-2021 12:02                3066
function.fann-get-total-connections.php            24-Jan-2021 12:02                2487
function.fann-get-total-neurons.php                24-Jan-2021 12:02                2558
function.fann-get-train-error-function.php         24-Jan-2021 12:02                3268
function.fann-get-train-stop-function.php          24-Jan-2021 12:02                3240
function.fann-get-training-algorithm.php           24-Jan-2021 12:02                3416
function.fann-init-weights.php                     24-Jan-2021 12:02                3948
function.fann-length-train-data.php                24-Jan-2021 12:02                2497
function.fann-merge-train-data.php                 24-Jan-2021 12:02                2805
function.fann-num-input-train-data.php             24-Jan-2021 12:02                3162
function.fann-num-output-train-data.php            24-Jan-2021 12:02                3156
function.fann-print-error.php                      24-Jan-2021 12:02                2702
function.fann-randomize-weights.php                24-Jan-2021 12:02                3542
function.fann-read-train-from-file.php             24-Jan-2021 12:02                4815
function.fann-reset-errno.php                      24-Jan-2021 12:02                2896
function.fann-reset-errstr.php                     24-Jan-2021 12:02                2885
function.fann-reset-mse.php                        24-Jan-2021 12:02                3131
function.fann-run.php                              24-Jan-2021 12:02                2556
function.fann-save-train.php                       24-Jan-2021 12:02                3144
function.fann-save.php                             24-Jan-2021 12:02                3910
function.fann-scale-input-train-data.php           24-Jan-2021 12:02                3679
function.fann-scale-input.php                      24-Jan-2021 12:02                3416
function.fann-scale-output-train-data.php          24-Jan-2021 12:02                3703
function.fann-scale-output.php                     24-Jan-2021 12:02                3413
function.fann-scale-train-data.php                 24-Jan-2021 12:02                3683
function.fann-scale-train.php                      24-Jan-2021 12:02                3410
function.fann-set-activation-function-hidden.php   24-Jan-2021 12:02                4050
function.fann-set-activation-function-layer.php    24-Jan-2021 12:02                4478
function.fann-set-activation-function-output.php   24-Jan-2021 12:02                4067
function.fann-set-activation-function.php          24-Jan-2021 12:02                5574
function.fann-set-activation-steepness-hidden.php  24-Jan-2021 12:02                4291
function.fann-set-activation-steepness-layer.php   24-Jan-2021 12:02                4669
function.fann-set-activation-steepness-output.php  24-Jan-2021 12:02                4269
function.fann-set-activation-steepness.php         24-Jan-2021 12:02                5305
function.fann-set-bit-fail-limit.php               24-Jan-2021 12:02                3082
function.fann-set-callback.php                     24-Jan-2021 12:02                5053
function.fann-set-cascade-activation-functions.php 24-Jan-2021 12:02                3689
function.fann-set-cascade-activation-steepnesse..> 24-Jan-2021 12:02                3883
function.fann-set-cascade-candidate-change-frac..> 24-Jan-2021 12:02                3402
function.fann-set-cascade-candidate-limit.php      24-Jan-2021 12:02                3244
function.fann-set-cascade-candidate-stagnation-..> 24-Jan-2021 12:02                3432
function.fann-set-cascade-max-cand-epochs.php      24-Jan-2021 12:02                3265
function.fann-set-cascade-max-out-epochs.php       24-Jan-2021 12:02                3214
function.fann-set-cascade-min-cand-epochs.php      24-Jan-2021 12:02                3227
function.fann-set-cascade-min-out-epochs.php       24-Jan-2021 12:02                3218
function.fann-set-cascade-num-candidate-groups.php 24-Jan-2021 12:02                3295
function.fann-set-cascade-output-change-fractio..> 24-Jan-2021 12:02                3374
function.fann-set-cascade-output-stagnation-epo..> 24-Jan-2021 12:02                3414
function.fann-set-cascade-weight-multiplier.php    24-Jan-2021 12:02                3218
function.fann-set-error-log.php                    24-Jan-2021 12:02                2658
function.fann-set-input-scaling-params.php         24-Jan-2021 12:02                3881
function.fann-set-learning-momentum.php            24-Jan-2021 12:02                3478
function.fann-set-learning-rate.php                24-Jan-2021 12:02                3424
function.fann-set-output-scaling-params.php        24-Jan-2021 12:02                3892
function.fann-set-quickprop-decay.php              24-Jan-2021 12:02                3154
function.fann-set-quickprop-mu.php                 24-Jan-2021 12:02                3060
function.fann-set-rprop-decrease-factor.php        24-Jan-2021 12:02                3218
function.fann-set-rprop-delta-max.php              24-Jan-2021 12:02                3307
function.fann-set-rprop-delta-min.php              24-Jan-2021 12:02                3109
function.fann-set-rprop-delta-zero.php             24-Jan-2021 12:02                3494
function.fann-set-rprop-increase-factor.php        24-Jan-2021 12:02                3238
function.fann-set-sarprop-step-error-shift.php     24-Jan-2021 12:02                3321
function.fann-set-sarprop-step-error-threshold-..> 24-Jan-2021 12:02                3472
function.fann-set-sarprop-temperature.php          24-Jan-2021 12:02                3218
function.fann-set-sarprop-weight-decay-shift.php   24-Jan-2021 12:02                3320
function.fann-set-scaling-params.php               24-Jan-2021 12:02                4728
function.fann-set-train-error-function.php         24-Jan-2021 12:02                3424
function.fann-set-train-stop-function.php          24-Jan-2021 12:02                3415
function.fann-set-training-algorithm.php           24-Jan-2021 12:02                3362
function.fann-set-weight-array.php                 24-Jan-2021 12:02                2861
function.fann-set-weight.php                       24-Jan-2021 12:02                3122
function.fann-shuffle-train-data.php               24-Jan-2021 12:02                2522
function.fann-subset-train-data.php                24-Jan-2021 12:02                3810
function.fann-test-data.php                        24-Jan-2021 12:02                3857
function.fann-test.php                             24-Jan-2021 12:02                4193
function.fann-train-epoch.php                      24-Jan-2021 12:02                4171
function.fann-train-on-data.php                    24-Jan-2021 12:02                5806
function.fann-train-on-file.php                    24-Jan-2021 12:02                5775
function.fann-train.php                            24-Jan-2021 12:02                4240
function.fastcgi-finish-request.php                24-Jan-2021 12:02                2066
function.fbird-add-user.php                        24-Jan-2021 12:02                2197
function.fbird-affected-rows.php                   24-Jan-2021 12:02                2210
function.fbird-backup.php                          24-Jan-2021 12:02                1624
function.fbird-blob-add.php                        24-Jan-2021 12:02                2556
function.fbird-blob-cancel.php                     24-Jan-2021 12:02                3360
function.fbird-blob-close.php                      24-Jan-2021 12:02                2585
function.fbird-blob-create.php                     24-Jan-2021 12:02                2584
function.fbird-blob-echo.php                       24-Jan-2021 12:02                2374
function.fbird-blob-get.php                        24-Jan-2021 12:02                2368
function.fbird-blob-import.php                     24-Jan-2021 12:02                2580
function.fbird-blob-info.php                       24-Jan-2021 12:02                1653
function.fbird-blob-open.php                       24-Jan-2021 12:02                2364
function.fbird-close.php                           24-Jan-2021 12:02                2141
function.fbird-commit-ret.php                      24-Jan-2021 12:02                1645
function.fbird-commit.php                          24-Jan-2021 12:02                1617
function.fbird-connect.php                         24-Jan-2021 12:02                2145
function.fbird-db-info.php                         24-Jan-2021 12:02                1629
function.fbird-delete-user.php                     24-Jan-2021 12:02                2209
function.fbird-drop-db.php                         24-Jan-2021 12:02                2161
function.fbird-errcode.php                         24-Jan-2021 12:02                1971
function.fbird-errmsg.php                          24-Jan-2021 12:02                1965
function.fbird-execute.php                         24-Jan-2021 12:02                1976
function.fbird-fetch-assoc.php                     24-Jan-2021 12:02                2225
function.fbird-fetch-object.php                    24-Jan-2021 12:02                2235
function.fbird-fetch-row.php                       24-Jan-2021 12:02                2215
function.fbird-field-info.php                      24-Jan-2021 12:02                2043
function.fbird-free-event-handler.php              24-Jan-2021 12:02                2139
function.fbird-free-query.php                      24-Jan-2021 12:02                1681
function.fbird-free-result.php                     24-Jan-2021 12:02                1665
function.fbird-gen-id.php                          24-Jan-2021 12:02                1627
function.fbird-maintain-db.php                     24-Jan-2021 12:02                1667
function.fbird-modify-user.php                     24-Jan-2021 12:02                2225
function.fbird-name-result.php                     24-Jan-2021 12:02                2208
function.fbird-num-fields.php                      24-Jan-2021 12:02                2032
function.fbird-num-params.php                      24-Jan-2021 12:02                2204
function.fbird-param-info.php                      24-Jan-2021 12:02                2209
function.fbird-pconnect.php                        24-Jan-2021 12:02                2161
function.fbird-prepare.php                         24-Jan-2021 12:02                1619
function.fbird-query.php                           24-Jan-2021 12:02                2506
function.fbird-restore.php                         24-Jan-2021 12:02                1626
function.fbird-rollback-ret.php                    24-Jan-2021 12:02                1673
function.fbird-rollback.php                        24-Jan-2021 12:02                1649
function.fbird-server-info.php                     24-Jan-2021 12:02                1677
function.fbird-service-attach.php                  24-Jan-2021 12:02                1713
function.fbird-service-detach.php                  24-Jan-2021 12:02                1725
function.fbird-set-event-handler.php               24-Jan-2021 12:02                2312
function.fbird-trans.php                           24-Jan-2021 12:02                1627
function.fbird-wait-event.php                      24-Jan-2021 12:02                2244
function.fbsql-affected-rows.php                   24-Jan-2021 12:02                4396
function.fbsql-autocommit.php                      24-Jan-2021 12:02                4319
function.fbsql-blob-size.php                       24-Jan-2021 12:02                3609
function.fbsql-change-user.php                     24-Jan-2021 12:02                4007
function.fbsql-clob-size.php                       24-Jan-2021 12:02                3599
function.fbsql-close.php                           24-Jan-2021 12:02                5086
function.fbsql-commit.php                          24-Jan-2021 12:02                3600
function.fbsql-connect.php                         24-Jan-2021 12:02                5667
function.fbsql-create-blob.php                     24-Jan-2021 12:02                7362
function.fbsql-create-clob.php                     24-Jan-2021 12:02                7369
function.fbsql-create-db.php                       24-Jan-2021 12:02                5640
function.fbsql-data-seek.php                       24-Jan-2021 12:02                7686
function.fbsql-database-password.php               24-Jan-2021 12:02                6431
function.fbsql-database.php                        24-Jan-2021 12:02                3257
function.fbsql-db-query.php                        24-Jan-2021 12:02                4168
function.fbsql-db-status.php                       24-Jan-2021 12:02                5355
function.fbsql-drop-db.php                         24-Jan-2021 12:02                3659
function.fbsql-errno.php                           24-Jan-2021 12:02                6430
function.fbsql-error.php                           24-Jan-2021 12:02                6436
function.fbsql-fetch-array.php                     24-Jan-2021 12:02                8498
function.fbsql-fetch-assoc.php                     24-Jan-2021 12:02                6830
function.fbsql-fetch-field.php                     24-Jan-2021 12:02                8655
function.fbsql-fetch-lengths.php                   24-Jan-2021 12:02                3514
function.fbsql-fetch-object.php                    24-Jan-2021 12:02                6232
function.fbsql-fetch-row.php                       24-Jan-2021 12:02                4342
function.fbsql-field-flags.php                     24-Jan-2021 12:02                3019
function.fbsql-field-len.php                       24-Jan-2021 12:02                2758
function.fbsql-field-name.php                      24-Jan-2021 12:02                5250
function.fbsql-field-seek.php                      24-Jan-2021 12:02                3596
function.fbsql-field-table.php                     24-Jan-2021 12:02                2859
function.fbsql-field-type.php                      24-Jan-2021 12:02                9750
function.fbsql-free-result.php                     24-Jan-2021 12:02                2929
function.fbsql-get-autostart-info.php              24-Jan-2021 12:02                2710
function.fbsql-hostname.php                        24-Jan-2021 12:02                3760
function.fbsql-insert-id.php                       24-Jan-2021 12:02                3886
function.fbsql-list-dbs.php                        24-Jan-2021 12:02                5945
function.fbsql-list-fields.php                     24-Jan-2021 12:02                7599
function.fbsql-list-tables.php                     24-Jan-2021 12:02                3949
function.fbsql-next-result.php                     24-Jan-2021 12:02                5602
function.fbsql-num-fields.php                      24-Jan-2021 12:02                3449
function.fbsql-num-rows.php                        24-Jan-2021 12:02                5796
function.fbsql-password.php                        24-Jan-2021 12:02                3736
function.fbsql-pconnect.php                        24-Jan-2021 12:02                4509
function.fbsql-query.php                           24-Jan-2021 12:02                8482
function.fbsql-read-blob.php                       24-Jan-2021 12:02                8340
function.fbsql-read-clob.php                       24-Jan-2021 12:02                8342
function.fbsql-result.php                          24-Jan-2021 12:02                5300
function.fbsql-rollback.php                        24-Jan-2021 12:02                3592
function.fbsql-rows-fetched.php                    24-Jan-2021 12:02                2504
function.fbsql-select-db.php                       24-Jan-2021 12:02                5100
function.fbsql-set-characterset.php                24-Jan-2021 12:02                2349
function.fbsql-set-lob-mode.php                    24-Jan-2021 12:02                5326
function.fbsql-set-password.php                    24-Jan-2021 12:02                3725
function.fbsql-set-transaction.php                 24-Jan-2021 12:02                4054
function.fbsql-start-db.php                        24-Jan-2021 12:02                4041
function.fbsql-stop-db.php                         24-Jan-2021 12:02                3737
function.fbsql-table-name.php                      24-Jan-2021 12:02                5436
function.fbsql-tablename.php                       24-Jan-2021 12:02                1649
function.fbsql-username.php                        24-Jan-2021 12:02                3739
function.fbsql-warnings.php                        24-Jan-2021 12:02                2945
function.fclose.php                                24-Jan-2021 12:02                4060
function.fdf-add-doc-javascript.php                24-Jan-2021 12:02                5079
function.fdf-add-template.php                      24-Jan-2021 12:02                2258
function.fdf-close.php                             24-Jan-2021 12:02                2863
function.fdf-create.php                            24-Jan-2021 12:02                5253
function.fdf-enum-values.php                       24-Jan-2021 12:02                2241
function.fdf-errno.php                             24-Jan-2021 12:02                2394
function.fdf-error.php                             24-Jan-2021 12:02                2963
function.fdf-get-ap.php                            24-Jan-2021 12:02                3636
function.fdf-get-attachment.php                    24-Jan-2021 12:02                5824
function.fdf-get-encoding.php                      24-Jan-2021 12:02                3132
function.fdf-get-file.php                          24-Jan-2021 12:02                2956
function.fdf-get-flags.php                         24-Jan-2021 12:02                2005
function.fdf-get-opt.php                           24-Jan-2021 12:02                2145
function.fdf-get-status.php                        24-Jan-2021 12:02                2973
function.fdf-get-value.php                         24-Jan-2021 12:02                4267
function.fdf-get-version.php                       24-Jan-2021 12:02                3332
function.fdf-header.php                            24-Jan-2021 12:02                1979
function.fdf-next-field-name.php                   24-Jan-2021 12:02                5207
function.fdf-open-string.php                       24-Jan-2021 12:02                4607
function.fdf-open.php                              24-Jan-2021 12:02                5720
function.fdf-remove-item.php                       24-Jan-2021 12:02                2015
function.fdf-save-string.php                       24-Jan-2021 12:02                5361
function.fdf-save.php                              24-Jan-2021 12:02                3723
function.fdf-set-ap.php                            24-Jan-2021 12:02                3786
function.fdf-set-encoding.php                      24-Jan-2021 12:02                3359
function.fdf-set-file.php                          24-Jan-2021 12:02                6593
function.fdf-set-flags.php                         24-Jan-2021 12:02                3781
function.fdf-set-javascript-action.php             24-Jan-2021 12:02                3964
function.fdf-set-on-import-javascript.php          24-Jan-2021 12:02                2802
function.fdf-set-opt.php                           24-Jan-2021 12:02                3985
function.fdf-set-status.php                        24-Jan-2021 12:02                3406
function.fdf-set-submit-form-action.php            24-Jan-2021 12:02                4185
function.fdf-set-target-frame.php                  24-Jan-2021 12:02                3400
function.fdf-set-value.php                         24-Jan-2021 12:02                5300
function.fdf-set-version.php                       24-Jan-2021 12:02                3629
function.fdiv.php                                  24-Jan-2021 12:02                5864
function.feof.php                                  24-Jan-2021 12:02                7456
function.fflush.php                                24-Jan-2021 12:02                5804
function.fgetc.php                                 24-Jan-2021 12:02                6075
function.fgetcsv.php                               24-Jan-2021 12:02               11117
function.fgets.php                                 24-Jan-2021 12:02                8044
function.fgetss.php                                24-Jan-2021 12:02                8465
function.file-exists.php                           24-Jan-2021 12:02                6565
function.file-get-contents.php                     24-Jan-2021 12:02               15470
function.file-put-contents.php                     24-Jan-2021 12:02               12102
function.file.php                                  24-Jan-2021 12:02               12397
function.fileatime.php                             24-Jan-2021 12:02                6355
function.filectime.php                             24-Jan-2021 12:02                6465
function.filegroup.php                             24-Jan-2021 12:02                5210
function.fileinode.php                             24-Jan-2021 12:02                4871
function.filemtime.php                             24-Jan-2021 12:02                6209
function.fileowner.php                             24-Jan-2021 12:02                5059
function.fileperms.php                             24-Jan-2021 12:02               18173
function.filepro-fieldcount.php                    24-Jan-2021 12:02                2340
function.filepro-fieldname.php                     24-Jan-2021 12:02                2408
function.filepro-fieldtype.php                     24-Jan-2021 12:02                2414
function.filepro-fieldwidth.php                    24-Jan-2021 12:02                2410
function.filepro-retrieve.php                      24-Jan-2021 12:02                3006
function.filepro-rowcount.php                      24-Jan-2021 12:02                2299
function.filepro.php                               24-Jan-2021 12:02                2438
function.filesize.php                              24-Jan-2021 12:02                5209
function.filetype.php                              24-Jan-2021 12:02                6039
function.filter-has-var.php                        24-Jan-2021 12:02                2727
function.filter-id.php                             24-Jan-2021 12:02                2593
function.filter-input-array.php                    24-Jan-2021 12:02               13737
function.filter-input.php                          24-Jan-2021 12:02                7477
function.filter-list.php                           24-Jan-2021 12:02                3266
function.filter-var-array.php                      24-Jan-2021 12:02               13833
function.filter-var.php                            24-Jan-2021 12:02               13216
function.finfo-buffer.php                          24-Jan-2021 12:02                6342
function.finfo-close.php                           24-Jan-2021 12:02                2526
function.finfo-file.php                            24-Jan-2021 12:02                6949
function.finfo-open.php                            24-Jan-2021 12:02                8915
function.finfo-set-flags.php                       24-Jan-2021 12:02                3621
function.floatval.php                              24-Jan-2021 12:02                3339
function.flock.php                                 24-Jan-2021 12:02               12986
function.floor.php                                 24-Jan-2021 12:02                4358
function.flush.php                                 24-Jan-2021 12:01                3047
function.fmod.php                                  24-Jan-2021 12:02                4124
function.fnmatch.php                               24-Jan-2021 12:02                7686
function.fopen.php                                 24-Jan-2021 12:02               21158
function.forward-static-call-array.php             24-Jan-2021 12:02                9842
function.forward-static-call.php                   24-Jan-2021 12:02                9608
function.fpassthru.php                             24-Jan-2021 12:02                7058
function.fprintf.php                               24-Jan-2021 12:02               18540
function.fputcsv.php                               24-Jan-2021 12:02                7485
function.fputs.php                                 24-Jan-2021 12:02                1521
function.fread.php                                 24-Jan-2021 12:02               13782
function.frenchtojd.php                            24-Jan-2021 12:02                3503
function.fscanf.php                                24-Jan-2021 12:02                8239
function.fseek.php                                 24-Jan-2021 12:02                7212
function.fsockopen.php                             24-Jan-2021 12:02               16269
function.fstat.php                                 24-Jan-2021 12:02                5454
function.ftell.php                                 24-Jan-2021 12:02                5470
function.ftok.php                                  24-Jan-2021 12:02                3367
function.ftp-alloc.php                             24-Jan-2021 12:02                7232
function.ftp-append.php                            24-Jan-2021 12:02                3116
function.ftp-cdup.php                              24-Jan-2021 12:02                5939
function.ftp-chdir.php                             24-Jan-2021 12:02                6729
function.ftp-chmod.php                             24-Jan-2021 12:02                6034
function.ftp-close.php                             24-Jan-2021 12:02                5027
function.ftp-connect.php                           24-Jan-2021 12:02                5346
function.ftp-delete.php                            24-Jan-2021 12:02                5402
function.ftp-exec.php                              24-Jan-2021 12:02                5857
function.ftp-fget.php                              24-Jan-2021 12:02                9200
function.ftp-fput.php                              24-Jan-2021 12:02                8530
function.ftp-get-option.php                        24-Jan-2021 12:02                4942
function.ftp-get.php                               24-Jan-2021 12:02                8445
function.ftp-login.php                             24-Jan-2021 12:02                5958
function.ftp-mdtm.php                              24-Jan-2021 12:02                6391
function.ftp-mkdir.php                             24-Jan-2021 12:02                5609
function.ftp-mlsd.php                              24-Jan-2021 12:02                8082
function.ftp-nb-continue.php                       24-Jan-2021 12:02                4629
function.ftp-nb-fget.php                           24-Jan-2021 12:02                9605
function.ftp-nb-fput.php                           24-Jan-2021 12:02                9374
function.ftp-nb-get.php                            24-Jan-2021 12:02               13529
function.ftp-nb-put.php                            24-Jan-2021 12:02               11024
function.ftp-nlist.php                             24-Jan-2021 12:02                6147
function.ftp-pasv.php                              24-Jan-2021 12:02                6379
function.ftp-put.php                               24-Jan-2021 12:02                8214
function.ftp-pwd.php                               24-Jan-2021 12:02                5137
function.ftp-quit.php                              24-Jan-2021 12:02                1560
function.ftp-raw.php                               24-Jan-2021 12:02                4348
function.ftp-rawlist.php                           24-Jan-2021 12:02                7078
function.ftp-rename.php                            24-Jan-2021 12:02                6286
function.ftp-rmdir.php                             24-Jan-2021 12:02                5587
function.ftp-set-option.php                        24-Jan-2021 12:02                5856
function.ftp-site.php                              24-Jan-2021 12:02                5834
function.ftp-size.php                              24-Jan-2021 12:02                5965
function.ftp-ssl-connect.php                       24-Jan-2021 12:02                8334
function.ftp-systype.php                           24-Jan-2021 12:02                4614
function.ftruncate.php                             24-Jan-2021 12:02                6849
function.func-get-arg.php                          24-Jan-2021 12:02               14045
function.func-get-args.php                         24-Jan-2021 12:02               14873
function.func-num-args.php                         24-Jan-2021 12:02                8293
function.function-exists.php                       24-Jan-2021 12:02                5712
function.fwrite.php                                24-Jan-2021 12:02               14213
function.gc-collect-cycles.php                     24-Jan-2021 12:01                2324
function.gc-disable.php                            24-Jan-2021 12:01                2369
function.gc-enable.php                             24-Jan-2021 12:01                2348
function.gc-enabled.php                            24-Jan-2021 12:01                3078
function.gc-mem-caches.php                         24-Jan-2021 12:01                2277
function.gc-status.php                             24-Jan-2021 12:01                5790
function.gd-info.php                               24-Jan-2021 12:02                6255
function.geoip-asnum-by-name.php                   24-Jan-2021 12:02                3900
function.geoip-continent-code-by-name.php          24-Jan-2021 12:02                5443
function.geoip-country-code-by-name.php            24-Jan-2021 12:02                5138
function.geoip-country-code3-by-name.php           24-Jan-2021 12:02                4761
function.geoip-country-name-by-name.php            24-Jan-2021 12:02                4706
function.geoip-database-info.php                   24-Jan-2021 12:02                3894
function.geoip-db-avail.php                        24-Jan-2021 12:02                4095
function.geoip-db-filename.php                     24-Jan-2021 12:02                3807
function.geoip-db-get-all-info.php                 24-Jan-2021 12:02                6318
function.geoip-domain-by-name.php                  24-Jan-2021 12:02                4132
function.geoip-id-by-name.php                      24-Jan-2021 12:02                5660
function.geoip-isp-by-name.php                     24-Jan-2021 12:02                4131
function.geoip-netspeedcell-by-name.php            24-Jan-2021 12:02                4782
function.geoip-org-by-name.php                     24-Jan-2021 12:02                4131
function.geoip-record-by-name.php                  24-Jan-2021 12:02                7228
function.geoip-region-by-name.php                  24-Jan-2021 12:02                4699
function.geoip-region-name-by-code.php             24-Jan-2021 12:02                6918
function.geoip-setup-custom-directory.php          24-Jan-2021 12:02                3983
function.geoip-time-zone-by-country-and-region.php 24-Jan-2021 12:02                7052
function.get-browser.php                           24-Jan-2021 12:02                6947
function.get-called-class.php                      24-Jan-2021 12:02                4527
function.get-cfg-var.php                           24-Jan-2021 12:01                3891
function.get-class-methods.php                     24-Jan-2021 12:02                6563
function.get-class-vars.php                        24-Jan-2021 12:02               10192
function.get-class.php                             24-Jan-2021 12:02               10795
function.get-current-user.php                      24-Jan-2021 12:01                3925
function.get-declared-classes.php                  24-Jan-2021 12:02                4081
function.get-declared-interfaces.php               24-Jan-2021 12:02                3875
function.get-declared-traits.php                   24-Jan-2021 12:02                2698
function.get-defined-constants.php                 24-Jan-2021 12:01                8061
function.get-defined-functions.php                 24-Jan-2021 12:02                6395
function.get-defined-vars.php                      24-Jan-2021 12:02                4838
function.get-extension-funcs.php                   24-Jan-2021 12:01                5162
function.get-headers.php                           24-Jan-2021 12:02                7806
function.get-html-translation-table.php            24-Jan-2021 12:02               12365
function.get-include-path.php                      24-Jan-2021 12:01                3805
function.get-included-files.php                    24-Jan-2021 12:01                5949
function.get-loaded-extensions.php                 24-Jan-2021 12:01                4612
function.get-magic-quotes-gpc.php                  24-Jan-2021 12:01                3639
function.get-magic-quotes-runtime.php              24-Jan-2021 12:01                4319
function.get-meta-tags.php                         24-Jan-2021 12:02                7972
function.get-object-vars.php                       24-Jan-2021 12:02               13043
function.get-parent-class.php                      24-Jan-2021 12:02               11574
function.get-required-files.php                    24-Jan-2021 12:01                1689
function.get-resource-id.php                       24-Jan-2021 12:02                4377
function.get-resource-type.php                     24-Jan-2021 12:02                4041
function.get-resources.php                         24-Jan-2021 12:01                6297
function.getallheaders.php                         24-Jan-2021 12:02                4677
function.getcwd.php                                24-Jan-2021 12:02                4109
function.getdate.php                               24-Jan-2021 12:02                8201
function.getenv.php                                24-Jan-2021 12:01                7248
function.gethostbyaddr.php                         24-Jan-2021 12:02                3958
function.gethostbyname.php                         24-Jan-2021 12:02                4243
function.gethostbynamel.php                        24-Jan-2021 12:02                4595
function.gethostname.php                           24-Jan-2021 12:02                3802
function.getimagesize.php                          24-Jan-2021 12:02               26505
function.getimagesizefromstring.php                24-Jan-2021 12:02                5300
function.getlastmod.php                            24-Jan-2021 12:01                4708
function.getmxrr.php                               24-Jan-2021 12:02                5698
function.getmygid.php                              24-Jan-2021 12:01                2944
function.getmyinode.php                            24-Jan-2021 12:01                2951
function.getmypid.php                              24-Jan-2021 12:01                3247
function.getmyuid.php                              24-Jan-2021 12:01                2886
function.getopt.php                                24-Jan-2021 12:01               14946
function.getprotobyname.php                        24-Jan-2021 12:02                4487
function.getprotobynumber.php                      24-Jan-2021 12:02                2991
function.getrandmax.php                            24-Jan-2021 12:02                2634
function.getrusage.php                             24-Jan-2021 12:01               11511
function.getservbyname.php                         24-Jan-2021 12:02                6154
function.getservbyport.php                         24-Jan-2021 12:02                3430
function.gettext.php                               24-Jan-2021 12:02                5730
function.gettimeofday.php                          24-Jan-2021 12:02                4955
function.gettype.php                               24-Jan-2021 12:02                5260
function.glob.php                                  24-Jan-2021 12:02                8815
function.gmdate.php                                24-Jan-2021 12:02                4645
function.gmmktime.php                              24-Jan-2021 12:02                5104
function.gmp-abs.php                               24-Jan-2021 12:02                4173
function.gmp-add.php                               24-Jan-2021 12:02                4309
function.gmp-and.php                               24-Jan-2021 12:02                4790
function.gmp-binomial.php                          24-Jan-2021 12:02                3495
function.gmp-clrbit.php                            24-Jan-2021 12:02                5343
function.gmp-cmp.php                               24-Jan-2021 12:02                5189
function.gmp-com.php                               24-Jan-2021 12:02                3644
function.gmp-div-q.php                             24-Jan-2021 12:02                9440
function.gmp-div-qr.php                            24-Jan-2021 12:02                6210
function.gmp-div-r.php                             24-Jan-2021 12:02                5610
function.gmp-div.php                               24-Jan-2021 12:02                1546
function.gmp-divexact.php                          24-Jan-2021 12:02                5405
function.gmp-export.php                            24-Jan-2021 12:02                5119
function.gmp-fact.php                              24-Jan-2021 12:02                4596
function.gmp-gcd.php                               24-Jan-2021 12:02                4701
function.gmp-gcdext.php                            24-Jan-2021 12:02                9195
function.gmp-hamdist.php                           24-Jan-2021 12:02                6012
function.gmp-import.php                            24-Jan-2021 12:02                5581
function.gmp-init.php                              24-Jan-2021 12:02                5028
function.gmp-intval.php                            24-Jan-2021 12:02                4915
function.gmp-invert.php                            24-Jan-2021 12:02                4863
function.gmp-jacobi.php                            24-Jan-2021 12:02                5145
function.gmp-kronecker.php                         24-Jan-2021 12:02                3492
function.gmp-lcm.php                               24-Jan-2021 12:02                3278
function.gmp-legendre.php                          24-Jan-2021 12:02                5162
function.gmp-mod.php                               24-Jan-2021 12:02                4400
function.gmp-mul.php                               24-Jan-2021 12:02                4482
function.gmp-neg.php                               24-Jan-2021 12:02                4125
function.gmp-nextprime.php                         24-Jan-2021 12:02                4842
function.gmp-or.php                                24-Jan-2021 12:02                4982
function.gmp-perfect-power.php                     24-Jan-2021 12:02                2903
function.gmp-perfect-square.php                    24-Jan-2021 12:02                5218
function.gmp-popcount.php                          24-Jan-2021 12:02                4539
function.gmp-pow.php                               24-Jan-2021 12:02                5493
function.gmp-powm.php                              24-Jan-2021 12:02                5208
function.gmp-prob-prime.php                        24-Jan-2021 12:02                5371
function.gmp-random-bits.php                       24-Jan-2021 12:02                4420
function.gmp-random-range.php                      24-Jan-2021 12:02                5342
function.gmp-random-seed.php                       24-Jan-2021 12:02                6516
function.gmp-random.php                            24-Jan-2021 12:02                5141
function.gmp-root.php                              24-Jan-2021 12:02                2854
function.gmp-rootrem.php                           24-Jan-2021 12:02                2959
function.gmp-scan0.php                             24-Jan-2021 12:02                5247
function.gmp-scan1.php                             24-Jan-2021 12:02                5259
function.gmp-setbit.php                            24-Jan-2021 12:02               11661
function.gmp-sign.php                              24-Jan-2021 12:02                4910
function.gmp-sqrt.php                              24-Jan-2021 12:02                4721
function.gmp-sqrtrem.php                           24-Jan-2021 12:02                6130
function.gmp-strval.php                            24-Jan-2021 12:02                4308
function.gmp-sub.php                               24-Jan-2021 12:02                4574
function.gmp-testbit.php                           24-Jan-2021 12:02                5418
function.gmp-xor.php                               24-Jan-2021 12:02                4982
function.gmstrftime.php                            24-Jan-2021 12:02                4562
function.gnupg-adddecryptkey.php                   24-Jan-2021 12:02                4915
function.gnupg-addencryptkey.php                   24-Jan-2021 12:02                4516
function.gnupg-addsignkey.php                      24-Jan-2021 12:02                4940
function.gnupg-cleardecryptkeys.php                24-Jan-2021 12:02                4114
function.gnupg-clearencryptkeys.php                24-Jan-2021 12:02                4119
function.gnupg-clearsignkeys.php                   24-Jan-2021 12:02                4064
function.gnupg-decrypt.php                         24-Jan-2021 12:02                5714
function.gnupg-decryptverify.php                   24-Jan-2021 12:02                6825
function.gnupg-encrypt.php                         24-Jan-2021 12:02                5650
function.gnupg-encryptsign.php                     24-Jan-2021 12:02                6550
function.gnupg-export.php                          24-Jan-2021 12:02                4784
function.gnupg-geterror.php                        24-Jan-2021 12:02                3971
function.gnupg-getprotocol.php                     24-Jan-2021 12:02                4094
function.gnupg-import.php                          24-Jan-2021 12:02                5054
function.gnupg-init.php                            24-Jan-2021 12:02                3060
function.gnupg-keyinfo.php                         24-Jan-2021 12:02                4975
function.gnupg-setarmor.php                        24-Jan-2021 12:02                5366
function.gnupg-seterrormode.php                    24-Jan-2021 12:02                5309
function.gnupg-setsignmode.php                     24-Jan-2021 12:02                5212
function.gnupg-sign.php                            24-Jan-2021 12:02                5863
function.gnupg-verify.php                          24-Jan-2021 12:02                7901
function.grapheme-extract.php                      24-Jan-2021 12:02                7877
function.grapheme-stripos.php                      24-Jan-2021 12:02                7784
function.grapheme-stristr.php                      24-Jan-2021 12:02                7264
function.grapheme-strlen.php                       24-Jan-2021 12:02                5236
function.grapheme-strpos.php                       24-Jan-2021 12:02                7393
function.grapheme-strripos.php                     24-Jan-2021 12:02                7242
function.grapheme-strrpos.php                      24-Jan-2021 12:02                6842
function.grapheme-strstr.php                       24-Jan-2021 12:02                6877
function.grapheme-substr.php                       24-Jan-2021 12:02                6528
function.gregoriantojd.php                         24-Jan-2021 12:02                5265
function.gzclose.php                               24-Jan-2021 12:02                3992
function.gzcompress.php                            24-Jan-2021 12:02                5663
function.gzdecode.php                              24-Jan-2021 12:02                3126
function.gzdeflate.php                             24-Jan-2021 12:02                5296
function.gzencode.php                              24-Jan-2021 12:02                7387
function.gzeof.php                                 24-Jan-2021 12:02                3875
function.gzfile.php                                24-Jan-2021 12:02                4524
function.gzgetc.php                                24-Jan-2021 12:02                4465
function.gzgets.php                                24-Jan-2021 12:02                5795
function.gzgetss.php                               24-Jan-2021 12:02                5799
function.gzinflate.php                             24-Jan-2021 12:02                5068
function.gzopen.php                                24-Jan-2021 12:02                5341
function.gzpassthru.php                            24-Jan-2021 12:02                4592
function.gzputs.php                                24-Jan-2021 12:02                1520
function.gzread.php                                24-Jan-2021 12:02                6401
function.gzrewind.php                              24-Jan-2021 12:02                2988
function.gzseek.php                                24-Jan-2021 12:02                5879
function.gztell.php                                24-Jan-2021 12:02                3191
function.gzuncompress.php                          24-Jan-2021 12:02                5108
function.gzwrite.php                               24-Jan-2021 12:02                6601
function.halt-compiler.php                         24-Jan-2021 12:02                4696
function.hash-algos.php                            24-Jan-2021 12:02                5048
function.hash-copy.php                             24-Jan-2021 12:02                5270
function.hash-equals.php                           24-Jan-2021 12:02                6385
function.hash-file.php                             24-Jan-2021 12:02                5991
function.hash-final.php                            24-Jan-2021 12:02                5979
function.hash-hkdf.php                             24-Jan-2021 12:02                8641
function.hash-hmac-algos.php                       24-Jan-2021 12:02                4891
function.hash-hmac-file.php                        24-Jan-2021 12:02                6805
function.hash-hmac.php                             24-Jan-2021 12:02                6463
function.hash-init.php                             24-Jan-2021 12:02                7412
function.hash-pbkdf2.php                           24-Jan-2021 12:02               10481
function.hash-update-file.php                      24-Jan-2021 12:02                5127
function.hash-update-stream.php                    24-Jan-2021 12:02                6866
function.hash-update.php                           24-Jan-2021 12:02                4136
function.hash.php                                  24-Jan-2021 12:02               10239
function.header-register-callback.php              24-Jan-2021 12:02                6495
function.header-remove.php                         24-Jan-2021 12:02                5689
function.header.php                                24-Jan-2021 12:02               17009
function.headers-list.php                          24-Jan-2021 12:02                5598
function.headers-sent.php                          24-Jan-2021 12:02                7479
function.hebrev.php                                24-Jan-2021 12:02                3196
function.hebrevc.php                               24-Jan-2021 12:02                3261
function.hex2bin.php                               24-Jan-2021 12:02                5270
function.hexdec.php                                24-Jan-2021 12:02                5814
function.highlight-file.php                        24-Jan-2021 12:02                4838
function.highlight-string.php                      24-Jan-2021 12:02                5230
function.hrtime.php                                24-Jan-2021 12:02                4393
function.html-entity-decode.php                    24-Jan-2021 12:02               12842
function.htmlentities.php                          24-Jan-2021 12:02               16227
function.htmlspecialchars-decode.php               24-Jan-2021 12:02                7933
function.htmlspecialchars.php                      24-Jan-2021 12:02               19580
function.http-build-query.php                      24-Jan-2021 12:02               21091
function.http-response-code.php                    24-Jan-2021 12:02                6522
function.hypot.php                                 24-Jan-2021 12:02                2758
function.ibase-add-user.php                        24-Jan-2021 12:02                4412
function.ibase-affected-rows.php                   24-Jan-2021 12:02                3209
function.ibase-backup.php                          24-Jan-2021 12:02                9751
function.ibase-blob-add.php                        24-Jan-2021 12:02                3760
function.ibase-blob-cancel.php                     24-Jan-2021 12:02                3374
function.ibase-blob-close.php                      24-Jan-2021 12:02                3730
function.ibase-blob-create.php                     24-Jan-2021 12:02                3706
function.ibase-blob-echo.php                       24-Jan-2021 12:02                3747
function.ibase-blob-get.php                        24-Jan-2021 12:02                6393
function.ibase-blob-import.php                     24-Jan-2021 12:02                8170
function.ibase-blob-info.php                       24-Jan-2021 12:02                3099
function.ibase-blob-open.php                       24-Jan-2021 12:02                3952
function.ibase-close.php                           24-Jan-2021 12:02                3416
function.ibase-commit-ret.php                      24-Jan-2021 12:02                2906
function.ibase-commit.php                          24-Jan-2021 12:02                2711
function.ibase-connect.php                         24-Jan-2021 12:02                9768
function.ibase-db-info.php                         24-Jan-2021 12:02                2165
function.ibase-delete-user.php                     24-Jan-2021 12:02                3200
function.ibase-drop-db.php                         24-Jan-2021 12:02                3312
function.ibase-errcode.php                         24-Jan-2021 12:02                2259
function.ibase-errmsg.php                          24-Jan-2021 12:02                2252
function.ibase-execute.php                         24-Jan-2021 12:02                6836
function.ibase-fetch-assoc.php                     24-Jan-2021 12:02                4384
function.ibase-fetch-object.php                    24-Jan-2021 12:02                6424
function.ibase-fetch-row.php                       24-Jan-2021 12:02                4151
function.ibase-field-info.php                      24-Jan-2021 12:02                6956
function.ibase-free-event-handler.php              24-Jan-2021 12:02                3175
function.ibase-free-query.php                      24-Jan-2021 12:02                2473
function.ibase-free-result.php                     24-Jan-2021 12:02                2564
function.ibase-gen-id.php                          24-Jan-2021 12:02                2494
function.ibase-maintain-db.php                     24-Jan-2021 12:02                2488
function.ibase-modify-user.php                     24-Jan-2021 12:02                4414
function.ibase-name-result.php                     24-Jan-2021 12:02                5549
function.ibase-num-fields.php                      24-Jan-2021 12:02                6517
function.ibase-num-params.php                      24-Jan-2021 12:02                3202
function.ibase-param-info.php                      24-Jan-2021 12:02                3404
function.ibase-pconnect.php                        24-Jan-2021 12:02                7050
function.ibase-prepare.php                         24-Jan-2021 12:02                3965
function.ibase-query.php                           24-Jan-2021 12:02                6839
function.ibase-restore.php                         24-Jan-2021 12:02                9829
function.ibase-rollback-ret.php                    24-Jan-2021 12:02                2945
function.ibase-rollback.php                        24-Jan-2021 12:02                2754
function.ibase-server-info.php                     24-Jan-2021 12:02               10683
function.ibase-service-attach.php                  24-Jan-2021 12:02               12602
function.ibase-service-detach.php                  24-Jan-2021 12:02                6880
function.ibase-set-event-handler.php               24-Jan-2021 12:02                7543
function.ibase-trans.php                           24-Jan-2021 12:02                5358
function.ibase-wait-event.php                      24-Jan-2021 12:02                3832
function.iconv-get-encoding.php                    24-Jan-2021 12:02                5250
function.iconv-mime-decode-headers.php             24-Jan-2021 12:02                9117
function.iconv-mime-decode.php                     24-Jan-2021 12:02                7261
function.iconv-mime-encode.php                     24-Jan-2021 12:02               11513
function.iconv-set-encoding.php                    24-Jan-2021 12:02                4608
function.iconv-strlen.php                          24-Jan-2021 12:02                3776
function.iconv-strpos.php                          24-Jan-2021 12:02                6627
function.iconv-strrpos.php                         24-Jan-2021 12:02                6031
function.iconv-substr.php                          24-Jan-2021 12:02                6809
function.iconv.php                                 24-Jan-2021 12:02                7706
function.idate.php                                 24-Jan-2021 12:02                6667
function.idn-to-ascii.php                          24-Jan-2021 12:02                6557
function.idn-to-utf8.php                           24-Jan-2021 12:02                6579
function.ignore-user-abort.php                     24-Jan-2021 12:02                6776
function.image-type-to-extension.php               24-Jan-2021 12:02                4788
function.image-type-to-mime-type.php               24-Jan-2021 12:02                6188
function.image2wbmp.php                            24-Jan-2021 12:02                4644
function.imageaffine.php                           24-Jan-2021 12:02                3142
function.imageaffinematrixconcat.php               24-Jan-2021 12:02                6292
function.imageaffinematrixget.php                  24-Jan-2021 12:02                5860
function.imagealphablending.php                    24-Jan-2021 12:02                6814
function.imageantialias.php                        24-Jan-2021 12:02                9814
function.imagearc.php                              24-Jan-2021 12:02                6627
function.imagebmp.php                              24-Jan-2021 12:02                6382
function.imagechar.php                             24-Jan-2021 12:02                5896
function.imagecharup.php                           24-Jan-2021 12:02                5936
function.imagecolorallocate.php                    24-Jan-2021 12:02                6995
function.imagecolorallocatealpha.php               24-Jan-2021 12:02               25616
function.imagecolorat.php                          24-Jan-2021 12:02                4515
function.imagecolorclosest.php                     24-Jan-2021 12:02                2707
function.imagecolorclosestalpha.php                24-Jan-2021 12:02               12590
function.imagecolorclosesthwb.php                  24-Jan-2021 12:02                5819
function.imagecolordeallocate.php                  24-Jan-2021 12:02                3489
function.imagecolorexact.php                       24-Jan-2021 12:02                2500
function.imagecolorexactalpha.php                  24-Jan-2021 12:02                8359
function.imagecolormatch.php                       24-Jan-2021 12:02                7756
function.imagecolorresolve.php                     24-Jan-2021 12:02                2531
function.imagecolorresolvealpha.php                24-Jan-2021 12:02                7319
function.imagecolorset.php                         24-Jan-2021 12:02                2499
function.imagecolorsforindex.php                   24-Jan-2021 12:02                5071
function.imagecolorstotal.php                      24-Jan-2021 12:02                2121
function.imagecolortransparent.php                 24-Jan-2021 12:02                3362
function.imageconvolution.php                      24-Jan-2021 12:02               10953
function.imagecopy.php                             24-Jan-2021 12:02                2860
function.imagecopymerge.php                        24-Jan-2021 12:02                3559
function.imagecopymergegray.php                    24-Jan-2021 12:02                3851
function.imagecopyresampled.php                    24-Jan-2021 12:02               17154
function.imagecopyresized.php                      24-Jan-2021 12:02               11942
function.imagecreate.php                           24-Jan-2021 12:02                5479
function.imagecreatefrombmp.php                    24-Jan-2021 12:02                4472
function.imagecreatefromgd.php                     24-Jan-2021 12:02                4968
function.imagecreatefromgd2.php                    24-Jan-2021 12:02                5093
function.imagecreatefromgd2part.php                24-Jan-2021 12:02                7551
function.imagecreatefromgif.php                    24-Jan-2021 12:02                9265
function.imagecreatefromjpeg.php                   24-Jan-2021 12:02                8966
function.imagecreatefrompng.php                    24-Jan-2021 12:02                8937
function.imagecreatefromstring.php                 24-Jan-2021 12:02                6829
function.imagecreatefromwbmp.php                   24-Jan-2021 12:02                8674
function.imagecreatefromwebp.php                   24-Jan-2021 12:02                4537
function.imagecreatefromxbm.php                    24-Jan-2021 12:02                4612
function.imagecreatefromxpm.php                    24-Jan-2021 12:02                5731
function.imagecreatetruecolor.php                  24-Jan-2021 12:02                6846
function.imagecrop.php                             24-Jan-2021 12:02                6508
function.imagecropauto.php                         24-Jan-2021 12:02                9668
function.imagedashedline.php                       24-Jan-2021 12:02                2501
function.imagedestroy.php                          24-Jan-2021 12:02                2027
function.imageellipse.php                          24-Jan-2021 12:02                8125
function.imagefill.php                             24-Jan-2021 12:02                4686
function.imagefilledarc.php                        24-Jan-2021 12:02               17185
function.imagefilledellipse.php                    24-Jan-2021 12:02                8231
function.imagefilledpolygon.php                    24-Jan-2021 12:02                7783
function.imagefilledrectangle.php                  24-Jan-2021 12:02                2751
function.imagefilltoborder.php                     24-Jan-2021 12:02                2748
function.imagefilter.php                           24-Jan-2021 12:02               38359
function.imageflip.php                             24-Jan-2021 12:02                8544
function.imagefontheight.php                       24-Jan-2021 12:02                2016
function.imagefontwidth.php                        24-Jan-2021 12:02                2033
function.imageftbbox.php                           24-Jan-2021 12:02               13118
function.imagefttext.php                           24-Jan-2021 12:02               14209
function.imagegammacorrect.php                     24-Jan-2021 12:02                2249
function.imagegd.php                               24-Jan-2021 12:02                2643
function.imagegd2.php                              24-Jan-2021 12:02               10146
function.imagegetclip.php                          24-Jan-2021 12:02                5119
function.imagegetinterpolation.php                 24-Jan-2021 12:02                2786
function.imagegif.php                              24-Jan-2021 12:02               16106
function.imagegrabscreen.php                       24-Jan-2021 12:02                3650
function.imagegrabwindow.php                       24-Jan-2021 12:02                8577
function.imageinterlace.php                        24-Jan-2021 12:02                2407
function.imageistruecolor.php                      24-Jan-2021 12:02                6394
function.imagejpeg.php                             24-Jan-2021 12:02               13797
function.imagelayereffect.php                      24-Jan-2021 12:02               10394
function.imageline.php                             24-Jan-2021 12:02               13539
function.imageloadfont.php                         24-Jan-2021 12:02                6862
function.imageopenpolygon.php                      24-Jan-2021 12:02                9074
function.imagepalettecopy.php                      24-Jan-2021 12:02                2133
function.imagepalettetotruecolor.php               24-Jan-2021 12:02                9384
function.imagepng.php                              24-Jan-2021 12:02                3212
function.imagepolygon.php                          24-Jan-2021 12:02                6741
function.imagerectangle.php                        24-Jan-2021 12:02                2553
function.imageresolution.php                       24-Jan-2021 12:02                6550
function.imagerotate.php                           24-Jan-2021 12:02                7082
function.imagesavealpha.php                        24-Jan-2021 12:02                6018
function.imagescale.php                            24-Jan-2021 12:02                4844
function.imagesetbrush.php                         24-Jan-2021 12:02                3169
function.imagesetclip.php                          24-Jan-2021 12:02                3878
function.imagesetinterpolation.php                 24-Jan-2021 12:02                9331
function.imagesetpixel.php                         24-Jan-2021 12:02                2570
function.imagesetstyle.php                         24-Jan-2021 12:02               11921
function.imagesetthickness.php                     24-Jan-2021 12:02                7767
function.imagesettile.php                          24-Jan-2021 12:02                2964
function.imagestring.php                           24-Jan-2021 12:02                5952
function.imagestringup.php                         24-Jan-2021 12:02                2886
function.imagesx.php                               24-Jan-2021 12:02                3198
function.imagesy.php                               24-Jan-2021 12:02                3234
function.imagetruecolortopalette.php               24-Jan-2021 12:02                5736
function.imagettfbbox.php                          24-Jan-2021 12:02                4300
function.imagettftext.php                          24-Jan-2021 12:02               15798
function.imagetypes.php                            24-Jan-2021 12:02                2780
function.imagewbmp.php                             24-Jan-2021 12:02                3788
function.imagewebp.php                             24-Jan-2021 12:02                6541
function.imagexbm.php                              24-Jan-2021 12:02                9166
function.imap-8bit.php                             24-Jan-2021 12:02                2852
function.imap-alerts.php                           24-Jan-2021 12:02                2828
function.imap-append.php                           24-Jan-2021 12:02                9162
function.imap-base64.php                           24-Jan-2021 12:02                3272
function.imap-binary.php                           24-Jan-2021 12:02                2816
function.imap-body.php                             24-Jan-2021 12:02                4363
function.imap-bodystruct.php                       24-Jan-2021 12:02                3652
function.imap-check.php                            24-Jan-2021 12:02                5077
function.imap-clearflag-full.php                   24-Jan-2021 12:02                4498
function.imap-close.php                            24-Jan-2021 12:02                3253
function.imap-create.php                           24-Jan-2021 12:02                1619
function.imap-createmailbox.php                    24-Jan-2021 12:02               14706
function.imap-delete.php                           24-Jan-2021 12:02                8578
function.imap-deletemailbox.php                    24-Jan-2021 12:02                3901
function.imap-errors.php                           24-Jan-2021 12:02                3024
function.imap-expunge.php                          24-Jan-2021 12:02                2625
function.imap-fetch-overview.php                   24-Jan-2021 12:02               10366
function.imap-fetchbody.php                        24-Jan-2021 12:02                4812
function.imap-fetchheader.php                      24-Jan-2021 12:02                4601
function.imap-fetchmime.php                        24-Jan-2021 12:02                5016
function.imap-fetchstructure.php                   24-Jan-2021 12:02                8326
function.imap-fetchtext.php                        24-Jan-2021 12:02                1597
function.imap-gc.php                               24-Jan-2021 12:02                4042
function.imap-get-quota.php                        24-Jan-2021 12:02               11803
function.imap-get-quotaroot.php                    24-Jan-2021 12:02                8540
function.imap-getacl.php                           24-Jan-2021 12:02                4837
function.imap-getmailboxes.php                     24-Jan-2021 12:02               11088
function.imap-getsubscribed.php                    24-Jan-2021 12:02                6325
function.imap-header.php                           24-Jan-2021 12:02                1828
function.imap-headerinfo.php                       24-Jan-2021 12:02               10874
function.imap-headers.php                          24-Jan-2021 12:02                2493
function.imap-last-error.php                       24-Jan-2021 12:02                2728
function.imap-list.php                             24-Jan-2021 12:02                7848
function.imap-listmailbox.php                      24-Jan-2021 12:02                1600
function.imap-listscan.php                         24-Jan-2021 12:02                5657
function.imap-listsubscribed.php                   24-Jan-2021 12:02                1618
function.imap-lsub.php                             24-Jan-2021 12:02                4877
function.imap-mail-compose.php                     24-Jan-2021 12:02               14572
function.imap-mail-copy.php                        24-Jan-2021 12:02                4718
function.imap-mail-move.php                        24-Jan-2021 12:02                5068
function.imap-mail.php                             24-Jan-2021 12:02                6157
function.imap-mailboxmsginfo.php                   24-Jan-2021 12:02                9236
function.imap-mime-header-decode.php               24-Jan-2021 12:02                6241
function.imap-msgno.php                            24-Jan-2021 12:02                3217
function.imap-mutf7-to-utf8.php                    24-Jan-2021 12:02                3033
function.imap-num-msg.php                          24-Jan-2021 12:02                3057
function.imap-num-recent.php                       24-Jan-2021 12:02                2936
function.imap-open.php                             24-Jan-2021 12:02               20981
function.imap-ping.php                             24-Jan-2021 12:02                3984
function.imap-qprint.php                           24-Jan-2021 12:02                2862
function.imap-rename.php                           24-Jan-2021 12:02                1622
function.imap-renamemailbox.php                    24-Jan-2021 12:02                4491
function.imap-reopen.php                           24-Jan-2021 12:02                7343
function.imap-rfc822-parse-adrlist.php             24-Jan-2021 12:02                8011
function.imap-rfc822-parse-headers.php             24-Jan-2021 12:02                3461
function.imap-rfc822-write-address.php             24-Jan-2021 12:02                4965
function.imap-savebody.php                         24-Jan-2021 12:02                4962
function.imap-scan.php                             24-Jan-2021 12:02                1589
function.imap-scanmailbox.php                      24-Jan-2021 12:02                1612
function.imap-search.php                           24-Jan-2021 12:02               12314
function.imap-set-quota.php                        24-Jan-2021 12:02                5749
function.imap-setacl.php                           24-Jan-2021 12:02                4225
function.imap-setflag-full.php                     24-Jan-2021 12:02                6801
function.imap-sort.php                             24-Jan-2021 12:02                6699
function.imap-status.php                           24-Jan-2021 12:02                9913
function.imap-subscribe.php                        24-Jan-2021 12:02                3387
function.imap-thread.php                           24-Jan-2021 12:02                7109
function.imap-timeout.php                          24-Jan-2021 12:02                4141
function.imap-uid.php                              24-Jan-2021 12:02                3608
function.imap-undelete.php                         24-Jan-2021 12:02                3700
function.imap-unsubscribe.php                      24-Jan-2021 12:02                3460
function.imap-utf7-decode.php                      24-Jan-2021 12:02                3434
function.imap-utf7-encode.php                      24-Jan-2021 12:02                3029
function.imap-utf8-to-mutf7.php                    24-Jan-2021 12:02                3036
function.imap-utf8.php                             24-Jan-2021 12:02                3962
function.implode.php                               24-Jan-2021 12:02                6604
function.in-array.php                              24-Jan-2021 12:02               11065
function.include-once.php                          24-Jan-2021 12:01                1976
function.include.php                               24-Jan-2021 12:01               21052
function.inet-ntop.php                             24-Jan-2021 12:02                6116
function.inet-pton.php                             24-Jan-2021 12:02                4573
function.inflate-add.php                           24-Jan-2021 12:02                5247
function.inflate-get-read-len.php                  24-Jan-2021 12:02                3079
function.inflate-get-status.php                    24-Jan-2021 12:02                3020
function.inflate-init.php                          24-Jan-2021 12:02                5827
function.ingres-autocommit-state.php               24-Jan-2021 12:02                3106
function.ingres-autocommit.php                     24-Jan-2021 12:02                4725
function.ingres-charset.php                        24-Jan-2021 12:02                4833
function.ingres-close.php                          24-Jan-2021 12:02                3294
function.ingres-commit.php                         24-Jan-2021 12:02                3975
function.ingres-connect.php                        24-Jan-2021 12:02               14871
function.ingres-cursor.php                         24-Jan-2021 12:02                4592
function.ingres-errno.php                          24-Jan-2021 12:02                5895
function.ingres-error.php                          24-Jan-2021 12:02                5788
function.ingres-errsqlstate.php                    24-Jan-2021 12:02                5975
function.ingres-escape-string.php                  24-Jan-2021 12:02                6122
function.ingres-execute.php                        24-Jan-2021 12:02                6303
function.ingres-fetch-array.php                    24-Jan-2021 12:02               10418
function.ingres-fetch-assoc.php                    24-Jan-2021 12:02                7428
function.ingres-fetch-object.php                   24-Jan-2021 12:02                7519
function.ingres-fetch-proc-return.php              24-Jan-2021 12:02                7093
function.ingres-fetch-row.php                      24-Jan-2021 12:02                6997
function.ingres-field-length.php                   24-Jan-2021 12:02                5593
function.ingres-field-name.php                     24-Jan-2021 12:02                5527
function.ingres-field-nullable.php                 24-Jan-2021 12:02                5510
function.ingres-field-precision.php                24-Jan-2021 12:02                5625
function.ingres-field-scale.php                    24-Jan-2021 12:02                5587
function.ingres-field-type.php                     24-Jan-2021 12:02                6265
function.ingres-free-result.php                    24-Jan-2021 12:02                5030
function.ingres-next-error.php                     24-Jan-2021 12:02                3972
function.ingres-num-fields.php                     24-Jan-2021 12:02                3738
function.ingres-num-rows.php                       24-Jan-2021 12:02                4880
function.ingres-pconnect.php                       24-Jan-2021 12:02                5157
function.ingres-prepare.php                        24-Jan-2021 12:02                7679
function.ingres-query.php                          24-Jan-2021 12:02               20493
function.ingres-result-seek.php                    24-Jan-2021 12:02                8114
function.ingres-rollback.php                       24-Jan-2021 12:02                3485
function.ingres-set-environment.php                24-Jan-2021 12:02               12368
function.ingres-unbuffered-query.php               24-Jan-2021 12:02               16565
function.ini-alter.php                             24-Jan-2021 12:01                1557
function.ini-get-all.php                           24-Jan-2021 12:01                9508
function.ini-get.php                               24-Jan-2021 12:01               11124
function.ini-restore.php                           24-Jan-2021 12:01                6305
function.ini-set.php                               24-Jan-2021 12:01                5125
function.inotify-add-watch.php                     24-Jan-2021 12:02                3796
function.inotify-init.php                          24-Jan-2021 12:02                8979
function.inotify-queue-len.php                     24-Jan-2021 12:02                3601
function.inotify-read.php                          24-Jan-2021 12:02                4227
function.inotify-rm-watch.php                      24-Jan-2021 12:02                3290
function.intdiv.php                                24-Jan-2021 12:02                6501
function.interface-exists.php                      24-Jan-2021 12:02                4847
function.intl-error-name.php                       24-Jan-2021 12:02                4910
function.intl-get-error-code.php                   24-Jan-2021 12:02                4282
function.intl-get-error-message.php                24-Jan-2021 12:02                4275
function.intl-is-failure.php                       24-Jan-2021 12:02                5361
function.intval.php                                24-Jan-2021 12:02               13639
function.ip2long.php                               24-Jan-2021 12:02               10071
function.iptcembed.php                             24-Jan-2021 12:02               13625
function.iptcparse.php                             24-Jan-2021 12:02                4342
function.is-a.php                                  24-Jan-2021 12:02                6481
function.is-array.php                              24-Jan-2021 12:02                2469
function.is-bool.php                               24-Jan-2021 12:02                4264
function.is-callable.php                           24-Jan-2021 12:02                8002
function.is-countable.php                          24-Jan-2021 12:02                6114
function.is-dir.php                                24-Jan-2021 12:02                6254
function.is-double.php                             24-Jan-2021 12:02                1584
function.is-executable.php                         24-Jan-2021 12:02                5815
function.is-file.php                               24-Jan-2021 12:02                5488
function.is-finite.php                             24-Jan-2021 12:02                2910
function.is-float.php                              24-Jan-2021 12:02                3032
function.is-infinite.php                           24-Jan-2021 12:02                3030
function.is-int.php                                24-Jan-2021 12:02                3041
function.is-integer.php                            24-Jan-2021 12:02                1624
function.is-iterable.php                           24-Jan-2021 12:02                5613
function.is-link.php                               24-Jan-2021 12:02                5366
function.is-long.php                               24-Jan-2021 12:02                1560
function.is-nan.php                                24-Jan-2021 12:02                4372
function.is-null.php                               24-Jan-2021 12:02                3288
function.is-numeric.php                            24-Jan-2021 12:02                2723
function.is-object.php                             24-Jan-2021 12:02                2629
function.is-readable.php                           24-Jan-2021 12:02                5977
function.is-real.php                               24-Jan-2021 12:02                1636
function.is-resource.php                           24-Jan-2021 12:02                2250
function.is-scalar.php                             24-Jan-2021 12:02                6324
function.is-soap-fault.php                         24-Jan-2021 12:02                8039
function.is-string.php                             24-Jan-2021 12:02                2772
function.is-subclass-of.php                        24-Jan-2021 12:02               14287
function.is-tainted.php                            24-Jan-2021 12:02                2124
function.is-uploaded-file.php                      24-Jan-2021 12:02                6464
function.is-writable.php                           24-Jan-2021 12:02                5578
function.is-writeable.php                          24-Jan-2021 12:02                1593
function.isset.php                                 24-Jan-2021 12:02               17247
function.iterator-apply.php                        24-Jan-2021 12:02                5957
function.iterator-count.php                        24-Jan-2021 12:02                3910
function.iterator-to-array.php                     24-Jan-2021 12:02                5535
function.jddayofweek.php                           24-Jan-2021 12:02                3317
function.jdmonthname.php                           24-Jan-2021 12:02                3953
function.jdtofrench.php                            24-Jan-2021 12:02                2872
function.jdtogregorian.php                         24-Jan-2021 12:02                2864
function.jdtojewish.php                            24-Jan-2021 12:02                5813
function.jdtojulian.php                            24-Jan-2021 12:02                2854
function.jdtounix.php                              24-Jan-2021 12:02                2881
function.jewishtojd.php                            24-Jan-2021 12:02                3515
function.join.php                                  24-Jan-2021 12:02                1516
function.jpeg2wbmp.php                             24-Jan-2021 12:02                5725
function.json-decode.php                           24-Jan-2021 12:02               21403
function.json-encode.php                           24-Jan-2021 12:02               29232
function.json-last-error-msg.php                   24-Jan-2021 12:02                2809
function.json-last-error.php                       24-Jan-2021 12:02               12514
function.juliantojd.php                            24-Jan-2021 12:02                4002
function.key-exists.php                            24-Jan-2021 12:02                1586
function.key.php                                   24-Jan-2021 12:02                6823
function.krsort.php                                24-Jan-2021 12:02                5560
function.ksort.php                                 24-Jan-2021 12:02                5409
function.lcfirst.php                               24-Jan-2021 12:02                5352
function.lcg-value.php                             24-Jan-2021 12:02                2464
function.lchgrp.php                                24-Jan-2021 12:02                5542
function.lchown.php                                24-Jan-2021 12:02                5440
function.ldap-8859-to-t61.php                      24-Jan-2021 12:02                3067
function.ldap-add-ext.php                          24-Jan-2021 12:02                4275
function.ldap-add.php                              24-Jan-2021 12:02                9807
function.ldap-bind-ext.php                         24-Jan-2021 12:02                4247
function.ldap-bind.php                             24-Jan-2021 12:02                8603
function.ldap-close.php                            24-Jan-2021 12:02                1571
function.ldap-compare.php                          24-Jan-2021 12:02               10114
function.ldap-connect.php                          24-Jan-2021 12:02                8234
function.ldap-control-paged-result-response.php    24-Jan-2021 12:02                5214
function.ldap-control-paged-result.php             24-Jan-2021 12:02               15352
function.ldap-count-entries.php                    24-Jan-2021 12:02                4159
function.ldap-delete-ext.php                       24-Jan-2021 12:02                3963
function.ldap-delete.php                           24-Jan-2021 12:02                4340
function.ldap-dn2ufn.php                           24-Jan-2021 12:02                2447
function.ldap-err2str.php                          24-Jan-2021 12:02                4522
function.ldap-errno.php                            24-Jan-2021 12:02                6894
function.ldap-error.php                            24-Jan-2021 12:02                3524
function.ldap-escape.php                           24-Jan-2021 12:02                6241
function.ldap-exop-passwd.php                      24-Jan-2021 12:02                9927
function.ldap-exop-refresh.php                     24-Jan-2021 12:02                3968
function.ldap-exop-whoami.php                      24-Jan-2021 12:02                2846
function.ldap-exop.php                             24-Jan-2021 12:02               11656
function.ldap-explode-dn.php                       24-Jan-2021 12:02                3301
function.ldap-first-attribute.php                  24-Jan-2021 12:02                4519
function.ldap-first-entry.php                      24-Jan-2021 12:02                3671
function.ldap-first-reference.php                  24-Jan-2021 12:02                2036
function.ldap-free-result.php                      24-Jan-2021 12:02                2757
function.ldap-get-attributes.php                   24-Jan-2021 12:02                7037
function.ldap-get-dn.php                           24-Jan-2021 12:02                2711
function.ldap-get-entries.php                      24-Jan-2021 12:02                4296
function.ldap-get-option.php                       24-Jan-2021 12:02               11768
function.ldap-get-values-len.php                   24-Jan-2021 12:02                3857
function.ldap-get-values.php                       24-Jan-2021 12:02                7410
function.ldap-list.php                             24-Jan-2021 12:02               12089
function.ldap-mod-add.php                          24-Jan-2021 12:02                5705
function.ldap-mod-del.php                          24-Jan-2021 12:02                5254
function.ldap-mod-replace.php                      24-Jan-2021 12:02                5646
function.ldap-mod_add-ext.php                      24-Jan-2021 12:02                4266
function.ldap-mod_del-ext.php                      24-Jan-2021 12:02                4282
function.ldap-mod_replace-ext.php                  24-Jan-2021 12:02                4340
function.ldap-modify-batch.php                     24-Jan-2021 12:02               20049
function.ldap-modify.php                           24-Jan-2021 12:02                1985
function.ldap-next-attribute.php                   24-Jan-2021 12:02                3981
function.ldap-next-entry.php                       24-Jan-2021 12:02                3903
function.ldap-next-reference.php                   24-Jan-2021 12:02                2020
function.ldap-parse-exop.php                       24-Jan-2021 12:02                3948
function.ldap-parse-reference.php                  24-Jan-2021 12:02                2082
function.ldap-parse-result.php                     24-Jan-2021 12:02                8007
function.ldap-read.php                             24-Jan-2021 12:02                9220
function.ldap-rename-ext.php                       24-Jan-2021 12:02                4450
function.ldap-rename.php                           24-Jan-2021 12:02                5860
function.ldap-sasl-bind.php                        24-Jan-2021 12:02                5011
function.ldap-search.php                           24-Jan-2021 12:02               13329
function.ldap-set-option.php                       24-Jan-2021 12:02               14561
function.ldap-set-rebind-proc.php                  24-Jan-2021 12:02                2542
function.ldap-sort.php                             24-Jan-2021 12:02                6573
function.ldap-start-tls.php                        24-Jan-2021 12:02                1760
function.ldap-t61-to-8859.php                      24-Jan-2021 12:02                1899
function.ldap-unbind.php                           24-Jan-2021 12:02                2724
function.levenshtein.php                           24-Jan-2021 12:02               12028
function.libxml-clear-errors.php                   24-Jan-2021 12:02                2514
function.libxml-disable-entity-loader.php          24-Jan-2021 12:02                4461
function.libxml-get-errors.php                     24-Jan-2021 12:02               11644
function.libxml-get-last-error.php                 24-Jan-2021 12:02                2801
function.libxml-set-external-entity-loader.php     24-Jan-2021 12:02                9819
function.libxml-set-streams-context.php            24-Jan-2021 12:02                5017
function.libxml-use-internal-errors.php            24-Jan-2021 12:02                6355
function.link.php                                  24-Jan-2021 12:02                5705
function.linkinfo.php                              24-Jan-2021 12:02                4577
function.list.php                                  24-Jan-2021 12:02               21509
function.localeconv.php                            24-Jan-2021 12:02                8898
function.localtime.php                             24-Jan-2021 12:02                8533
function.log-cmd-delete.php                        24-Jan-2021 12:02                6260
function.log-cmd-insert.php                        24-Jan-2021 12:02                5849
function.log-cmd-update.php                        24-Jan-2021 12:02                6529
function.log-getmore.php                           24-Jan-2021 12:02                4066
function.log-killcursor.php                        24-Jan-2021 12:02                3814
function.log-reply.php                             24-Jan-2021 12:02                5504
function.log-write-batch.php                       24-Jan-2021 12:02                5813
function.log.php                                   24-Jan-2021 12:02                4264
function.log10.php                                 24-Jan-2021 12:02                2505
function.log1p.php                                 24-Jan-2021 12:02                3716
function.long2ip.php                               24-Jan-2021 12:02                3749
function.lstat.php                                 24-Jan-2021 12:02                5861
function.ltrim.php                                 24-Jan-2021 12:02                9429
function.lzf-compress.php                          24-Jan-2021 12:02                2688
function.lzf-decompress.php                        24-Jan-2021 12:02                2778
function.lzf-optimized-for.php                     24-Jan-2021 12:02                1871
function.mail.php                                  24-Jan-2021 12:02               22368
function.mailparse-determine-best-xfer-encoding..> 24-Jan-2021 12:02                4021
function.mailparse-msg-create.php                  24-Jan-2021 12:02                2550
function.mailparse-msg-extract-part-file.php       24-Jan-2021 12:02                4916
function.mailparse-msg-extract-part.php            24-Jan-2021 12:02                3839
function.mailparse-msg-extract-whole-part-file.php 24-Jan-2021 12:02                3823
function.mailparse-msg-free.php                    24-Jan-2021 12:02                3321
function.mailparse-msg-get-part-data.php           24-Jan-2021 12:02                2299
function.mailparse-msg-get-part.php                24-Jan-2021 12:02                2529
function.mailparse-msg-get-structure.php           24-Jan-2021 12:02                2319
function.mailparse-msg-parse-file.php              24-Jan-2021 12:02                3500
function.mailparse-msg-parse.php                   24-Jan-2021 12:02                3161
function.mailparse-rfc822-parse-addresses.php      24-Jan-2021 12:02                5322
function.mailparse-stream-encode.php               24-Jan-2021 12:02                5540
function.mailparse-uudecode-all.php                24-Jan-2021 12:02                6758
function.main.php                                  24-Jan-2021 12:01                3736
function.max.php                                   24-Jan-2021 12:02               11825
function.mb-check-encoding.php                     24-Jan-2021 12:02                2996
function.mb-chr.php                                24-Jan-2021 12:02                3669
function.mb-convert-case.php                       24-Jan-2021 12:02                9784
function.mb-convert-encoding.php                   24-Jan-2021 12:02                6738
function.mb-convert-kana.php                       24-Jan-2021 12:02                8975
function.mb-convert-variables.php                  24-Jan-2021 12:02                6016
function.mb-decode-mimeheader.php                  24-Jan-2021 12:02                2909
function.mb-decode-numericentity.php               24-Jan-2021 12:02               35391
function.mb-detect-encoding.php                    24-Jan-2021 12:02                6724
function.mb-detect-order.php                       24-Jan-2021 12:02                7945
function.mb-encode-mimeheader.php                  24-Jan-2021 12:02                7863
function.mb-encode-numericentity.php               24-Jan-2021 12:02               12849
function.mb-encoding-aliases.php                   24-Jan-2021 12:02                5499
function.mb-ereg-match.php                         24-Jan-2021 12:02                4760
function.mb-ereg-replace-callback.php              24-Jan-2021 12:02               12630
function.mb-ereg-replace.php                       24-Jan-2021 12:02                6270
function.mb-ereg-search-getpos.php                 24-Jan-2021 12:02                3679
function.mb-ereg-search-getregs.php                24-Jan-2021 12:02                4021
function.mb-ereg-search-init.php                   24-Jan-2021 12:02                5499
function.mb-ereg-search-pos.php                    24-Jan-2021 12:02                5381
function.mb-ereg-search-regs.php                   24-Jan-2021 12:02                5132
function.mb-ereg-search-setpos.php                 24-Jan-2021 12:02                4209
function.mb-ereg-search.php                        24-Jan-2021 12:02                5050
function.mb-ereg.php                               24-Jan-2021 12:02                5940
function.mb-eregi-replace.php                      24-Jan-2021 12:02                6153
function.mb-eregi.php                              24-Jan-2021 12:02                5983
function.mb-get-info.php                           24-Jan-2021 12:02                4462
function.mb-http-input.php                         24-Jan-2021 12:02                3688
function.mb-http-output.php                        24-Jan-2021 12:02                3945
function.mb-internal-encoding.php                  24-Jan-2021 12:02                5105
function.mb-language.php                           24-Jan-2021 12:02                3602
function.mb-list-encodings.php                     24-Jan-2021 12:02                4474
function.mb-ord.php                                24-Jan-2021 12:02                3703
function.mb-output-handler.php                     24-Jan-2021 12:02                6223
function.mb-parse-str.php                          24-Jan-2021 12:02                3662
function.mb-preferred-mime-name.php                24-Jan-2021 12:02                3918
function.mb-regex-encoding.php                     24-Jan-2021 12:02                4202
function.mb-regex-set-options.php                  24-Jan-2021 12:02                6783
function.mb-scrub.php                              24-Jan-2021 12:02                2997
function.mb-send-mail.php                          24-Jan-2021 12:02                7838
function.mb-split.php                              24-Jan-2021 12:02                4059
function.mb-str-split.php                          24-Jan-2021 12:02                4802
function.mb-strcut.php                             24-Jan-2021 12:02                6062
function.mb-strimwidth.php                         24-Jan-2021 12:02                6255
function.mb-stripos.php                            24-Jan-2021 12:02                5325
function.mb-stristr.php                            24-Jan-2021 12:02                5240
function.mb-strlen.php                             24-Jan-2021 12:02                4064
function.mb-strpos.php                             24-Jan-2021 12:02                5141
function.mb-strrchr.php                            24-Jan-2021 12:02                5025
function.mb-strrichr.php                           24-Jan-2021 12:02                5102
function.mb-strripos.php                           24-Jan-2021 12:02                4988
function.mb-strrpos.php                            24-Jan-2021 12:02                5926
function.mb-strstr.php                             24-Jan-2021 12:02                4997
function.mb-strtolower.php                         24-Jan-2021 12:02                6857
function.mb-strtoupper.php                         24-Jan-2021 12:02                6825
function.mb-strwidth.php                           24-Jan-2021 12:02                4111
function.mb-substitute-character.php               24-Jan-2021 12:02                5839
function.mb-substr-count.php                       24-Jan-2021 12:02                5078
function.mb-substr.php                             24-Jan-2021 12:02                5779
function.mcrypt-cbc.php                            24-Jan-2021 12:02                3724
function.mcrypt-cfb.php                            24-Jan-2021 12:02                3705
function.mcrypt-create-iv.php                      24-Jan-2021 12:02                7470
function.mcrypt-decrypt.php                        24-Jan-2021 12:02                5886
function.mcrypt-ecb.php                            24-Jan-2021 12:02                3650
function.mcrypt-enc-get-algorithms-name.php        24-Jan-2021 12:02                5086
function.mcrypt-enc-get-block-size.php             24-Jan-2021 12:02                2758
function.mcrypt-enc-get-iv-size.php                24-Jan-2021 12:02                2842
function.mcrypt-enc-get-key-size.php               24-Jan-2021 12:02                2733
function.mcrypt-enc-get-modes-name.php             24-Jan-2021 12:02                4978
function.mcrypt-enc-get-supported-key-sizes.php    24-Jan-2021 12:02                4688
function.mcrypt-enc-is-block-algorithm-mode.php    24-Jan-2021 12:02                3068
function.mcrypt-enc-is-block-algorithm.php         24-Jan-2021 12:02                2855
function.mcrypt-enc-is-block-mode.php              24-Jan-2021 12:02                3000
function.mcrypt-enc-self-test.php                  24-Jan-2021 12:02                2724
function.mcrypt-encrypt.php                        24-Jan-2021 12:02               15413
function.mcrypt-generic-deinit.php                 24-Jan-2021 12:02                3641
function.mcrypt-generic-end.php                    24-Jan-2021 12:02                3272
function.mcrypt-generic-init.php                   24-Jan-2021 12:02                4761
function.mcrypt-generic.php                        24-Jan-2021 12:02                5476
function.mcrypt-get-block-size.php                 24-Jan-2021 12:02                5936
function.mcrypt-get-cipher-name.php                24-Jan-2021 12:02                4584
function.mcrypt-get-iv-size.php                    24-Jan-2021 12:02                6079
function.mcrypt-get-key-size.php                   24-Jan-2021 12:02                6056
function.mcrypt-list-algorithms.php                24-Jan-2021 12:02                4431
function.mcrypt-list-modes.php                     24-Jan-2021 12:02                4435
function.mcrypt-module-close.php                   24-Jan-2021 12:02                3050
function.mcrypt-module-get-algo-block-size.php     24-Jan-2021 12:02                3177
function.mcrypt-module-get-algo-key-size.php       24-Jan-2021 12:02                3209
function.mcrypt-module-get-supported-key-sizes.php 24-Jan-2021 12:02                4155
function.mcrypt-module-is-block-algorithm-mode.php 24-Jan-2021 12:02                3668
function.mcrypt-module-is-block-algorithm.php      24-Jan-2021 12:02                3404
function.mcrypt-module-is-block-mode.php           24-Jan-2021 12:02                3924
function.mcrypt-module-open.php                    24-Jan-2021 12:02               14163
function.mcrypt-module-self-test.php               24-Jan-2021 12:02                4504
function.mcrypt-ofb.php                            24-Jan-2021 12:02                3738
function.md5-file.php                              24-Jan-2021 12:02                5323
function.md5.php                                   24-Jan-2021 12:02                5665
function.mdecrypt-generic.php                      24-Jan-2021 12:02               11320
function.memcache-debug.php                        24-Jan-2021 12:02                3054
function.memory-get-peak-usage.php                 24-Jan-2021 12:01                3793
function.memory-get-usage.php                      24-Jan-2021 12:01                5912
function.metaphone.php                             24-Jan-2021 12:02                7843
function.method-exists.php                         24-Jan-2021 12:02                6113
function.mhash-count.php                           24-Jan-2021 12:02                3595
function.mhash-get-block-size.php                  24-Jan-2021 12:02                3401
function.mhash-get-hash-name.php                   24-Jan-2021 12:02                3357
function.mhash-keygen-s2k.php                      24-Jan-2021 12:02                4255
function.mhash.php                                 24-Jan-2021 12:02                3851
function.microtime.php                             24-Jan-2021 12:02                5398
function.mime-content-type.php                     24-Jan-2021 12:02                4454
function.min.php                                   24-Jan-2021 12:02                9406
function.mkdir.php                                 24-Jan-2021 12:02                7302
function.mktime.php                                24-Jan-2021 12:02               20610
function.money-format.php                          24-Jan-2021 12:02               16527
function.mongodb.bson-fromjson.php                 24-Jan-2021 12:02                5677
function.mongodb.bson-fromphp.php                  24-Jan-2021 12:02                5637
function.mongodb.bson-tocanonicalextendedjson.php  24-Jan-2021 12:02               16025
function.mongodb.bson-tojson.php                   24-Jan-2021 12:02               17486
function.mongodb.bson-tophp.php                    24-Jan-2021 12:02                8668
function.mongodb.bson-torelaxedextendedjson.php    24-Jan-2021 12:02               15726
function.mongodb.driver.monitoring.addsubscribe..> 24-Jan-2021 12:02                4509
function.mongodb.driver.monitoring.removesubscr..> 24-Jan-2021 12:02                4590
function.move-uploaded-file.php                    24-Jan-2021 12:02                7957
function.mqseries-back.php                         24-Jan-2021 12:02                6347
function.mqseries-begin.php                        24-Jan-2021 12:02                7714
function.mqseries-close.php                        24-Jan-2021 12:02                6298
function.mqseries-cmit.php                         24-Jan-2021 12:02                6297
function.mqseries-conn.php                         24-Jan-2021 12:02                5710
function.mqseries-connx.php                        24-Jan-2021 12:02               14118
function.mqseries-disc.php                         24-Jan-2021 12:02                5547
function.mqseries-get.php                          24-Jan-2021 12:02               12810
function.mqseries-inq.php                          24-Jan-2021 12:02                8826
function.mqseries-open.php                         24-Jan-2021 12:02                7388
function.mqseries-put.php                          24-Jan-2021 12:02               13833
function.mqseries-put1.php                         24-Jan-2021 12:02                5629
function.mqseries-set.php                          24-Jan-2021 12:02                5298
function.mqseries-strerror.php                     24-Jan-2021 12:02                4185
function.msg-get-queue.php                         24-Jan-2021 12:02                5212
function.msg-queue-exists.php                      24-Jan-2021 12:02                3119
function.msg-receive.php                           24-Jan-2021 12:02               10127
function.msg-remove-queue.php                      24-Jan-2021 12:02                4234
function.msg-send.php                              24-Jan-2021 12:02                7960
function.msg-set-queue.php                         24-Jan-2021 12:02                4845
function.msg-stat-queue.php                        24-Jan-2021 12:02                6293
function.mt-getrandmax.php                         24-Jan-2021 12:02                4895
function.mt-rand.php                               24-Jan-2021 12:02                6969
function.mt-srand.php                              24-Jan-2021 12:02                6217
function.mysql-affected-rows.php                   24-Jan-2021 12:02               11894
function.mysql-client-encoding.php                 24-Jan-2021 12:02                6126
function.mysql-close.php                           24-Jan-2021 12:02                6705
function.mysql-connect.php                         24-Jan-2021 12:02               17538
function.mysql-create-db.php                       24-Jan-2021 12:02                8025
function.mysql-data-seek.php                       24-Jan-2021 12:02               11894
function.mysql-db-name.php                         24-Jan-2021 12:02                7433
function.mysql-db-query.php                        24-Jan-2021 12:02                3925
function.mysql-drop-db.php                         24-Jan-2021 12:02                8395
function.mysql-errno.php                           24-Jan-2021 12:02                5366
function.mysql-error.php                           24-Jan-2021 12:02                5239
function.mysql-escape-string.php                   24-Jan-2021 12:02                4700
function.mysql-fetch-array.php                     24-Jan-2021 12:02                8089
function.mysql-fetch-assoc.php                     24-Jan-2021 12:02               11761
function.mysql-fetch-field.php                     24-Jan-2021 12:02               20299
function.mysql-fetch-lengths.php                   24-Jan-2021 12:02                2725
function.mysql-fetch-object.php                    24-Jan-2021 12:02               11240
function.mysql-fetch-row.php                       24-Jan-2021 12:02                7809
function.mysql-field-flags.php                     24-Jan-2021 12:02                2703
function.mysql-field-len.php                       24-Jan-2021 12:02                2119
function.mysql-field-name.php                      24-Jan-2021 12:02               11848
function.mysql-field-seek.php                      24-Jan-2021 12:02                2378
function.mysql-field-table.php                     24-Jan-2021 12:02                2089
function.mysql-field-type.php                      24-Jan-2021 12:02               17737
function.mysql-free-result.php                     24-Jan-2021 12:02                6848
function.mysql-get-client-info.php                 24-Jan-2021 12:02                3161
function.mysql-get-host-info.php                   24-Jan-2021 12:02                4195
function.mysql-get-proto-info.php                  24-Jan-2021 12:02                4141
function.mysql-get-server-info.php                 24-Jan-2021 12:02                4159
function.mysql-info.php                            24-Jan-2021 12:02                3632
function.mysql-insert-id.php                       24-Jan-2021 12:02                5513
function.mysql-list-dbs.php                        24-Jan-2021 12:02                4897
function.mysql-list-fields.php                     24-Jan-2021 12:02                5966
function.mysql-list-processes.php                  24-Jan-2021 12:02                5149
function.mysql-list-tables.php                     24-Jan-2021 12:02                6812
function.mysql-num-fields.php                      24-Jan-2021 12:02                2647
function.mysql-num-rows.php                        24-Jan-2021 12:02                5357
function.mysql-pconnect.php                        24-Jan-2021 12:02                5313
function.mysql-ping.php                            24-Jan-2021 12:02                2731
function.mysql-query.php                           24-Jan-2021 12:02               13776
function.mysql-real-escape-string.php              24-Jan-2021 12:02               16209
function.mysql-result.php                          24-Jan-2021 12:02                5557
function.mysql-select-db.php                       24-Jan-2021 12:02                9348
function.mysql-set-charset.php                     24-Jan-2021 12:02                5495
function.mysql-stat.php                            24-Jan-2021 12:02                4107
function.mysql-tablename.php                       24-Jan-2021 12:02                4971
function.mysql-thread-id.php                       24-Jan-2021 12:02                4222
function.mysql-unbuffered-query.php                24-Jan-2021 12:02                3525
function.mysql-xdevapi-expression.php              24-Jan-2021 12:02                4601
function.mysql-xdevapi-getsession.php              24-Jan-2021 12:02               12995
function.mysqli-connect.php                        24-Jan-2021 12:02                5231
function.mysqli-escape-string.php                  24-Jan-2021 12:02                1687
function.mysqli-execute.php                        24-Jan-2021 12:02                2401
function.mysqli-get-client-stats.php               24-Jan-2021 12:02                8071
function.mysqli-get-links-stats.php                24-Jan-2021 12:02                2909
function.mysqli-report.php                         24-Jan-2021 12:02                1600
function.mysqli-set-opt.php                        24-Jan-2021 12:02                1728
function.mysqlnd-memcache-get-config.php           24-Jan-2021 12:02               11861
function.mysqlnd-memcache-set.php                  24-Jan-2021 12:02               10823
function.mysqlnd-ms-dump-servers.php               24-Jan-2021 12:02                9168
function.mysqlnd-ms-fabric-select-global.php       24-Jan-2021 12:02                3898
function.mysqlnd-ms-fabric-select-shard.php        24-Jan-2021 12:02                4218
function.mysqlnd-ms-get-last-gtid.php              24-Jan-2021 12:02                8810
function.mysqlnd-ms-get-last-used-connection.php   24-Jan-2021 12:02               10042
function.mysqlnd-ms-get-stats.php                  24-Jan-2021 12:02               31459
function.mysqlnd-ms-match-wild.php                 24-Jan-2021 12:02                6898
function.mysqlnd-ms-query-is-select.php            24-Jan-2021 12:02                8698
function.mysqlnd-ms-set-qos.php                    24-Jan-2021 12:02               15595
function.mysqlnd-ms-set-user-pick-server.php       24-Jan-2021 12:02               19006
function.mysqlnd-ms-xa-begin.php                   24-Jan-2021 12:02                8561
function.mysqlnd-ms-xa-commit.php                  24-Jan-2021 12:02                4580
function.mysqlnd-ms-xa-gc.php                      24-Jan-2021 12:02                6416
function.mysqlnd-ms-xa-rollback.php                24-Jan-2021 12:02                4326
function.mysqlnd-qc-clear-cache.php                24-Jan-2021 12:02                2881
function.mysqlnd-qc-get-available-handlers.php     24-Jan-2021 12:02                4770
function.mysqlnd-qc-get-cache-info.php             24-Jan-2021 12:02               19598
function.mysqlnd-qc-get-core-stats.php             24-Jan-2021 12:02               19242
function.mysqlnd-qc-get-normalized-query-trace-..> 24-Jan-2021 12:02               15398
function.mysqlnd-qc-get-query-trace-log.php        24-Jan-2021 12:02               16446
function.mysqlnd-qc-set-cache-condition.php        24-Jan-2021 12:02                9202
function.mysqlnd-qc-set-is-select.php              24-Jan-2021 12:02               11799
function.mysqlnd-qc-set-storage-handler.php        24-Jan-2021 12:02                6343
function.mysqlnd-qc-set-user-handlers.php          24-Jan-2021 12:02                5780
function.mysqlnd-uh-convert-to-mysqlnd.php         24-Jan-2021 12:02                8019
function.mysqlnd-uh-set-connection-proxy.php       24-Jan-2021 12:02               11111
function.mysqlnd-uh-set-statement-proxy.php        24-Jan-2021 12:02                4496
function.natcasesort.php                           24-Jan-2021 12:02                6718
function.natsort.php                               24-Jan-2021 12:02               10438
function.ncurses-addch.php                         24-Jan-2021 12:02                2396
function.ncurses-addchnstr.php                     24-Jan-2021 12:02                2666
function.ncurses-addchstr.php                      24-Jan-2021 12:02                2424
function.ncurses-addnstr.php                       24-Jan-2021 12:02                2641
function.ncurses-addstr.php                        24-Jan-2021 12:02                2428
function.ncurses-assume-default-colors.php         24-Jan-2021 12:02                2733
function.ncurses-attroff.php                       24-Jan-2021 12:02                2440
function.ncurses-attron.php                        24-Jan-2021 12:02                2405
function.ncurses-attrset.php                       24-Jan-2021 12:02                2405
function.ncurses-baudrate.php                      24-Jan-2021 12:02                2013
function.ncurses-beep.php                          24-Jan-2021 12:02                2373
function.ncurses-bkgd.php                          24-Jan-2021 12:02                2395
function.ncurses-bkgdset.php                       24-Jan-2021 12:02                2431
function.ncurses-border.php                        24-Jan-2021 12:02                4727
function.ncurses-bottom-panel.php                  24-Jan-2021 12:02                2193
function.ncurses-can-change-color.php              24-Jan-2021 12:02                3390
function.ncurses-cbreak.php                        24-Jan-2021 12:02                2731
function.ncurses-clear.php                         24-Jan-2021 12:02                2884
function.ncurses-clrtobot.php                      24-Jan-2021 12:02                2955
function.ncurses-clrtoeol.php                      24-Jan-2021 12:02                2962
function.ncurses-color-content.php                 24-Jan-2021 12:02                4506
function.ncurses-color-set.php                     24-Jan-2021 12:02                5978
function.ncurses-curs-set.php                      24-Jan-2021 12:02                2426
function.ncurses-def-prog-mode.php                 24-Jan-2021 12:02                2830
function.ncurses-def-shell-mode.php                24-Jan-2021 12:02                2847
function.ncurses-define-key.php                    24-Jan-2021 12:02                2677
function.ncurses-del-panel.php                     24-Jan-2021 12:02                2195
function.ncurses-delay-output.php                  24-Jan-2021 12:02                2479
function.ncurses-delch.php                         24-Jan-2021 12:02                2827
function.ncurses-deleteln.php                      24-Jan-2021 12:02                2771
function.ncurses-delwin.php                        24-Jan-2021 12:02                2403
function.ncurses-doupdate.php                      24-Jan-2021 12:02                2343
function.ncurses-echo.php                          24-Jan-2021 12:02                2711
function.ncurses-echochar.php                      24-Jan-2021 12:02                2419
function.ncurses-end.php                           24-Jan-2021 12:02                1993
function.ncurses-erase.php                         24-Jan-2021 12:02                2928
function.ncurses-erasechar.php                     24-Jan-2021 12:02                2529
function.ncurses-filter.php                        24-Jan-2021 12:02                2049
function.ncurses-flash.php                         24-Jan-2021 12:02                2586
function.ncurses-flushinp.php                      24-Jan-2021 12:02                2255
function.ncurses-getch.php                         24-Jan-2021 12:02                2004
function.ncurses-getmaxyx.php                      24-Jan-2021 12:02                3341
function.ncurses-getmouse.php                      24-Jan-2021 12:02                6387
function.ncurses-getyx.php                         24-Jan-2021 12:02                2619
function.ncurses-halfdelay.php                     24-Jan-2021 12:02                2426
function.ncurses-has-colors.php                    24-Jan-2021 12:02                5423
function.ncurses-has-ic.php                        24-Jan-2021 12:02                2659
function.ncurses-has-il.php                        24-Jan-2021 12:02                2663
function.ncurses-has-key.php                       24-Jan-2021 12:02                2441
function.ncurses-hide-panel.php                    24-Jan-2021 12:02                2157
function.ncurses-hline.php                         24-Jan-2021 12:02                2683
function.ncurses-inch.php                          24-Jan-2021 12:02                2146
function.ncurses-init-color.php                    24-Jan-2021 12:02                4636
function.ncurses-init-pair.php                     24-Jan-2021 12:02                7723
function.ncurses-init.php                          24-Jan-2021 12:02                2702
function.ncurses-insch.php                         24-Jan-2021 12:02                2440
function.ncurses-insdelln.php                      24-Jan-2021 12:02                2469
function.ncurses-insertln.php                      24-Jan-2021 12:02                1990
function.ncurses-insstr.php                        24-Jan-2021 12:02                2427
function.ncurses-instr.php                         24-Jan-2021 12:02                2681
function.ncurses-isendwin.php                      24-Jan-2021 12:02                3058
function.ncurses-keyok.php                         24-Jan-2021 12:02                2620
function.ncurses-keypad.php                        24-Jan-2021 12:02                2324
function.ncurses-killchar.php                      24-Jan-2021 12:02                2536
function.ncurses-longname.php                      24-Jan-2021 12:02                2612
function.ncurses-meta.php                          24-Jan-2021 12:02                2344
function.ncurses-mouse-trafo.php                   24-Jan-2021 12:02                2610
function.ncurses-mouseinterval.php                 24-Jan-2021 12:02                2485
function.ncurses-mousemask.php                     24-Jan-2021 12:02                8093
function.ncurses-move-panel.php                    24-Jan-2021 12:02                2633
function.ncurses-move.php                          24-Jan-2021 12:02                2588
function.ncurses-mvaddch.php                       24-Jan-2021 12:02                2845
function.ncurses-mvaddchnstr.php                   24-Jan-2021 12:02                3124
function.ncurses-mvaddchstr.php                    24-Jan-2021 12:02                2882
function.ncurses-mvaddnstr.php                     24-Jan-2021 12:02                3099
function.ncurses-mvaddstr.php                      24-Jan-2021 12:02                2843
function.ncurses-mvcur.php                         24-Jan-2021 12:02                3063
function.ncurses-mvdelch.php                       24-Jan-2021 12:02                2641
function.ncurses-mvgetch.php                       24-Jan-2021 12:02                2633
function.ncurses-mvhline.php                       24-Jan-2021 12:02                3134
function.ncurses-mvinch.php                        24-Jan-2021 12:02                2636
function.ncurses-mvvline.php                       24-Jan-2021 12:02                3136
function.ncurses-mvwaddstr.php                     24-Jan-2021 12:02                3094
function.ncurses-napms.php                         24-Jan-2021 12:02                2386
function.ncurses-new-panel.php                     24-Jan-2021 12:02                2153
function.ncurses-newpad.php                        24-Jan-2021 12:02                2331
function.ncurses-newwin.php                        24-Jan-2021 12:02                3555
function.ncurses-nl.php                            24-Jan-2021 12:02                1999
function.ncurses-nocbreak.php                      24-Jan-2021 12:02                2890
function.ncurses-noecho.php                        24-Jan-2021 12:02                2753
function.ncurses-nonl.php                          24-Jan-2021 12:02                2022
function.ncurses-noqiflush.php                     24-Jan-2021 12:02                2052
function.ncurses-noraw.php                         24-Jan-2021 12:02                3233
function.ncurses-pair-content.php                  24-Jan-2021 12:02                4712
function.ncurses-panel-above.php                   24-Jan-2021 12:02                2396
function.ncurses-panel-below.php                   24-Jan-2021 12:02                2386
function.ncurses-panel-window.php                  24-Jan-2021 12:02                2192
function.ncurses-pnoutrefresh.php                  24-Jan-2021 12:02                3567
function.ncurses-prefresh.php                      24-Jan-2021 12:02                3527
function.ncurses-putp.php                          24-Jan-2021 12:02                2407
function.ncurses-qiflush.php                       24-Jan-2021 12:02                2028
function.ncurses-raw.php                           24-Jan-2021 12:02                3199
function.ncurses-refresh.php                       24-Jan-2021 12:02                2388
function.ncurses-replace-panel.php                 24-Jan-2021 12:02                2427
function.ncurses-reset-prog-mode.php               24-Jan-2021 12:02                1821
function.ncurses-reset-shell-mode.php              24-Jan-2021 12:02                1816
function.ncurses-resetty.php                       24-Jan-2021 12:02                2672
function.ncurses-savetty.php                       24-Jan-2021 12:02                2668
function.ncurses-scr-dump.php                      24-Jan-2021 12:02                2422
function.ncurses-scr-init.php                      24-Jan-2021 12:02                2435
function.ncurses-scr-restore.php                   24-Jan-2021 12:02                2448
function.ncurses-scr-set.php                       24-Jan-2021 12:02                2416
function.ncurses-scrl.php                          24-Jan-2021 12:02                2424
function.ncurses-show-panel.php                    24-Jan-2021 12:02                2173
function.ncurses-slk-attr.php                      24-Jan-2021 12:02                2169
function.ncurses-slk-attroff.php                   24-Jan-2021 12:02                2475
function.ncurses-slk-attron.php                    24-Jan-2021 12:02                2474
function.ncurses-slk-attrset.php                   24-Jan-2021 12:02                2468
function.ncurses-slk-clear.php                     24-Jan-2021 12:02                2311
function.ncurses-slk-color.php                     24-Jan-2021 12:02                2429
function.ncurses-slk-init.php                      24-Jan-2021 12:02                3419
function.ncurses-slk-noutrefresh.php               24-Jan-2021 12:02                2090
function.ncurses-slk-refresh.php                   24-Jan-2021 12:02                2016
function.ncurses-slk-restore.php                   24-Jan-2021 12:02                2099
function.ncurses-slk-set.php                       24-Jan-2021 12:02                2582
function.ncurses-slk-touch.php                     24-Jan-2021 12:02                2137
function.ncurses-standend.php                      24-Jan-2021 12:02                2038
function.ncurses-standout.php                      24-Jan-2021 12:02                2043
function.ncurses-start-color.php                   24-Jan-2021 12:02                5600
function.ncurses-termattrs.php                     24-Jan-2021 12:02                2074
function.ncurses-termname.php                      24-Jan-2021 12:02                2602
function.ncurses-timeout.php                       24-Jan-2021 12:02                2457
function.ncurses-top-panel.php                     24-Jan-2021 12:02                2154
function.ncurses-typeahead.php                     24-Jan-2021 12:02                2445
function.ncurses-ungetch.php                       24-Jan-2021 12:02                2432
function.ncurses-ungetmouse.php                    24-Jan-2021 12:02                3880
function.ncurses-update-panels.php                 24-Jan-2021 12:02                1875
function.ncurses-use-default-colors.php            24-Jan-2021 12:02                2119
function.ncurses-use-env.php                       24-Jan-2021 12:02                2509
function.ncurses-use-extended-names.php            24-Jan-2021 12:02                2517
function.ncurses-vidattr.php                       24-Jan-2021 12:02                2457
function.ncurses-vline.php                         24-Jan-2021 12:02                2679
function.ncurses-waddch.php                        24-Jan-2021 12:02                2364
function.ncurses-waddstr.php                       24-Jan-2021 12:02                2612
function.ncurses-wattroff.php                      24-Jan-2021 12:02                2358
function.ncurses-wattron.php                       24-Jan-2021 12:02                2353
function.ncurses-wattrset.php                      24-Jan-2021 12:02                2356
function.ncurses-wborder.php                       24-Jan-2021 12:02                5038
function.ncurses-wclear.php                        24-Jan-2021 12:02                2102
function.ncurses-wcolor-set.php                    24-Jan-2021 12:02                2374
function.ncurses-werase.php                        24-Jan-2021 12:02                2108
function.ncurses-wgetch.php                        24-Jan-2021 12:02                2119
function.ncurses-whline.php                        24-Jan-2021 12:02                2653
function.ncurses-wmouse-trafo.php                  24-Jan-2021 12:02                2853
function.ncurses-wmove.php                         24-Jan-2021 12:02                2560
function.ncurses-wnoutrefresh.php                  24-Jan-2021 12:02                2160
function.ncurses-wrefresh.php                      24-Jan-2021 12:02                2438
function.ncurses-wstandend.php                     24-Jan-2021 12:02                2143
function.ncurses-wstandout.php                     24-Jan-2021 12:02                2141
function.ncurses-wvline.php                        24-Jan-2021 12:02                2629
function.next.php                                  24-Jan-2021 12:02                7462
function.ngettext.php                              24-Jan-2021 12:02                5560
function.nl-langinfo.php                           24-Jan-2021 12:02               13530
function.nl2br.php                                 24-Jan-2021 12:02                6914
function.number-format.php                         24-Jan-2021 12:02                9477
function.oauth-get-sbs.php                         24-Jan-2021 12:02                2800
function.oauth-urlencode.php                       24-Jan-2021 12:02                2394
function.ob-clean.php                              24-Jan-2021 12:01                3135
function.ob-end-clean.php                          24-Jan-2021 12:01                4793
function.ob-end-flush.php                          24-Jan-2021 12:01                5631
function.ob-flush.php                              24-Jan-2021 12:01                3346
function.ob-get-clean.php                          24-Jan-2021 12:01                4370
function.ob-get-contents.php                       24-Jan-2021 12:01                4246
function.ob-get-flush.php                          24-Jan-2021 12:01                4949
function.ob-get-length.php                         24-Jan-2021 12:01                4216
function.ob-get-level.php                          24-Jan-2021 12:01                2438
function.ob-get-status.php                         24-Jan-2021 12:01                6743
function.ob-gzhandler.php                          24-Jan-2021 12:01                6144
function.ob-iconv-handler.php                      24-Jan-2021 12:02                4810
function.ob-implicit-flush.php                     24-Jan-2021 12:01                3408
function.ob-list-handlers.php                      24-Jan-2021 12:01                5700
function.ob-start.php                              24-Jan-2021 12:01               17072
function.ob-tidyhandler.php                        24-Jan-2021 12:02                4086
function.oci-bind-array-by-name.php                24-Jan-2021 12:02               13549
function.oci-bind-by-name.php                      24-Jan-2021 12:02              105777
function.oci-cancel.php                            24-Jan-2021 12:02                2411
function.oci-client-version.php                    24-Jan-2021 12:02                3821
function.oci-close.php                             24-Jan-2021 12:02               20955
function.oci-commit.php                            24-Jan-2021 12:02               16904
function.oci-connect.php                           24-Jan-2021 12:02               53192
function.oci-define-by-name.php                    24-Jan-2021 12:02                6936
function.oci-error.php                             24-Jan-2021 12:02                5325
function.oci-execute.php                           24-Jan-2021 12:02               22963
function.oci-fetch-all.php                         24-Jan-2021 12:02               33041
function.oci-fetch-array.php                       24-Jan-2021 12:02               71084
function.oci-fetch-assoc.php                       24-Jan-2021 12:02                8551
function.oci-fetch-object.php                      24-Jan-2021 12:02               19207
function.oci-fetch-row.php                         24-Jan-2021 12:02                8496
function.oci-fetch.php                             24-Jan-2021 12:02               13925
function.oci-field-is-null.php                     24-Jan-2021 12:02                2790
function.oci-field-name.php                        24-Jan-2021 12:02                8513
function.oci-field-precision.php                   24-Jan-2021 12:02                2862
function.oci-field-scale.php                       24-Jan-2021 12:02                2923
function.oci-field-size.php                        24-Jan-2021 12:02                8625
function.oci-field-type-raw.php                    24-Jan-2021 12:02                2825
function.oci-field-type.php                        24-Jan-2021 12:02                8739
function.oci-free-descriptor.php                   24-Jan-2021 12:02                2770
function.oci-free-statement.php                    24-Jan-2021 12:02                2657
function.oci-get-implicit-resultset.php            24-Jan-2021 12:02               32161
function.oci-internal-debug.php                    24-Jan-2021 12:02                3471
function.oci-lob-copy.php                          24-Jan-2021 12:02                3593
function.oci-lob-is-equal.php                      24-Jan-2021 12:02                2978
function.oci-new-collection.php                    24-Jan-2021 12:02                3049
function.oci-new-connect.php                       24-Jan-2021 12:02               35758
function.oci-new-cursor.php                        24-Jan-2021 12:02               11962
function.oci-new-descriptor.php                    24-Jan-2021 12:02               20788
function.oci-num-fields.php                        24-Jan-2021 12:02                7217
function.oci-num-rows.php                          24-Jan-2021 12:02                7389
function.oci-parse.php                             24-Jan-2021 12:02                3200
function.oci-password-change.php                   24-Jan-2021 12:02                6937
function.oci-pconnect.php                          24-Jan-2021 12:02               12210
function.oci-register-taf-callback.php             24-Jan-2021 12:02                5207
function.oci-result.php                            24-Jan-2021 12:02                6472
function.oci-rollback.php                          24-Jan-2021 12:02               15528
function.oci-server-version.php                    24-Jan-2021 12:02                3614
function.oci-set-action.php                        24-Jan-2021 12:02                8149
function.oci-set-call-timout.php                   24-Jan-2021 12:02                5586
function.oci-set-client-identifier.php             24-Jan-2021 12:02                7961
function.oci-set-client-info.php                   24-Jan-2021 12:02                8071
function.oci-set-db-operation.php                  24-Jan-2021 12:02                7528
function.oci-set-edition.php                       24-Jan-2021 12:02                9675
function.oci-set-module-name.php                   24-Jan-2021 12:02                8196
function.oci-set-prefetch.php                      24-Jan-2021 12:02               21222
function.oci-statement-type.php                    24-Jan-2021 12:02                5903
function.oci-unregister-taf-callback.php           24-Jan-2021 12:02                3288
function.ocibindbyname.php                         24-Jan-2021 12:02                1832
function.ocicancel.php                             24-Jan-2021 12:02                1778
function.ocicloselob.php                           24-Jan-2021 12:02                1722
function.ocicollappend.php                         24-Jan-2021 12:02                1840
function.ocicollassign.php                         24-Jan-2021 12:02                1852
function.ocicollassignelem.php                     24-Jan-2021 12:02                1886
function.ocicollgetelem.php                        24-Jan-2021 12:02                1856
function.ocicollmax.php                            24-Jan-2021 12:02                1812
function.ocicollsize.php                           24-Jan-2021 12:02                1814
function.ocicolltrim.php                           24-Jan-2021 12:02                1824
function.ocicolumnisnull.php                       24-Jan-2021 12:02                1842
function.ocicolumnname.php                         24-Jan-2021 12:02                1836
function.ocicolumnprecision.php                    24-Jan-2021 12:02                1874
function.ocicolumnscale.php                        24-Jan-2021 12:02                1842
function.ocicolumnsize.php                         24-Jan-2021 12:02                1824
function.ocicolumntype.php                         24-Jan-2021 12:02                1828
function.ocicolumntyperaw.php                      24-Jan-2021 12:02                1848
function.ocicommit.php                             24-Jan-2021 12:02                1792
function.ocidefinebyname.php                       24-Jan-2021 12:02                1832
function.ocierror.php                              24-Jan-2021 12:02                1770
function.ociexecute.php                            24-Jan-2021 12:02                1772
function.ocifetch.php                              24-Jan-2021 12:02                1764
function.ocifetchinto.php                          24-Jan-2021 12:02                2511
function.ocifetchstatement.php                     24-Jan-2021 12:02                1848
function.ocifreecollection.php                     24-Jan-2021 12:02                1868
function.ocifreecursor.php                         24-Jan-2021 12:02                1842
function.ocifreedesc.php                           24-Jan-2021 12:02                1730
function.ocifreestatement.php                      24-Jan-2021 12:02                1858
function.ociinternaldebug.php                      24-Jan-2021 12:02                1879
function.ociloadlob.php                            24-Jan-2021 12:02                1716
function.ocilogoff.php                             24-Jan-2021 12:02                1762
function.ocilogon.php                              24-Jan-2021 12:02                1778
function.ocinewcollection.php                      24-Jan-2021 12:02                1856
function.ocinewcursor.php                          24-Jan-2021 12:02                1828
function.ocinewdescriptor.php                      24-Jan-2021 12:02                1846
function.ocinlogon.php                             24-Jan-2021 12:02                1802
function.ocinumcols.php                            24-Jan-2021 12:02                1786
function.ociparse.php                              24-Jan-2021 12:02                1758
function.ociplogon.php                             24-Jan-2021 12:02                1772
function.ociresult.php                             24-Jan-2021 12:02                1770
function.ocirollback.php                           24-Jan-2021 12:02                1790
function.ocirowcount.php                           24-Jan-2021 12:02                1792
function.ocisavelob.php                            24-Jan-2021 12:02                1716
function.ocisavelobfile.php                        24-Jan-2021 12:02                1746
function.ociserverversion.php                      24-Jan-2021 12:02                1860
function.ocisetprefetch.php                        24-Jan-2021 12:02                1848
function.ocistatementtype.php                      24-Jan-2021 12:02                1866
function.ociwritelobtofile.php                     24-Jan-2021 12:02                1784
function.ociwritetemporarylob.php                  24-Jan-2021 12:02                1794
function.octdec.php                                24-Jan-2021 12:02                4959
function.odbc-autocommit.php                       24-Jan-2021 12:02                3961
function.odbc-binmode.php                          24-Jan-2021 12:02                6382
function.odbc-close-all.php                        24-Jan-2021 12:02                2420
function.odbc-close.php                            24-Jan-2021 12:02                2681
function.odbc-columnprivileges.php                 24-Jan-2021 12:02                8054
function.odbc-columns.php                          24-Jan-2021 12:02               10706
function.odbc-commit.php                           24-Jan-2021 12:02                2382
function.odbc-connect.php                          24-Jan-2021 12:02                8445
function.odbc-cursor.php                           24-Jan-2021 12:02                2359
function.odbc-data-source.php                      24-Jan-2021 12:02                5482
function.odbc-do.php                               24-Jan-2021 12:02                1552
function.odbc-error.php                            24-Jan-2021 12:02                3795
function.odbc-errormsg.php                         24-Jan-2021 12:02                3845
function.odbc-exec.php                             24-Jan-2021 12:02                3712
function.odbc-execute.php                          24-Jan-2021 12:02                6695
function.odbc-fetch-array.php                      24-Jan-2021 12:02                3959
function.odbc-fetch-into.php                       24-Jan-2021 12:02                4700
function.odbc-fetch-object.php                     24-Jan-2021 12:02                4000
function.odbc-fetch-row.php                        24-Jan-2021 12:02                4387
function.odbc-field-len.php                        24-Jan-2021 12:02                3115
function.odbc-field-name.php                       24-Jan-2021 12:02                2714
function.odbc-field-num.php                        24-Jan-2021 12:02                2735
function.odbc-field-precision.php                  24-Jan-2021 12:02                2078
function.odbc-field-scale.php                      24-Jan-2021 12:02                2730
function.odbc-field-type.php                       24-Jan-2021 12:02                2714
function.odbc-foreignkeys.php                      24-Jan-2021 12:02                8271
function.odbc-free-result.php                      24-Jan-2021 12:02                3095
function.odbc-gettypeinfo.php                      24-Jan-2021 12:02                4209
function.odbc-longreadlen.php                      24-Jan-2021 12:02                3621
function.odbc-next-result.php                      24-Jan-2021 12:02                8900
function.odbc-num-fields.php                       24-Jan-2021 12:02                2382
function.odbc-num-rows.php                         24-Jan-2021 12:02                3024
function.odbc-pconnect.php                         24-Jan-2021 12:02                4197
function.odbc-prepare.php                          24-Jan-2021 12:02                6104
function.odbc-primarykeys.php                      24-Jan-2021 12:02                7418
function.odbc-procedurecolumns.php                 24-Jan-2021 12:02               10900
function.odbc-procedures.php                       24-Jan-2021 12:02                8886
function.odbc-result-all.php                       24-Jan-2021 12:02                3102
function.odbc-result.php                           24-Jan-2021 12:02                5270
function.odbc-rollback.php                         24-Jan-2021 12:02                2399
function.odbc-setoption.php                        24-Jan-2021 12:02                6890
function.odbc-specialcolumns.php                   24-Jan-2021 12:02                6714
function.odbc-statistics.php                       24-Jan-2021 12:02                9159
function.odbc-tableprivileges.php                  24-Jan-2021 12:02                7741
function.odbc-tables.php                           24-Jan-2021 12:02               11709
function.opcache-compile-file.php                  24-Jan-2021 12:01                3462
function.opcache-get-configuration.php             24-Jan-2021 12:01                2753
function.opcache-get-status.php                    24-Jan-2021 12:01                3181
function.opcache-invalidate.php                    24-Jan-2021 12:01                3755
function.opcache-is-script-cached.php              24-Jan-2021 12:01                3032
function.opcache-reset.php                         24-Jan-2021 12:01                2692
function.openal-buffer-create.php                  24-Jan-2021 12:02                2457
function.openal-buffer-data.php                    24-Jan-2021 12:02                4173
function.openal-buffer-destroy.php                 24-Jan-2021 12:02                2858
function.openal-buffer-get.php                     24-Jan-2021 12:02                3423
function.openal-buffer-loadwav.php                 24-Jan-2021 12:02                3379
function.openal-context-create.php                 24-Jan-2021 12:02                3113
function.openal-context-current.php                24-Jan-2021 12:02                2912
function.openal-context-destroy.php                24-Jan-2021 12:02                2898
function.openal-context-process.php                24-Jan-2021 12:02                3316
function.openal-context-suspend.php                24-Jan-2021 12:02                3310
function.openal-device-close.php                   24-Jan-2021 12:02                2867
function.openal-device-open.php                    24-Jan-2021 12:02                3113
function.openal-listener-get.php                   24-Jan-2021 12:02                3032
function.openal-listener-set.php                   24-Jan-2021 12:02                3331
function.openal-source-create.php                  24-Jan-2021 12:02                2668
function.openal-source-destroy.php                 24-Jan-2021 12:02                2866
function.openal-source-get.php                     24-Jan-2021 12:02                4531
function.openal-source-pause.php                   24-Jan-2021 12:02                3199
function.openal-source-play.php                    24-Jan-2021 12:02                3199
function.openal-source-rewind.php                  24-Jan-2021 12:02                3207
function.openal-source-set.php                     24-Jan-2021 12:02                5061
function.openal-source-stop.php                    24-Jan-2021 12:02                3181
function.openal-stream.php                         24-Jan-2021 12:02                3805
function.opendir.php                               24-Jan-2021 12:02                8023
function.openlog.php                               24-Jan-2021 12:02                8245
function.openssl-cipher-iv-length.php              24-Jan-2021 12:02                3959
function.openssl-cms-decrypt.php                   24-Jan-2021 12:02                4221
function.openssl-cms-encrypt.php                   24-Jan-2021 12:02                4550
function.openssl-cms-read.php                      24-Jan-2021 12:02                2818
function.openssl-cms-sign.php                      24-Jan-2021 12:02                5274
function.openssl-cms-verify.php                    24-Jan-2021 12:02                5650
function.openssl-csr-export-to-file.php            24-Jan-2021 12:02                7160
function.openssl-csr-export.php                    24-Jan-2021 12:02                6940
function.openssl-csr-get-public-key.php            24-Jan-2021 12:02                6989
function.openssl-csr-get-subject.php               24-Jan-2021 12:02                8365
function.openssl-csr-new.php                       24-Jan-2021 12:02               19199
function.openssl-csr-sign.php                      24-Jan-2021 12:02                9838
function.openssl-decrypt.php                       24-Jan-2021 12:02                6160
function.openssl-dh-compute-key.php                24-Jan-2021 12:02                2713
function.openssl-digest.php                        24-Jan-2021 12:02                4092
function.openssl-encrypt.php                       24-Jan-2021 12:02               17488
function.openssl-error-string.php                  24-Jan-2021 12:02                3328
function.openssl-free-key.php                      24-Jan-2021 12:02                2427
function.openssl-get-cert-locations.php            24-Jan-2021 12:02                3763
function.openssl-get-cipher-methods.php            24-Jan-2021 12:02               12006
function.openssl-get-curve-names.php               24-Jan-2021 12:02                6669
function.openssl-get-md-methods.php                24-Jan-2021 12:02                6662
function.openssl-get-privatekey.php                24-Jan-2021 12:02                1760
function.openssl-get-publickey.php                 24-Jan-2021 12:02                1733
function.openssl-open.php                          24-Jan-2021 12:02                8641
function.openssl-pbkdf2.php                        24-Jan-2021 12:02                6884
function.openssl-pkcs12-export-to-file.php         24-Jan-2021 12:02                4761
function.openssl-pkcs12-export.php                 24-Jan-2021 12:02                4748
function.openssl-pkcs12-read.php                   24-Jan-2021 12:02                5218
function.openssl-pkcs7-decrypt.php                 24-Jan-2021 12:02                5912
function.openssl-pkcs7-encrypt.php                 24-Jan-2021 12:02                8956
function.openssl-pkcs7-read.php                    24-Jan-2021 12:02                2691
function.openssl-pkcs7-sign.php                    24-Jan-2021 12:02                9403
function.openssl-pkcs7-verify.php                  24-Jan-2021 12:02                6176
function.openssl-pkey-export-to-file.php           24-Jan-2021 12:02                4275
function.openssl-pkey-export.php                   24-Jan-2021 12:02                4195
function.openssl-pkey-free.php                     24-Jan-2021 12:02                2422
function.openssl-pkey-get-details.php              24-Jan-2021 12:02                7955
function.openssl-pkey-get-private.php              24-Jan-2021 12:02                3518
function.openssl-pkey-get-public.php               24-Jan-2021 12:02                3223
function.openssl-pkey-new.php                      24-Jan-2021 12:02                3716
function.openssl-private-decrypt.php               24-Jan-2021 12:02                5187
function.openssl-private-encrypt.php               24-Jan-2021 12:02                4540
function.openssl-public-decrypt.php                24-Jan-2021 12:02                4533
function.openssl-public-encrypt.php                24-Jan-2021 12:02                4748
function.openssl-random-pseudo-bytes.php           24-Jan-2021 12:02                7849
function.openssl-seal.php                          24-Jan-2021 12:02                9809
function.openssl-sign.php                          24-Jan-2021 12:02               11003
function.openssl-spki-export-challenge.php         24-Jan-2021 12:02                7135
function.openssl-spki-export.php                   24-Jan-2021 12:02                7771
function.openssl-spki-new.php                      24-Jan-2021 12:02                7390
function.openssl-spki-verify.php                   24-Jan-2021 12:02                7429
function.openssl-verify.php                        24-Jan-2021 12:02               12252
function.openssl-x509-check-private-key.php        24-Jan-2021 12:02                3616
function.openssl-x509-checkpurpose.php             24-Jan-2021 12:02                5402
function.openssl-x509-export-to-file.php           24-Jan-2021 12:02                3634
function.openssl-x509-export.php                   24-Jan-2021 12:02                3590
function.openssl-x509-fingerprint.php              24-Jan-2021 12:02                3886
function.openssl-x509-free.php                     24-Jan-2021 12:02                2411
function.openssl-x509-parse.php                    24-Jan-2021 12:02                3287
function.openssl-x509-read.php                     24-Jan-2021 12:02                2730
function.openssl-x509-verify.php                   24-Jan-2021 12:02               11054
function.ord.php                                   24-Jan-2021 12:02                6759
function.output-add-rewrite-var.php                24-Jan-2021 12:01                6418
function.output-reset-rewrite-vars.php             24-Jan-2021 12:01                5077
function.pack.php                                  24-Jan-2021 12:02               12000
function.parse-ini-file.php                        24-Jan-2021 12:02               12603
function.parse-ini-string.php                      24-Jan-2021 12:02                5382
function.parse-str.php                             24-Jan-2021 12:02               10527
function.parse-url.php                             24-Jan-2021 12:02               11233
function.passthru.php                              24-Jan-2021 12:02                5200
function.password-algos.php                        24-Jan-2021 12:02                3015
function.password-get-info.php                     24-Jan-2021 12:02                3210
function.password-hash.php                         24-Jan-2021 12:02               19633
function.password-needs-rehash.php                 24-Jan-2021 12:02                7396
function.password-verify.php                       24-Jan-2021 12:02                5534
function.pathinfo.php                              24-Jan-2021 12:02               10004
function.pclose.php                                24-Jan-2021 12:02                4412
function.pcntl-alarm.php                           24-Jan-2021 12:02                2643
function.pcntl-async-signals.php                   24-Jan-2021 12:02                3109
function.pcntl-errno.php                           24-Jan-2021 12:02                1636
function.pcntl-exec.php                            24-Jan-2021 12:02                3419
function.pcntl-fork.php                            24-Jan-2021 12:02                5103
function.pcntl-get-last-error.php                  24-Jan-2021 12:02                2545
function.pcntl-getpriority.php                     24-Jan-2021 12:02                4187
function.pcntl-setpriority.php                     24-Jan-2021 12:02                4041
function.pcntl-signal-dispatch.php                 24-Jan-2021 12:02                5208
function.pcntl-signal-get-handler.php              24-Jan-2021 12:02                6462
function.pcntl-signal.php                          24-Jan-2021 12:02               10958
function.pcntl-sigprocmask.php                     24-Jan-2021 12:02                5649
function.pcntl-sigtimedwait.php                    24-Jan-2021 12:02                4396
function.pcntl-sigwaitinfo.php                     24-Jan-2021 12:02                6962
function.pcntl-strerror.php                        24-Jan-2021 12:02                2860
function.pcntl-wait.php                            24-Jan-2021 12:02                7848
function.pcntl-waitpid.php                         24-Jan-2021 12:02                8912
function.pcntl-wexitstatus.php                     24-Jan-2021 12:02                3234
function.pcntl-wifexited.php                       24-Jan-2021 12:02                3157
function.pcntl-wifsignaled.php                     24-Jan-2021 12:02                3177
function.pcntl-wifstopped.php                      24-Jan-2021 12:02                3143
function.pcntl-wstopsig.php                        24-Jan-2021 12:02                3158
function.pcntl-wtermsig.php                        24-Jan-2021 12:02                3349
function.pfsockopen.php                            24-Jan-2021 12:02                3323
function.pg-affected-rows.php                      24-Jan-2021 12:02                3844
function.pg-cancel-query.php                       24-Jan-2021 12:02                2373
function.pg-client-encoding.php                    24-Jan-2021 12:02                3013
function.pg-close.php                              24-Jan-2021 12:02                5071
function.pg-connect-poll.php                       24-Jan-2021 12:02                2776
function.pg-connect.php                            24-Jan-2021 12:02                6354
function.pg-connection-busy.php                    24-Jan-2021 12:02                4087
function.pg-connection-reset.php                   24-Jan-2021 12:02                4936
function.pg-connection-status.php                  24-Jan-2021 12:02                4815
function.pg-consume-input.php                      24-Jan-2021 12:02                2548
function.pg-convert.php                            24-Jan-2021 12:02                7269
function.pg-copy-from.php                          24-Jan-2021 12:02                6822
function.pg-copy-to.php                            24-Jan-2021 12:02                2579
function.pg-dbname.php                             24-Jan-2021 12:02                2971
function.pg-delete.php                             24-Jan-2021 12:02                7008
function.pg-end-copy.php                           24-Jan-2021 12:02                5991
function.pg-escape-bytea.php                       24-Jan-2021 12:02                3004
function.pg-escape-identifier.php                  24-Jan-2021 12:02                6794
function.pg-escape-literal.php                     24-Jan-2021 12:02                7454
function.pg-escape-string.php                      24-Jan-2021 12:02                2363
function.pg-execute.php                            24-Jan-2021 12:02                9131
function.pg-fetch-all-columns.php                  24-Jan-2021 12:02                6383
function.pg-fetch-all.php                          24-Jan-2021 12:02                4493
function.pg-fetch-array.php                        24-Jan-2021 12:02                7797
function.pg-fetch-assoc.php                        24-Jan-2021 12:02                6089
function.pg-fetch-object.php                       24-Jan-2021 12:02                8408
function.pg-fetch-result.php                       24-Jan-2021 12:02                3511
function.pg-fetch-row.php                          24-Jan-2021 12:02                7832
function.pg-field-is-null.php                      24-Jan-2021 12:02                5683
function.pg-field-name.php                         24-Jan-2021 12:02                7227
function.pg-field-num.php                          24-Jan-2021 12:02                2652
function.pg-field-prtlen.php                       24-Jan-2021 12:02                2770
function.pg-field-size.php                         24-Jan-2021 12:02                2902
function.pg-field-table.php                        24-Jan-2021 12:02                7449
function.pg-field-type-oid.php                     24-Jan-2021 12:02                6640
function.pg-field-type.php                         24-Jan-2021 12:02                2727
function.pg-flush.php                              24-Jan-2021 12:02                2564
function.pg-free-result.php                        24-Jan-2021 12:02                6761
function.pg-get-notify.php                         24-Jan-2021 12:02                4410
function.pg-get-pid.php                            24-Jan-2021 12:02                3366
function.pg-get-result.php                         24-Jan-2021 12:02                2366
function.pg-host.php                               24-Jan-2021 12:02                2148
function.pg-insert.php                             24-Jan-2021 12:02                7116
function.pg-last-error.php                         24-Jan-2021 12:02                2929
function.pg-last-notice.php                        24-Jan-2021 12:02                6894
function.pg-last-oid.php                           24-Jan-2021 12:02                3076
function.pg-lo-close.php                           24-Jan-2021 12:02                2660
function.pg-lo-create.php                          24-Jan-2021 12:02                2782
function.pg-lo-export.php                          24-Jan-2021 12:02                7119
function.pg-lo-import.php                          24-Jan-2021 12:02                6433
function.pg-lo-open.php                            24-Jan-2021 12:02                3055
function.pg-lo-read-all.php                        24-Jan-2021 12:02                2557
function.pg-lo-read.php                            24-Jan-2021 12:02                2718
function.pg-lo-seek.php                            24-Jan-2021 12:02                2364
function.pg-lo-tell.php                            24-Jan-2021 12:02                2065
function.pg-lo-truncate.php                        24-Jan-2021 12:02                6372
function.pg-lo-unlink.php                          24-Jan-2021 12:02                6084
function.pg-lo-write.php                           24-Jan-2021 12:02                2827
function.pg-meta-data.php                          24-Jan-2021 12:02                6283
function.pg-num-fields.php                         24-Jan-2021 12:02                2498
function.pg-num-rows.php                           24-Jan-2021 12:02                2848
function.pg-options.php                            24-Jan-2021 12:02                1908
function.pg-parameter-status.php                   24-Jan-2021 12:02                7235
function.pg-pconnect.php                           24-Jan-2021 12:02                8655
function.pg-ping.php                               24-Jan-2021 12:02                3431
function.pg-port.php                               24-Jan-2021 12:02                1837
function.pg-prepare.php                            24-Jan-2021 12:02                9080
function.pg-put-line.php                           24-Jan-2021 12:02                7726
function.pg-query-params.php                       24-Jan-2021 12:02                9430
function.pg-query.php                              24-Jan-2021 12:02                4781
function.pg-result-error-field.php                 24-Jan-2021 12:02                7391
function.pg-result-error.php                       24-Jan-2021 12:02                2656
function.pg-result-seek.php                        24-Jan-2021 12:02                2646
function.pg-result-status.php                      24-Jan-2021 12:02                2227
function.pg-select.php                             24-Jan-2021 12:02                7310
function.pg-send-execute.php                       24-Jan-2021 12:02               10122
function.pg-send-prepare.php                       24-Jan-2021 12:02               10497
function.pg-send-query-params.php                  24-Jan-2021 12:02                7135
function.pg-send-query.php                         24-Jan-2021 12:02                7630
function.pg-set-client-encoding.php                24-Jan-2021 12:02                3105
function.pg-set-error-verbosity.php                24-Jan-2021 12:02                7443
function.pg-socket.php                             24-Jan-2021 12:02                2688
function.pg-trace.php                              24-Jan-2021 12:02                3478
function.pg-transaction-status.php                 24-Jan-2021 12:02                5615
function.pg-tty.php                                24-Jan-2021 12:02                1879
function.pg-unescape-bytea.php                     24-Jan-2021 12:02                3045
function.pg-untrace.php                            24-Jan-2021 12:02                2262
function.pg-update.php                             24-Jan-2021 12:02                7964
function.pg-version.php                            24-Jan-2021 12:02                5275
function.php-ini-loaded-file.php                   24-Jan-2021 12:01                4339
function.php-ini-scanned-files.php                 24-Jan-2021 12:01                5864
function.php-sapi-name.php                         24-Jan-2021 12:01                5533
function.php-strip-whitespace.php                  24-Jan-2021 12:02                4512
function.php-uname.php                             24-Jan-2021 12:01                9103
function.phpcredits.php                            24-Jan-2021 12:01                7608
function.phpdbg-break-file.php                     24-Jan-2021 12:01                3518
function.phpdbg-break-function.php                 24-Jan-2021 12:01                3303
function.phpdbg-break-method.php                   24-Jan-2021 12:01                3587
function.phpdbg-break-next.php                     24-Jan-2021 12:01                2989
function.phpdbg-clear.php                          24-Jan-2021 12:01                3224
function.phpdbg-color.php                          24-Jan-2021 12:01                3417
function.phpdbg-end-oplog.php                      24-Jan-2021 12:01                2292
function.phpdbg-exec.php                           24-Jan-2021 12:01                2616
function.phpdbg-get-executable.php                 24-Jan-2021 12:01                2282
function.phpdbg-prompt.php                         24-Jan-2021 12:01                2609
function.phpdbg-start-oplog.php                    24-Jan-2021 12:01                2056
function.phpinfo.php                               24-Jan-2021 12:01                9797
function.phpversion.php                            24-Jan-2021 12:01                9649
function.pi.php                                    24-Jan-2021 12:02                2964
function.png2wbmp.php                              24-Jan-2021 12:02                5973
function.popen.php                                 24-Jan-2021 12:02                7376
function.pos.php                                   24-Jan-2021 12:02                1491
function.posix-access.php                          24-Jan-2021 12:02                6080
function.posix-ctermid.php                         24-Jan-2021 12:02                3965
function.posix-errno.php                           24-Jan-2021 12:02                1652
function.posix-get-last-error.php                  24-Jan-2021 12:02                3845
function.posix-getcwd.php                          24-Jan-2021 12:02                3835
function.posix-getegid.php                         24-Jan-2021 12:02                4964
function.posix-geteuid.php                         24-Jan-2021 12:02                4904
function.posix-getgid.php                          24-Jan-2021 12:02                4411
function.posix-getgrgid.php                        24-Jan-2021 12:02                6105
function.posix-getgrnam.php                        24-Jan-2021 12:02                5982
function.posix-getgroups.php                       24-Jan-2021 12:02                3714
function.posix-getlogin.php                        24-Jan-2021 12:02                3171
function.posix-getpgid.php                         24-Jan-2021 12:02                4338
function.posix-getpgrp.php                         24-Jan-2021 12:02                2168
function.posix-getpid.php                          24-Jan-2021 12:02                3274
function.posix-getppid.php                         24-Jan-2021 12:02                2590
function.posix-getpwnam.php                        24-Jan-2021 12:02                6447
function.posix-getpwuid.php                        24-Jan-2021 12:02                6448
function.posix-getrlimit.php                       24-Jan-2021 12:02                6694
function.posix-getsid.php                          24-Jan-2021 12:02                4422
function.posix-getuid.php                          24-Jan-2021 12:02                2998
function.posix-initgroups.php                      24-Jan-2021 12:02                2920
function.posix-isatty.php                          24-Jan-2021 12:02                3450
function.posix-kill.php                            24-Jan-2021 12:02                3109
function.posix-mkfifo.php                          24-Jan-2021 12:02                3162
function.posix-mknod.php                           24-Jan-2021 12:02                6864
function.posix-setegid.php                         24-Jan-2021 12:02                4936
function.posix-seteuid.php                         24-Jan-2021 12:02                3235
function.posix-setgid.php                          24-Jan-2021 12:02                5142
function.posix-setpgid.php                         24-Jan-2021 12:02                3027
function.posix-setrlimit.php                       24-Jan-2021 12:02                4039
function.posix-setsid.php                          24-Jan-2021 12:02                2154
function.posix-setuid.php                          24-Jan-2021 12:02                5253
function.posix-strerror.php                        24-Jan-2021 12:02                4559
function.posix-times.php                           24-Jan-2021 12:02                4209
function.posix-ttyname.php                         24-Jan-2021 12:02                3011
function.posix-uname.php                           24-Jan-2021 12:02                4336
function.pow.php                                   24-Jan-2021 12:02                7272
function.preg-filter.php                           24-Jan-2021 12:02                8721
function.preg-grep.php                             24-Jan-2021 12:02                5084
function.preg-last-error-msg.php                   24-Jan-2021 12:02                3895
function.preg-last-error.php                       24-Jan-2021 12:02                4086
function.preg-match-all.php                        24-Jan-2021 12:02               24444
function.preg-match.php                            24-Jan-2021 12:02               22258
function.preg-quote.php                            24-Jan-2021 12:02                8275
function.preg-replace-callback-array.php           24-Jan-2021 12:02                9680
function.preg-replace-callback.php                 24-Jan-2021 12:02               15795
function.preg-replace.php                          24-Jan-2021 12:02               21068
function.preg-split.php                            24-Jan-2021 12:02               11593
function.prev.php                                  24-Jan-2021 12:02                7355
function.print-r.php                               24-Jan-2021 12:02                8619
function.print.php                                 24-Jan-2021 12:02                7673
function.printf.php                                24-Jan-2021 12:02                4205
function.proc-close.php                            24-Jan-2021 12:02                3515
function.proc-get-status.php                       24-Jan-2021 12:02                5523
function.proc-nice.php                             24-Jan-2021 12:02                7059
function.proc-open.php                             24-Jan-2021 12:02               15276
function.proc-terminate.php                        24-Jan-2021 12:02                4841
function.property-exists.php                       24-Jan-2021 12:02                8976
function.ps-add-bookmark.php                       24-Jan-2021 12:02                4600
function.ps-add-launchlink.php                     24-Jan-2021 12:02                5055
function.ps-add-locallink.php                      24-Jan-2021 12:02                5763
function.ps-add-note.php                           24-Jan-2021 12:02                6351
function.ps-add-pdflink.php                        24-Jan-2021 12:02                6059
function.ps-add-weblink.php                        24-Jan-2021 12:02                5144
function.ps-arc.php                                24-Jan-2021 12:02                4583
function.ps-arcn.php                               24-Jan-2021 12:02                4588
function.ps-begin-page.php                         24-Jan-2021 12:02                6586
function.ps-begin-pattern.php                      24-Jan-2021 12:02               13021
function.ps-begin-template.php                     24-Jan-2021 12:02               11246
function.ps-circle.php                             24-Jan-2021 12:02                4268
function.ps-clip.php                               24-Jan-2021 12:02                2797
function.ps-close-image.php                        24-Jan-2021 12:02                3658
function.ps-close.php                              24-Jan-2021 12:02                3449
function.ps-closepath-stroke.php                   24-Jan-2021 12:02                2858
function.ps-closepath.php                          24-Jan-2021 12:02                3041
function.ps-continue-text.php                      24-Jan-2021 12:02                3812
function.ps-curveto.php                            24-Jan-2021 12:02                4377
function.ps-delete.php                             24-Jan-2021 12:02                3312
function.ps-end-page.php                           24-Jan-2021 12:02                3036
function.ps-end-pattern.php                        24-Jan-2021 12:02                2964
function.ps-end-template.php                       24-Jan-2021 12:02                2970
function.ps-fill-stroke.php                        24-Jan-2021 12:02                3087
function.ps-fill.php                               24-Jan-2021 12:02                3024
function.ps-findfont.php                           24-Jan-2021 12:02                6631
function.ps-get-buffer.php                         24-Jan-2021 12:02                2997
function.ps-get-parameter.php                      24-Jan-2021 12:02                7466
function.ps-get-value.php                          24-Jan-2021 12:02                9221
function.ps-hyphenate.php                          24-Jan-2021 12:02                7035
function.ps-include-file.php                       24-Jan-2021 12:02                2776
function.ps-lineto.php                             24-Jan-2021 12:02                8069
function.ps-makespotcolor.php                      24-Jan-2021 12:02               10166
function.ps-moveto.php                             24-Jan-2021 12:02                3506
function.ps-new.php                                24-Jan-2021 12:02                2634
function.ps-open-file.php                          24-Jan-2021 12:02                3392
function.ps-open-image-file.php                    24-Jan-2021 12:02                4439
function.ps-open-image.php                         24-Jan-2021 12:02                6144
function.ps-open-memory-image.php                  24-Jan-2021 12:02                2561
function.ps-place-image.php                        24-Jan-2021 12:02                4677
function.ps-rect.php                               24-Jan-2021 12:02                4419
function.ps-restore.php                            24-Jan-2021 12:02                3150
function.ps-rotate.php                             24-Jan-2021 12:02               12235
function.ps-save.php                               24-Jan-2021 12:02                2900
function.ps-scale.php                              24-Jan-2021 12:02                3431
function.ps-set-border-color.php                   24-Jan-2021 12:02                4375
function.ps-set-border-dash.php                    24-Jan-2021 12:02                4127
function.ps-set-border-style.php                   24-Jan-2021 12:02                4188
function.ps-set-info.php                           24-Jan-2021 12:02                5668
function.ps-set-parameter.php                      24-Jan-2021 12:02                3599
function.ps-set-text-pos.php                       24-Jan-2021 12:02                9225
function.ps-set-value.php                          24-Jan-2021 12:02                4439
function.ps-setcolor.php                           24-Jan-2021 12:02                5146
function.ps-setdash.php                            24-Jan-2021 12:02                3301
function.ps-setflat.php                            24-Jan-2021 12:02                2770
function.ps-setfont.php                            24-Jan-2021 12:02                3734
function.ps-setgray.php                            24-Jan-2021 12:02                3024
function.ps-setlinecap.php                         24-Jan-2021 12:02                3577
function.ps-setlinejoin.php                        24-Jan-2021 12:02                3594
function.ps-setlinewidth.php                       24-Jan-2021 12:02                3457
function.ps-setmiterlimit.php                      24-Jan-2021 12:02                3876
function.ps-setoverprintmode.php                   24-Jan-2021 12:02                2798
function.ps-setpolydash.php                        24-Jan-2021 12:02                7625
function.ps-shading-pattern.php                    24-Jan-2021 12:02                3939
function.ps-shading.php                            24-Jan-2021 12:02                6154
function.ps-shfill.php                             24-Jan-2021 12:02                3689
function.ps-show-boxed.php                         24-Jan-2021 12:02               11115
function.ps-show-xy.php                            24-Jan-2021 12:02                3752
function.ps-show-xy2.php                           24-Jan-2021 12:02                2469
function.ps-show.php                               24-Jan-2021 12:02                5514
function.ps-show2.php                              24-Jan-2021 12:02                2958
function.ps-string-geometry.php                    24-Jan-2021 12:02                4452
function.ps-stringwidth.php                        24-Jan-2021 12:02                3918
function.ps-stroke.php                             24-Jan-2021 12:02                3234
function.ps-symbol-name.php                        24-Jan-2021 12:02                3624
function.ps-symbol-width.php                       24-Jan-2021 12:02                4006
function.ps-symbol.php                             24-Jan-2021 12:02                3435
function.ps-translate.php                          24-Jan-2021 12:02               14271
function.pspell-add-to-personal.php                24-Jan-2021 12:02                5286
function.pspell-add-to-session.php                 24-Jan-2021 12:02                2885
function.pspell-check.php                          24-Jan-2021 12:02                3958
function.pspell-clear-session.php                  24-Jan-2021 12:02                4799
function.pspell-config-create.php                  24-Jan-2021 12:02                6877
function.pspell-config-data-dir.php                24-Jan-2021 12:02                2291
function.pspell-config-dict-dir.php                24-Jan-2021 12:02                2290
function.pspell-config-ignore.php                  24-Jan-2021 12:02                4660
function.pspell-config-mode.php                    24-Jan-2021 12:02                5285
function.pspell-config-personal.php                24-Jan-2021 12:02                5399
function.pspell-config-repl.php                    24-Jan-2021 12:02                5715
function.pspell-config-runtogether.php             24-Jan-2021 12:02                5154
function.pspell-config-save-repl.php               24-Jan-2021 12:02                4047
function.pspell-new-config.php                     24-Jan-2021 12:02                4977
function.pspell-new-personal.php                   24-Jan-2021 12:02                9097
function.pspell-new.php                            24-Jan-2021 12:02                7766
function.pspell-save-wordlist.php                  24-Jan-2021 12:02                5122
function.pspell-store-replacement.php              24-Jan-2021 12:02                6695
function.pspell-suggest.php                        24-Jan-2021 12:02                4614
function.putenv.php                                24-Jan-2021 12:01                3655
function.px-close.php                              24-Jan-2021 12:02                3063
function.px-create-fp.php                          24-Jan-2021 12:02                9742
function.px-date2string.php                        24-Jan-2021 12:02                6797
function.px-delete-record.php                      24-Jan-2021 12:02                3180
function.px-delete.php                             24-Jan-2021 12:02                2441
function.px-get-field.php                          24-Jan-2021 12:02                2925
function.px-get-info.php                           24-Jan-2021 12:02                5340
function.px-get-parameter.php                      24-Jan-2021 12:02                3950
function.px-get-record.php                         24-Jan-2021 12:02                4720
function.px-get-schema.php                         24-Jan-2021 12:02                3735
function.px-get-value.php                          24-Jan-2021 12:02                3111
function.px-insert-record.php                      24-Jan-2021 12:02               14256
function.px-new.php                                24-Jan-2021 12:02                6480
function.px-numfields.php                          24-Jan-2021 12:02                2596
function.px-numrecords.php                         24-Jan-2021 12:02                2615
function.px-open-fp.php                            24-Jan-2021 12:02                3832
function.px-put-record.php                         24-Jan-2021 12:02                3682
function.px-retrieve-record.php                    24-Jan-2021 12:02                4805
function.px-set-blob-file.php                      24-Jan-2021 12:02                3980
function.px-set-parameter.php                      24-Jan-2021 12:02                4335
function.px-set-tablename.php                      24-Jan-2021 12:02                3550
function.px-set-targetencoding.php                 24-Jan-2021 12:02                4129
function.px-set-value.php                          24-Jan-2021 12:02                3555
function.px-timestamp2string.php                   24-Jan-2021 12:02                8192
function.px-update-record.php                      24-Jan-2021 12:02                4061
function.quoted-printable-decode.php               24-Jan-2021 12:02                3302
function.quoted-printable-encode.php               24-Jan-2021 12:02                3313
function.quotemeta.php                             24-Jan-2021 12:02                4602
function.rad2deg.php                               24-Jan-2021 12:02                3348
function.radius-acct-open.php                      24-Jan-2021 12:02                2864
function.radius-add-server.php                     24-Jan-2021 12:02                7122
function.radius-auth-open.php                      24-Jan-2021 12:02                2876
function.radius-close.php                          24-Jan-2021 12:02                2051
function.radius-config.php                         24-Jan-2021 12:02                3704
function.radius-create-request.php                 24-Jan-2021 12:02                4878
function.radius-cvt-addr.php                       24-Jan-2021 12:02                6100
function.radius-cvt-int.php                        24-Jan-2021 12:02                5322
function.radius-cvt-string.php                     24-Jan-2021 12:02                5376
function.radius-demangle-mppe-key.php              24-Jan-2021 12:02                2436
function.radius-demangle.php                       24-Jan-2021 12:02                2179
function.radius-get-attr.php                       24-Jan-2021 12:02                6375
function.radius-get-tagged-attr-data.php           24-Jan-2021 12:02                6619
function.radius-get-tagged-attr-tag.php            24-Jan-2021 12:02                6675
function.radius-get-vendor-attr.php                24-Jan-2021 12:02                8396
function.radius-put-addr.php                       24-Jan-2021 12:02                4733
function.radius-put-attr.php                       24-Jan-2021 12:02                8147
function.radius-put-int.php                        24-Jan-2021 12:02                6822
function.radius-put-string.php                     24-Jan-2021 12:02                7207
function.radius-put-vendor-addr.php                24-Jan-2021 12:02                4772
function.radius-put-vendor-attr.php                24-Jan-2021 12:02                6944
function.radius-put-vendor-int.php                 24-Jan-2021 12:02                5400
function.radius-put-vendor-string.php              24-Jan-2021 12:02                5788
function.radius-request-authenticator.php          24-Jan-2021 12:02                2569
function.radius-salt-encrypt-attr.php              24-Jan-2021 12:02                3859
function.radius-send-request.php                   24-Jan-2021 12:02                3207
function.radius-server-secret.php                  24-Jan-2021 12:02                2107
function.radius-strerror.php                       24-Jan-2021 12:02                2052
function.rand.php                                  24-Jan-2021 12:02                6269
function.random-bytes.php                          24-Jan-2021 12:02                6675
function.random-int.php                            24-Jan-2021 12:02                6802
function.range.php                                 24-Jan-2021 12:02                7508
function.rar-wrapper-cache-stats.php               24-Jan-2021 12:02                2103
function.rawurldecode.php                          24-Jan-2021 12:02                4434
function.rawurlencode.php                          24-Jan-2021 12:02                7147
function.read-exif-data.php                        24-Jan-2021 12:02                1600
function.readdir.php                               24-Jan-2021 12:02                9403
function.readfile.php                              24-Jan-2021 12:02                9433
function.readgzfile.php                            24-Jan-2021 12:02                4158
function.readline-add-history.php                  24-Jan-2021 12:02                2478
function.readline-callback-handler-install.php     24-Jan-2021 12:02                9711
function.readline-callback-handler-remove.php      24-Jan-2021 12:02                3345
function.readline-callback-read-char.php           24-Jan-2021 12:02                3434
function.readline-clear-history.php                24-Jan-2021 12:02                1998
function.readline-completion-function.php          24-Jan-2021 12:02                2713
function.readline-info.php                         24-Jan-2021 12:02                3092
function.readline-list-history.php                 24-Jan-2021 12:02                1898
function.readline-on-new-line.php                  24-Jan-2021 12:02                1916
function.readline-read-history.php                 24-Jan-2021 12:02                2458
function.readline-redisplay.php                    24-Jan-2021 12:02                1875
function.readline-write-history.php                24-Jan-2021 12:02                2428
function.readline.php                              24-Jan-2021 12:02                4577
function.readlink.php                              24-Jan-2021 12:02                4392
function.realpath-cache-get.php                    24-Jan-2021 12:02                3766
function.realpath-cache-size.php                   24-Jan-2021 12:02                3309
function.realpath.php                              24-Jan-2021 12:02                7429
function.recode-file.php                           24-Jan-2021 12:02                5336
function.recode-string.php                         24-Jan-2021 12:02                4178
function.recode.php                                24-Jan-2021 12:02                1579
function.register-shutdown-function.php            24-Jan-2021 12:02                7294
function.register-tick-function.php                24-Jan-2021 12:02                6639
function.rename.php                                24-Jan-2021 12:02                5482
function.require-once.php                          24-Jan-2021 12:01                1687
function.require.php                               24-Jan-2021 12:01                1762
function.reset.php                                 24-Jan-2021 12:02                6334
function.restore-error-handler.php                 24-Jan-2021 12:01                5401
function.restore-exception-handler.php             24-Jan-2021 12:01                6491
function.restore-include-path.php                  24-Jan-2021 12:01                4555
function.return.php                                24-Jan-2021 12:01                3802
function.rewind.php                                24-Jan-2021 12:02                6004
function.rewinddir.php                             24-Jan-2021 12:02                2199
function.rmdir.php                                 24-Jan-2021 12:02                4709
function.round.php                                 24-Jan-2021 12:02               12051
function.rpmaddtag.php                             24-Jan-2021 12:02                3008
function.rpmdbinfo.php                             24-Jan-2021 12:02                4583
function.rpmdbsearch.php                           24-Jan-2021 12:02                5261
function.rpminfo.php                               24-Jan-2021 12:02                4773
function.rpmvercmp.php                             24-Jan-2021 12:02                2446
function.rrd-create.php                            24-Jan-2021 12:02                2541
function.rrd-error.php                             24-Jan-2021 12:02                1892
function.rrd-fetch.php                             24-Jan-2021 12:02                2646
function.rrd-first.php                             24-Jan-2021 12:02                2568
function.rrd-graph.php                             24-Jan-2021 12:02                2819
function.rrd-info.php                              24-Jan-2021 12:02                2200
function.rrd-last.php                              24-Jan-2021 12:02                2206
function.rrd-lastupdate.php                        24-Jan-2021 12:02                2325
function.rrd-restore.php                           24-Jan-2021 12:02                2860
function.rrd-tune.php                              24-Jan-2021 12:02                2598
function.rrd-update.php                            24-Jan-2021 12:02                2677
function.rrd-version.php                           24-Jan-2021 12:02                1984
function.rrd-xport.php                             24-Jan-2021 12:02                2380
function.rrdc-disconnect.php                       24-Jan-2021 12:02                2362
function.rsort.php                                 24-Jan-2021 12:02                5913
function.rtrim.php                                 24-Jan-2021 12:02                9394
function.runkit7-constant-add.php                  24-Jan-2021 12:01                4077
function.runkit7-constant-redefine.php             24-Jan-2021 12:01                3958
function.runkit7-constant-remove.php               24-Jan-2021 12:01                3285
function.runkit7-function-add.php                  24-Jan-2021 12:01                8339
function.runkit7-function-copy.php                 24-Jan-2021 12:01                5120
function.runkit7-function-redefine.php             24-Jan-2021 12:01                8712
function.runkit7-function-remove.php               24-Jan-2021 12:01                3740
function.runkit7-function-rename.php               24-Jan-2021 12:01                3961
function.runkit7-import.php                        24-Jan-2021 12:01                3194
function.runkit7-method-add.php                    24-Jan-2021 12:01               10170
function.runkit7-method-copy.php                   24-Jan-2021 12:01                6707
function.runkit7-method-redefine.php               24-Jan-2021 12:01               10631
function.runkit7-method-remove.php                 24-Jan-2021 12:01                6304
function.runkit7-method-rename.php                 24-Jan-2021 12:01                6309
function.runkit7-object-id.php                     24-Jan-2021 12:01                2947
function.runkit7-superglobals.php                  24-Jan-2021 12:01                2417
function.runkit7-zval-inspect.php                  24-Jan-2021 12:01                2034
function.sapi-windows-cp-conv.php                  24-Jan-2021 12:02                4090
function.sapi-windows-cp-get.php                   24-Jan-2021 12:02                3208
function.sapi-windows-cp-is-utf8.php               24-Jan-2021 12:02                2514
function.sapi-windows-cp-set.php                   24-Jan-2021 12:02                2696
function.sapi-windows-generate-ctrl-event.php      24-Jan-2021 12:02                7497
function.sapi-windows-set-ctrl-handler.php         24-Jan-2021 12:02                7190
function.sapi-windows-vt100-support.php            24-Jan-2021 12:02                9010
function.scandir.php                               24-Jan-2021 12:02               10138
function.scoutapm-get-calls.php                    24-Jan-2021 12:02                4197
function.scoutapm-list-instrumented-functions.php  24-Jan-2021 12:02                3519
function.seaslog-get-author.php                    24-Jan-2021 12:02                2862
function.seaslog-get-version.php                   24-Jan-2021 12:02                2848
function.sem-acquire.php                           24-Jan-2021 12:02                4651
function.sem-get.php                               24-Jan-2021 12:02                6319
function.sem-release.php                           24-Jan-2021 12:02                3873
function.sem-remove.php                            24-Jan-2021 12:02                3855
function.serialize.php                             24-Jan-2021 12:02                6898
function.session-abort.php                         24-Jan-2021 12:02                3642
function.session-cache-expire.php                  24-Jan-2021 12:02                6534
function.session-cache-limiter.php                 24-Jan-2021 12:02                7900
function.session-commit.php                        24-Jan-2021 12:02                1682
function.session-create-id.php                     24-Jan-2021 12:02               10803
function.session-decode.php                        24-Jan-2021 12:02                3413
function.session-destroy.php                       24-Jan-2021 12:02                9182
function.session-encode.php                        24-Jan-2021 12:02                3297
function.session-gc.php                            24-Jan-2021 12:02                7786
function.session-get-cookie-params.php             24-Jan-2021 12:02                4688
function.session-id.php                            24-Jan-2021 12:02                4789
function.session-is-registered.php                 24-Jan-2021 12:02                4052
function.session-module-name.php                   24-Jan-2021 12:02                3421
function.session-name.php                          24-Jan-2021 12:02                6938
function.session-regenerate-id.php                 24-Jan-2021 12:02               17277
function.session-register-shutdown.php             24-Jan-2021 12:02                2487
function.session-register.php                      24-Jan-2021 12:02                9715
function.session-reset.php                         24-Jan-2021 12:02                3714
function.session-save-path.php                     24-Jan-2021 12:02                3467
function.session-set-cookie-params.php             24-Jan-2021 12:02                8739
function.session-set-save-handler.php              24-Jan-2021 12:02               29652
function.session-start.php                         24-Jan-2021 12:02               14773
function.session-status.php                        24-Jan-2021 12:02                2707
function.session-unregister.php                    24-Jan-2021 12:02                4642
function.session-unset.php                         24-Jan-2021 12:02                3003
function.session-write-close.php                   24-Jan-2021 12:02                3474
function.set-error-handler.php                     24-Jan-2021 12:01               26848
function.set-exception-handler.php                 24-Jan-2021 12:01                8208
function.set-file-buffer.php                       24-Jan-2021 12:02                1643
function.set-include-path.php                      24-Jan-2021 12:01                5751
function.set-time-limit.php                        24-Jan-2021 12:01                4161
function.setcookie.php                             24-Jan-2021 12:02               23947
function.setlocale.php                             24-Jan-2021 12:02               14626
function.setproctitle.php                          24-Jan-2021 12:02                4372
function.setrawcookie.php                          24-Jan-2021 12:02                4369
function.setthreadtitle.php                        24-Jan-2021 12:02                4106
function.settype.php                               24-Jan-2021 12:02                6323
function.sha1-file.php                             24-Jan-2021 12:02                5358
function.sha1.php                                  24-Jan-2021 12:02                5519
function.shell-exec.php                            24-Jan-2021 12:02                4713
function.shm-attach.php                            24-Jan-2021 12:02                5296
function.shm-detach.php                            24-Jan-2021 12:02                4110
function.shm-get-var.php                           24-Jan-2021 12:02                4076
function.shm-has-var.php                           24-Jan-2021 12:02                3896
function.shm-put-var.php                           24-Jan-2021 12:02                4941
function.shm-remove-var.php                        24-Jan-2021 12:02                3769
function.shm-remove.php                            24-Jan-2021 12:02                3535
function.shmop-close.php                           24-Jan-2021 12:02                4129
function.shmop-delete.php                          24-Jan-2021 12:02                3855
function.shmop-open.php                            24-Jan-2021 12:02                7854
function.shmop-read.php                            24-Jan-2021 12:02                5081
function.shmop-size.php                            24-Jan-2021 12:02                3986
function.shmop-write.php                           24-Jan-2021 12:02                5263
function.show-source.php                           24-Jan-2021 12:02                1604
function.shuffle.php                               24-Jan-2021 12:02                5505
function.similar-text.php                          24-Jan-2021 12:02                3798
function.simplexml-import-dom.php                  24-Jan-2021 12:02                6561
function.simplexml-load-file.php                   24-Jan-2021 12:02               10077
function.simplexml-load-string.php                 24-Jan-2021 12:02                9403
function.sin.php                                   24-Jan-2021 12:02                4487
function.sinh.php                                  24-Jan-2021 12:02                2980
function.sizeof.php                                24-Jan-2021 12:02                1508
function.sleep.php                                 24-Jan-2021 12:02                5491
function.snmp-get-quick-print.php                  24-Jan-2021 12:02                2888
function.snmp-get-valueretrieval.php               24-Jan-2021 12:02                4003
function.snmp-read-mib.php                         24-Jan-2021 12:02                4258
function.snmp-set-enum-print.php                   24-Jan-2021 12:02                4252
function.snmp-set-oid-numeric-print.php            24-Jan-2021 12:02                2364
function.snmp-set-oid-output-format.php            24-Jan-2021 12:02                6781
function.snmp-set-quick-print.php                  24-Jan-2021 12:02                4843
function.snmp-set-valueretrieval.php               24-Jan-2021 12:02                8716
function.snmp2-get.php                             24-Jan-2021 12:02                5314
function.snmp2-getnext.php                         24-Jan-2021 12:02                5685
function.snmp2-real-walk.php                       24-Jan-2021 12:02                5855
function.snmp2-set.php                             24-Jan-2021 12:02               10080
function.snmp2-walk.php                            24-Jan-2021 12:02                6385
function.snmp3-get.php                             24-Jan-2021 12:02                7218
function.snmp3-getnext.php                         24-Jan-2021 12:02                7553
function.snmp3-real-walk.php                       24-Jan-2021 12:02                7951
function.snmp3-set.php                             24-Jan-2021 12:02               12521
function.snmp3-walk.php                            24-Jan-2021 12:02                8410
function.snmpget.php                               24-Jan-2021 12:02                3266
function.snmpgetnext.php                           24-Jan-2021 12:02                5569
function.snmprealwalk.php                          24-Jan-2021 12:02                5592
function.snmpset.php                               24-Jan-2021 12:02                2914
function.snmpwalk.php                              24-Jan-2021 12:02                4448
function.snmpwalkoid.php                           24-Jan-2021 12:02                5407
function.socket-accept.php                         24-Jan-2021 12:02                6247
function.socket-addrinfo-bind.php                  24-Jan-2021 12:02                4797
function.socket-addrinfo-connect.php               24-Jan-2021 12:02                4587
function.socket-addrinfo-explain.php               24-Jan-2021 12:02                4114
function.socket-addrinfo-lookup.php                24-Jan-2021 12:02                5256
function.socket-bind.php                           24-Jan-2021 12:02               10007
function.socket-clear-error.php                    24-Jan-2021 12:02                3366
function.socket-close.php                          24-Jan-2021 12:02                3627
function.socket-cmsg-space.php                     24-Jan-2021 12:02                3339
function.socket-connect.php                        24-Jan-2021 12:02                5663
function.socket-create-listen.php                  24-Jan-2021 12:02                6630
function.socket-create-pair.php                    24-Jan-2021 12:02               20257
function.socket-create.php                         24-Jan-2021 12:02               10232
function.socket-export-stream.php                  24-Jan-2021 12:02                3077
function.socket-get-option.php                     24-Jan-2021 12:02               22355
function.socket-get-status.php                     24-Jan-2021 12:02                1678
function.socket-getopt.php                         24-Jan-2021 12:02                1662
function.socket-getpeername.php                    24-Jan-2021 12:02                7394
function.socket-getsockname.php                    24-Jan-2021 12:02                6710
function.socket-import-stream.php                  24-Jan-2021 12:02                4822
function.socket-last-error.php                     24-Jan-2021 12:02                6910
function.socket-listen.php                         24-Jan-2021 12:02                6785
function.socket-read.php                           24-Jan-2021 12:02                7325
function.socket-recv.php                           24-Jan-2021 12:02               15522
function.socket-recvfrom.php                       24-Jan-2021 12:02               12736
function.socket-recvmsg.php                        24-Jan-2021 12:02                3966
function.socket-select.php                         24-Jan-2021 12:02               15116
function.socket-send.php                           24-Jan-2021 12:02                5959
function.socket-sendmsg.php                        24-Jan-2021 12:02                4047
function.socket-sendto.php                         24-Jan-2021 12:02                9143
function.socket-set-block.php                      24-Jan-2021 12:02                5702
function.socket-set-blocking.php                   24-Jan-2021 12:02                1696
function.socket-set-nonblock.php                   24-Jan-2021 12:02                6059
function.socket-set-option.php                     24-Jan-2021 12:02               11125
function.socket-set-timeout.php                    24-Jan-2021 12:02                1665
function.socket-setopt.php                         24-Jan-2021 12:02                1656
function.socket-shutdown.php                       24-Jan-2021 12:02                4475
function.socket-strerror.php                       24-Jan-2021 12:02                7084
function.socket-write.php                          24-Jan-2021 12:02                6790
function.socket-wsaprotocol-info-export.php        24-Jan-2021 12:02                4581
function.socket-wsaprotocol-info-import.php        24-Jan-2021 12:02                4001
function.socket-wsaprotocol-info-release.php       24-Jan-2021 12:02                3270
function.sodium-add.php                            24-Jan-2021 12:02                2480
function.sodium-base642bin.php                     24-Jan-2021 12:02                2749
function.sodium-bin2base64.php                     24-Jan-2021 12:02                2478
function.sodium-bin2hex.php                        24-Jan-2021 12:02                2241
function.sodium-compare.php                        24-Jan-2021 12:02                2511
function.sodium-crypto-aead-aes256gcm-decrypt.php  24-Jan-2021 12:02                3301
function.sodium-crypto-aead-aes256gcm-encrypt.php  24-Jan-2021 12:02                3259
function.sodium-crypto-aead-aes256gcm-is-availa..> 24-Jan-2021 12:02                2382
function.sodium-crypto-aead-aes256gcm-keygen.php   24-Jan-2021 12:02                2343
function.sodium-crypto-aead-chacha20poly1305-de..> 24-Jan-2021 12:02                3423
function.sodium-crypto-aead-chacha20poly1305-en..> 24-Jan-2021 12:02                3323
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Jan-2021 12:02                3494
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Jan-2021 12:02                3376
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Jan-2021 12:02                2463
function.sodium-crypto-aead-chacha20poly1305-ke..> 24-Jan-2021 12:02                2430
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Jan-2021 12:02                3467
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Jan-2021 12:02                3383
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Jan-2021 12:02                2427
function.sodium-crypto-auth-keygen.php             24-Jan-2021 12:02                2231
function.sodium-crypto-auth-verify.php             24-Jan-2021 12:02                2839
function.sodium-crypto-auth.php                    24-Jan-2021 12:02                2608
function.sodium-crypto-box-keypair-from-secretk..> 24-Jan-2021 12:02                2862
function.sodium-crypto-box-keypair.php             24-Jan-2021 12:02                2274
function.sodium-crypto-box-open.php                24-Jan-2021 12:02                2957
function.sodium-crypto-box-publickey-from-secre..> 24-Jan-2021 12:02                2527
function.sodium-crypto-box-publickey.php           24-Jan-2021 12:02                2428
function.sodium-crypto-box-seal-open.php           24-Jan-2021 12:02                2728
function.sodium-crypto-box-seal.php                24-Jan-2021 12:02                2592
function.sodium-crypto-box-secretkey.php           24-Jan-2021 12:02                2394
function.sodium-crypto-box-seed-keypair.php        24-Jan-2021 12:02                2441
function.sodium-crypto-box.php                     24-Jan-2021 12:02                2790
function.sodium-crypto-generichash-final.php       24-Jan-2021 12:02                2756
function.sodium-crypto-generichash-init.php        24-Jan-2021 12:02                2812
function.sodium-crypto-generichash-keygen.php      24-Jan-2021 12:02                2272
function.sodium-crypto-generichash-update.php      24-Jan-2021 12:02                2695
function.sodium-crypto-generichash.php             24-Jan-2021 12:02                3012
function.sodium-crypto-kdf-derive-from-key.php     24-Jan-2021 12:02                3145
function.sodium-crypto-kdf-keygen.php              24-Jan-2021 12:02                2214
function.sodium-crypto-kx-client-session-keys.php  24-Jan-2021 12:02                2719
function.sodium-crypto-kx-keypair.php              24-Jan-2021 12:02                4786
function.sodium-crypto-kx-publickey.php            24-Jan-2021 12:02                2381
function.sodium-crypto-kx-secretkey.php            24-Jan-2021 12:02                2391
function.sodium-crypto-kx-seed-keypair.php         24-Jan-2021 12:02                2424
function.sodium-crypto-kx-server-session-keys.php  24-Jan-2021 12:02                2785
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Jan-2021 12:02                2955
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Jan-2021 12:02                3116
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Jan-2021 12:02                3517
function.sodium-crypto-pwhash-str-needs-rehash.php 24-Jan-2021 12:02                2986
function.sodium-crypto-pwhash-str-verify.php       24-Jan-2021 12:02                4388
function.sodium-crypto-pwhash-str.php              24-Jan-2021 12:02                7801
function.sodium-crypto-pwhash.php                  24-Jan-2021 12:02                8832
function.sodium-crypto-scalarmult-base.php         24-Jan-2021 12:02                1851
function.sodium-crypto-scalarmult.php              24-Jan-2021 12:02                2666
function.sodium-crypto-secretbox-keygen.php        24-Jan-2021 12:02                2234
function.sodium-crypto-secretbox-open.php          24-Jan-2021 12:02                2973
function.sodium-crypto-secretbox.php               24-Jan-2021 12:02                2876
function.sodium-crypto-secretstream-xchacha20po..> 24-Jan-2021 12:02                2908
function.sodium-crypto-secretstream-xchacha20po..> 24-Jan-2021 12:02                2732
function.sodium-crypto-secretstream-xchacha20po..> 24-Jan-2021 12:02                2512
function.sodium-crypto-secretstream-xchacha20po..> 24-Jan-2021 12:02                3318
function.sodium-crypto-secretstream-xchacha20po..> 24-Jan-2021 12:02                3565
function.sodium-crypto-secretstream-xchacha20po..> 24-Jan-2021 12:02                2689
function.sodium-crypto-shorthash-keygen.php        24-Jan-2021 12:02                2276
function.sodium-crypto-shorthash.php               24-Jan-2021 12:02                2628
function.sodium-crypto-sign-detached.php           24-Jan-2021 12:02                2664
function.sodium-crypto-sign-ed25519-pk-to-curve..> 24-Jan-2021 12:02                2623
function.sodium-crypto-sign-ed25519-sk-to-curve..> 24-Jan-2021 12:02                2679
function.sodium-crypto-sign-keypair-from-secret..> 24-Jan-2021 12:02                2923
function.sodium-crypto-sign-keypair.php            24-Jan-2021 12:02                2287
function.sodium-crypto-sign-open.php               24-Jan-2021 12:02                2765
function.sodium-crypto-sign-publickey-from-secr..> 24-Jan-2021 12:02                2571
function.sodium-crypto-sign-publickey.php          24-Jan-2021 12:02                2441
function.sodium-crypto-sign-secretkey.php          24-Jan-2021 12:02                2417
function.sodium-crypto-sign-seed-keypair.php       24-Jan-2021 12:02                2486
function.sodium-crypto-sign-verify-detached.php    24-Jan-2021 12:02                2944
function.sodium-crypto-sign.php                    24-Jan-2021 12:02                2571
function.sodium-crypto-stream-keygen.php           24-Jan-2021 12:02                2187
function.sodium-crypto-stream-xor.php              24-Jan-2021 12:02                2815
function.sodium-crypto-stream.php                  24-Jan-2021 12:02                2793
function.sodium-hex2bin.php                        24-Jan-2021 12:02                2985
function.sodium-increment.php                      24-Jan-2021 12:02                2292
function.sodium-memcmp.php                         24-Jan-2021 12:02                2475
function.sodium-memzero.php                        24-Jan-2021 12:02                2268
function.sodium-pad.php                            24-Jan-2021 12:02                2418
function.sodium-unpad.php                          24-Jan-2021 12:02                2434
function.solr-get-version.php                      24-Jan-2021 12:02                3623
function.sort.php                                  24-Jan-2021 12:02               11040
function.soundex.php                               24-Jan-2021 12:02                7121
function.spl-autoload-call.php                     24-Jan-2021 12:02                2410
function.spl-autoload-extensions.php               24-Jan-2021 12:02                3986
function.spl-autoload-functions.php                24-Jan-2021 12:02                2310
function.spl-autoload-register.php                 24-Jan-2021 12:02               10168
function.spl-autoload-unregister.php               24-Jan-2021 12:02                2851
function.spl-autoload.php                          24-Jan-2021 12:02                2889
function.spl-classes.php                           24-Jan-2021 12:02                3507
function.spl-object-hash.php                       24-Jan-2021 12:02                3735
function.spl-object-id.php                         24-Jan-2021 12:02                3935
function.split.php                                 24-Jan-2021 12:02                8198
function.spliti.php                                24-Jan-2021 12:02                7496
function.sprintf.php                               24-Jan-2021 12:02               25264
function.sql-regcase.php                           24-Jan-2021 12:02                3891
function.sqlsrv-begin-transaction.php              24-Jan-2021 12:02               11905
function.sqlsrv-cancel.php                         24-Jan-2021 12:02               10643
function.sqlsrv-client-info.php                    24-Jan-2021 12:02                6788
function.sqlsrv-close.php                          24-Jan-2021 12:02                5437
function.sqlsrv-commit.php                         24-Jan-2021 12:02               11781
function.sqlsrv-configure.php                      24-Jan-2021 12:02                4354
function.sqlsrv-connect.php                        24-Jan-2021 12:02               12615
function.sqlsrv-errors.php                         24-Jan-2021 12:02               10551
function.sqlsrv-execute.php                        24-Jan-2021 12:02               10734
function.sqlsrv-fetch-array.php                    24-Jan-2021 12:02               15010
function.sqlsrv-fetch-object.php                   24-Jan-2021 12:02               12213
function.sqlsrv-fetch.php                          24-Jan-2021 12:02               11080
function.sqlsrv-field-metadata.php                 24-Jan-2021 12:02                8900
function.sqlsrv-free-stmt.php                      24-Jan-2021 12:02                7639
function.sqlsrv-get-config.php                     24-Jan-2021 12:02                3146
function.sqlsrv-get-field.php                      24-Jan-2021 12:02               10594
function.sqlsrv-has-rows.php                       24-Jan-2021 12:02                6347
function.sqlsrv-next-result.php                    24-Jan-2021 12:02                9512
function.sqlsrv-num-fields.php                     24-Jan-2021 12:02                8466
function.sqlsrv-num-rows.php                       24-Jan-2021 12:02                7983
function.sqlsrv-prepare.php                        24-Jan-2021 12:02               14736
function.sqlsrv-query.php                          24-Jan-2021 12:02               11476
function.sqlsrv-rollback.php                       24-Jan-2021 12:02               11249
function.sqlsrv-rows-affected.php                  24-Jan-2021 12:02                8005
function.sqlsrv-send-stream-data.php               24-Jan-2021 12:02                8845
function.sqlsrv-server-info.php                    24-Jan-2021 12:02                6199
function.sqrt.php                                  24-Jan-2021 12:02                3663
function.srand.php                                 24-Jan-2021 12:02                5733
function.sscanf.php                                24-Jan-2021 12:02               10312
function.ssdeep-fuzzy-compare.php                  24-Jan-2021 12:02                2919
function.ssdeep-fuzzy-hash-filename.php            24-Jan-2021 12:02                2688
function.ssdeep-fuzzy-hash.php                     24-Jan-2021 12:02                2541
function.ssh2-auth-agent.php                       24-Jan-2021 12:02                4444
function.ssh2-auth-hostbased-file.php              24-Jan-2021 12:02                7441
function.ssh2-auth-none.php                        24-Jan-2021 12:02                4706
function.ssh2-auth-password.php                    24-Jan-2021 12:02                4657
function.ssh2-auth-pubkey-file.php                 24-Jan-2021 12:02                6913
function.ssh2-connect.php                          24-Jan-2021 12:02               15533
function.ssh2-disconnect.php                       24-Jan-2021 12:02                2763
function.ssh2-exec.php                             24-Jan-2021 12:02                6779
function.ssh2-fetch-stream.php                     24-Jan-2021 12:02                5277
function.ssh2-fingerprint.php                      24-Jan-2021 12:02                5194
function.ssh2-forward-accept.php                   24-Jan-2021 12:02                2707
function.ssh2-forward-listen.php                   24-Jan-2021 12:02                3896
function.ssh2-methods-negotiated.php               24-Jan-2021 12:02                8016
function.ssh2-poll.php                             24-Jan-2021 12:02                3237
function.ssh2-publickey-add.php                    24-Jan-2021 12:02                7747
function.ssh2-publickey-init.php                   24-Jan-2021 12:02                4279
function.ssh2-publickey-list.php                   24-Jan-2021 12:02                8694
function.ssh2-publickey-remove.php                 24-Jan-2021 12:02                4243
function.ssh2-scp-recv.php                         24-Jan-2021 12:02                5089
function.ssh2-scp-send.php                         24-Jan-2021 12:02                5546
function.ssh2-sftp-chmod.php                       24-Jan-2021 12:02                5624
function.ssh2-sftp-lstat.php                       24-Jan-2021 12:02                7167
function.ssh2-sftp-mkdir.php                       24-Jan-2021 12:02                6173
function.ssh2-sftp-readlink.php                    24-Jan-2021 12:02                5153
function.ssh2-sftp-realpath.php                    24-Jan-2021 12:02                5385
function.ssh2-sftp-rename.php                      24-Jan-2021 12:02                5183
function.ssh2-sftp-rmdir.php                       24-Jan-2021 12:02                5250
function.ssh2-sftp-stat.php                        24-Jan-2021 12:02                7066
function.ssh2-sftp-symlink.php                     24-Jan-2021 12:02                5387
function.ssh2-sftp-unlink.php                      24-Jan-2021 12:02                4694
function.ssh2-sftp.php                             24-Jan-2021 12:02                5260
function.ssh2-shell.php                            24-Jan-2021 12:02                6898
function.ssh2-tunnel.php                           24-Jan-2021 12:02                5079
function.stat.php                                  24-Jan-2021 12:02               13235
function.stats-absolute-deviation.php              24-Jan-2021 12:02                2528
function.stats-cdf-beta.php                        24-Jan-2021 12:02                4694
function.stats-cdf-binomial.php                    24-Jan-2021 12:02                4675
function.stats-cdf-cauchy.php                      24-Jan-2021 12:02                4712
function.stats-cdf-chisquare.php                   24-Jan-2021 12:02                4191
function.stats-cdf-exponential.php                 24-Jan-2021 12:02                4220
function.stats-cdf-f.php                           24-Jan-2021 12:02                4622
function.stats-cdf-gamma.php                       24-Jan-2021 12:02                4677
function.stats-cdf-laplace.php                     24-Jan-2021 12:02                4696
function.stats-cdf-logistic.php                    24-Jan-2021 12:02                4730
function.stats-cdf-negative-binomial.php           24-Jan-2021 12:02                4809
function.stats-cdf-noncentral-chisquare.php        24-Jan-2021 12:02                4908
function.stats-cdf-noncentral-f.php                24-Jan-2021 12:02                5413
function.stats-cdf-noncentral-t.php                24-Jan-2021 12:02                4776
function.stats-cdf-normal.php                      24-Jan-2021 12:02                4714
function.stats-cdf-poisson.php                     24-Jan-2021 12:02                4158
function.stats-cdf-t.php                           24-Jan-2021 12:02                4092
function.stats-cdf-uniform.php                     24-Jan-2021 12:02                4676
function.stats-cdf-weibull.php                     24-Jan-2021 12:02                4713
function.stats-covariance.php                      24-Jan-2021 12:02                2686
function.stats-dens-beta.php                       24-Jan-2021 12:02                3123
function.stats-dens-cauchy.php                     24-Jan-2021 12:02                3179
function.stats-dens-chisquare.php                  24-Jan-2021 12:02                2896
function.stats-dens-exponential.php                24-Jan-2021 12:02                2884
function.stats-dens-f.php                          24-Jan-2021 12:02                3124
function.stats-dens-gamma.php                      24-Jan-2021 12:02                3173
function.stats-dens-laplace.php                    24-Jan-2021 12:02                3205
function.stats-dens-logistic.php                   24-Jan-2021 12:02                3216
function.stats-dens-normal.php                     24-Jan-2021 12:02                3189
function.stats-dens-pmf-binomial.php               24-Jan-2021 12:02                3237
function.stats-dens-pmf-hypergeometric.php         24-Jan-2021 12:02                3720
function.stats-dens-pmf-negative-binomial.php      24-Jan-2021 12:02                3357
function.stats-dens-pmf-poisson.php                24-Jan-2021 12:02                2885
function.stats-dens-t.php                          24-Jan-2021 12:02                2808
function.stats-dens-uniform.php                    24-Jan-2021 12:02                3153
function.stats-dens-weibull.php                    24-Jan-2021 12:02                3185
function.stats-harmonic-mean.php                   24-Jan-2021 12:02                2523
function.stats-kurtosis.php                        24-Jan-2021 12:02                2445
function.stats-rand-gen-beta.php                   24-Jan-2021 12:02                2748
function.stats-rand-gen-chisquare.php              24-Jan-2021 12:02                2466
function.stats-rand-gen-exponential.php            24-Jan-2021 12:02                2462
function.stats-rand-gen-f.php                      24-Jan-2021 12:02                2805
function.stats-rand-gen-funiform.php               24-Jan-2021 12:02                2725
function.stats-rand-gen-gamma.php                  24-Jan-2021 12:02                2814
function.stats-rand-gen-ibinomial-negative.php     24-Jan-2021 12:02                2881
function.stats-rand-gen-ibinomial.php              24-Jan-2021 12:02                2814
function.stats-rand-gen-int.php                    24-Jan-2021 12:02                1907
function.stats-rand-gen-ipoisson.php               24-Jan-2021 12:02                2444
function.stats-rand-gen-iuniform.php               24-Jan-2021 12:02                2792
function.stats-rand-gen-noncentral-chisquare.php   24-Jan-2021 12:02                2921
function.stats-rand-gen-noncentral-f.php           24-Jan-2021 12:02                3232
function.stats-rand-gen-noncentral-t.php           24-Jan-2021 12:02                2842
function.stats-rand-gen-normal.php                 24-Jan-2021 12:02                2761
function.stats-rand-gen-t.php                      24-Jan-2021 12:02                2366
function.stats-rand-get-seeds.php                  24-Jan-2021 12:02                1945
function.stats-rand-phrase-to-seeds.php            24-Jan-2021 12:02                2447
function.stats-rand-ranf.php                       24-Jan-2021 12:02                1957
function.stats-rand-setall.php                     24-Jan-2021 12:02                2710
function.stats-skew.php                            24-Jan-2021 12:02                2415
function.stats-standard-deviation.php              24-Jan-2021 12:02                3299
function.stats-stat-binomial-coef.php              24-Jan-2021 12:02                2703
function.stats-stat-correlation.php                24-Jan-2021 12:02                2860
function.stats-stat-factorial.php                  24-Jan-2021 12:02                2330
function.stats-stat-independent-t.php              24-Jan-2021 12:02                2939
function.stats-stat-innerproduct.php               24-Jan-2021 12:02                2801
function.stats-stat-paired-t.php                   24-Jan-2021 12:02                2742
function.stats-stat-percentile.php                 24-Jan-2021 12:02                2658
function.stats-stat-powersum.php                   24-Jan-2021 12:02                2652
function.stats-variance.php                        24-Jan-2021 12:02                2869
function.stomp-connect-error.php                   24-Jan-2021 12:02                3462
function.stomp-version.php                         24-Jan-2021 12:02                2895
function.str-contains.php                          24-Jan-2021 12:02                8290
function.str-ends-with.php                         24-Jan-2021 12:02                8164
function.str-getcsv.php                            24-Jan-2021 12:02                3776
function.str-ireplace.php                          24-Jan-2021 12:02                7935
function.str-pad.php                               24-Jan-2021 12:02                7448
function.str-repeat.php                            24-Jan-2021 12:02                4395
function.str-replace.php                           24-Jan-2021 12:02               17088
function.str-rot13.php                             24-Jan-2021 12:02                3340
function.str-shuffle.php                           24-Jan-2021 12:02                5202
function.str-split.php                             24-Jan-2021 12:02                6682
function.str-starts-with.php                       24-Jan-2021 12:02                8192
function.str-word-count.php                        24-Jan-2021 12:02                8245
function.strcasecmp.php                            24-Jan-2021 12:02                5443
function.strchr.php                                24-Jan-2021 12:02                1529
function.strcmp.php                                24-Jan-2021 12:02                5324
function.strcoll.php                               24-Jan-2021 12:02                5330
function.strcspn.php                               24-Jan-2021 12:02                6493
function.stream-bucket-append.php                  24-Jan-2021 12:02                1976
function.stream-bucket-make-writeable.php          24-Jan-2021 12:02                1929
function.stream-bucket-new.php                     24-Jan-2021 12:02                1978
function.stream-bucket-prepend.php                 24-Jan-2021 12:02                6495
function.stream-context-create.php                 24-Jan-2021 12:02                7002
function.stream-context-get-default.php            24-Jan-2021 12:02                8541
function.stream-context-get-options.php            24-Jan-2021 12:02                4297
function.stream-context-get-params.php             24-Jan-2021 12:02                5202
function.stream-context-set-default.php            24-Jan-2021 12:02                6303
function.stream-context-set-option.php             24-Jan-2021 12:02                4166
function.stream-context-set-params.php             24-Jan-2021 12:02                4427
function.stream-copy-to-stream.php                 24-Jan-2021 12:02                6542
function.stream-filter-append.php                  24-Jan-2021 12:02               10669
function.stream-filter-prepend.php                 24-Jan-2021 12:02                7429
function.stream-filter-register.php                24-Jan-2021 12:02               19604
function.stream-filter-remove.php                  24-Jan-2021 12:02                6429
function.stream-get-contents.php                   24-Jan-2021 12:02                8037
function.stream-get-filters.php                    24-Jan-2021 12:02                3668
function.stream-get-line.php                       24-Jan-2021 12:02                4599
function.stream-get-meta-data.php                  24-Jan-2021 12:02                6444
function.stream-get-transports.php                 24-Jan-2021 12:02                3639
function.stream-get-wrappers.php                   24-Jan-2021 12:02                4535
function.stream-is-local.php                       24-Jan-2021 12:02                3761
function.stream-isatty.php                         24-Jan-2021 12:02                3654
function.stream-notification-callback.php          24-Jan-2021 12:02               24932
function.stream-register-wrapper.php               24-Jan-2021 12:02                1775
function.stream-resolve-include-path.php           24-Jan-2021 12:02                3972
function.stream-select.php                         24-Jan-2021 12:02               14618
function.stream-set-blocking.php                   24-Jan-2021 12:02                4735
function.stream-set-chunk-size.php                 24-Jan-2021 12:02                3130
function.stream-set-read-buffer.php                24-Jan-2021 12:02                3449
function.stream-set-timeout.php                    24-Jan-2021 12:02                8019
function.stream-set-write-buffer.php               24-Jan-2021 12:02                5745
function.stream-socket-accept.php                  24-Jan-2021 12:02                6533
function.stream-socket-client.php                  24-Jan-2021 12:02               15925
function.stream-socket-enable-crypto.php           24-Jan-2021 12:02               11427
function.stream-socket-get-name.php                24-Jan-2021 12:02                3295
function.stream-socket-pair.php                    24-Jan-2021 12:02                9332
function.stream-socket-recvfrom.php                24-Jan-2021 12:02               10249
function.stream-socket-sendto.php                  24-Jan-2021 12:02                6929
function.stream-socket-server.php                  24-Jan-2021 12:02               14190
function.stream-socket-shutdown.php                24-Jan-2021 12:02                6076
function.stream-supports-lock.php                  24-Jan-2021 12:02                2885
function.stream-wrapper-register.php               24-Jan-2021 12:02                9441
function.stream-wrapper-restore.php                24-Jan-2021 12:02                2579
function.stream-wrapper-unregister.php             24-Jan-2021 12:02                2777
function.strftime.php                              24-Jan-2021 12:02               58298
function.strip-tags.php                            24-Jan-2021 12:02                7994
function.stripcslashes.php                         24-Jan-2021 12:02                2851
function.stripos.php                               24-Jan-2021 12:02                9825
function.stripslashes.php                          24-Jan-2021 12:02                7957
function.stristr.php                               24-Jan-2021 12:02                9346
function.strlen.php                                24-Jan-2021 12:02                5499
function.strnatcasecmp.php                         24-Jan-2021 12:02                4948
function.strnatcmp.php                             24-Jan-2021 12:02                7922
function.strncasecmp.php                           24-Jan-2021 12:02                4473
function.strncmp.php                               24-Jan-2021 12:02                4448
function.strpbrk.php                               24-Jan-2021 12:02                4968
function.strpos.php                                24-Jan-2021 12:02               12755
function.strptime.php                              24-Jan-2021 12:02                9420
function.strrchr.php                               24-Jan-2021 12:02                6394
function.strrev.php                                24-Jan-2021 12:02                3004
function.strripos.php                              24-Jan-2021 12:02                7954
function.strrpos.php                               24-Jan-2021 12:02                9568
function.strspn.php                                24-Jan-2021 12:02                8533
function.strstr.php                                24-Jan-2021 12:02                7703
function.strtok.php                                24-Jan-2021 12:02                8070
function.strtolower.php                            24-Jan-2021 12:02                4811
function.strtotime.php                             24-Jan-2021 12:02               12378
function.strtoupper.php                            24-Jan-2021 12:02                4809
function.strtr.php                                 24-Jan-2021 12:02               10589
function.strval.php                                24-Jan-2021 12:02                2519
function.substr-compare.php                        24-Jan-2021 12:02                9856
function.substr-count.php                          24-Jan-2021 12:02                8741
function.substr-replace.php                        24-Jan-2021 12:02               15829
function.substr.php                                24-Jan-2021 12:02               22152
function.svn-add.php                               24-Jan-2021 12:02                5590
function.svn-auth-get-parameter.php                24-Jan-2021 12:02                3688
function.svn-auth-set-parameter.php                24-Jan-2021 12:02                5180
function.svn-blame.php                             24-Jan-2021 12:02                4678
function.svn-cat.php                               24-Jan-2021 12:02                4543
function.svn-checkout.php                          24-Jan-2021 12:02                6843
function.svn-cleanup.php                           24-Jan-2021 12:02                4856
function.svn-client-version.php                    24-Jan-2021 12:02                3074
function.svn-commit.php                            24-Jan-2021 12:02                7286
function.svn-delete.php                            24-Jan-2021 12:02                4184
function.svn-diff.php                              24-Jan-2021 12:02               13054
function.svn-export.php                            24-Jan-2021 12:02                4726
function.svn-fs-abort-txn.php                      24-Jan-2021 12:02                2342
function.svn-fs-apply-text.php                     24-Jan-2021 12:02                2445
function.svn-fs-begin-txn2.php                     24-Jan-2021 12:02                2390
function.svn-fs-change-node-prop.php               24-Jan-2021 12:02                2690
function.svn-fs-check-path.php                     24-Jan-2021 12:02                2496
function.svn-fs-contents-changed.php               24-Jan-2021 12:02                2691
function.svn-fs-copy.php                           24-Jan-2021 12:02                2663
function.svn-fs-delete.php                         24-Jan-2021 12:02                2431
function.svn-fs-dir-entries.php                    24-Jan-2021 12:02                2508
function.svn-fs-file-contents.php                  24-Jan-2021 12:02                2523
function.svn-fs-file-length.php                    24-Jan-2021 12:02                2454
function.svn-fs-is-dir.php                         24-Jan-2021 12:02                2417
function.svn-fs-is-file.php                        24-Jan-2021 12:02                2407
function.svn-fs-make-dir.php                       24-Jan-2021 12:02                2451
function.svn-fs-make-file.php                      24-Jan-2021 12:02                2465
function.svn-fs-node-created-rev.php               24-Jan-2021 12:02                2492
function.svn-fs-node-prop.php                      24-Jan-2021 12:02                2539
function.svn-fs-props-changed.php                  24-Jan-2021 12:02                2681
function.svn-fs-revision-prop.php                  24-Jan-2021 12:02                2550
function.svn-fs-revision-root.php                  24-Jan-2021 12:02                2470
function.svn-fs-txn-root.php                       24-Jan-2021 12:02                2294
function.svn-fs-youngest-rev.php                   24-Jan-2021 12:02                2338
function.svn-import.php                            24-Jan-2021 12:02                5576
function.svn-log.php                               24-Jan-2021 12:02                8452
function.svn-ls.php                                24-Jan-2021 12:02                6745
function.svn-mkdir.php                             24-Jan-2021 12:02                2889
function.svn-repos-create.php                      24-Jan-2021 12:02                2609
function.svn-repos-fs-begin-txn-for-commit.php     24-Jan-2021 12:02                2737
function.svn-repos-fs-commit-txn.php               24-Jan-2021 12:02                2389
function.svn-repos-fs.php                          24-Jan-2021 12:02                2294
function.svn-repos-hotcopy.php                     24-Jan-2021 12:02                2556
function.svn-repos-open.php                        24-Jan-2021 12:02                2268
function.svn-repos-recover.php                     24-Jan-2021 12:02                2314
function.svn-revert.php                            24-Jan-2021 12:02                3204
function.svn-status.php                            24-Jan-2021 12:02               14351
function.svn-update.php                            24-Jan-2021 12:02                5696
function.swoole-async-dns-lookup.php               24-Jan-2021 12:02                3474
function.swoole-async-read.php                     24-Jan-2021 12:02                3981
function.swoole-async-readfile.php                 24-Jan-2021 12:02                3503
function.swoole-async-set.php                      24-Jan-2021 12:02                2026
function.swoole-async-write.php                    24-Jan-2021 12:02                3211
function.swoole-async-writefile.php                24-Jan-2021 12:02                3239
function.swoole-client-select.php                  24-Jan-2021 12:02                3009
function.swoole-cpu-num.php                        24-Jan-2021 12:02                1936
function.swoole-errno.php                          24-Jan-2021 12:02                1919
function.swoole-event-add.php                      24-Jan-2021 12:02                3116
function.swoole-event-defer.php                    24-Jan-2021 12:02                2361
function.swoole-event-del.php                      24-Jan-2021 12:02                2271
function.swoole-event-exit.php                     24-Jan-2021 12:02                2009
function.swoole-event-set.php                      24-Jan-2021 12:02                3115
function.swoole-event-wait.php                     24-Jan-2021 12:02                1980
function.swoole-event-write.php                    24-Jan-2021 12:02                2493
function.swoole-get-local-ip.php                   24-Jan-2021 12:02                2002
function.swoole-last-error.php                     24-Jan-2021 12:02                1963
function.swoole-load-module.php                    24-Jan-2021 12:02                2160
function.swoole-select.php                         24-Jan-2021 12:02                2975
function.swoole-set-process-name.php               24-Jan-2021 12:02                2374
function.swoole-strerror.php                       24-Jan-2021 12:02                2303
function.swoole-timer-after.php                    24-Jan-2021 12:02                2837
function.swoole-timer-exists.php                   24-Jan-2021 12:02                2191
function.swoole-timer-tick.php                     24-Jan-2021 12:02                2711
function.swoole-version.php                        24-Jan-2021 12:02                1939
function.symlink.php                               24-Jan-2021 12:02                5452
function.sys-get-temp-dir.php                      24-Jan-2021 12:01                3704
function.sys-getloadavg.php                        24-Jan-2021 12:02                3610
function.syslog.php                                24-Jan-2021 12:02                9000
function.system.php                                24-Jan-2021 12:02                7090
function.taint.php                                 24-Jan-2021 12:02                2396
function.tan.php                                   24-Jan-2021 12:02                4108
function.tanh.php                                  24-Jan-2021 12:02                2977
function.tcpwrap-check.php                         24-Jan-2021 12:02                5159
function.tempnam.php                               24-Jan-2021 12:02                7299
function.textdomain.php                            24-Jan-2021 12:02                2539
function.tidy-access-count.php                     24-Jan-2021 12:02                6382
function.tidy-config-count.php                     24-Jan-2021 12:02                4208
function.tidy-error-count.php                      24-Jan-2021 12:02                5159
function.tidy-get-output.php                       24-Jan-2021 12:02                4061
function.tidy-warning-count.php                    24-Jan-2021 12:02                4766
function.time-nanosleep.php                        24-Jan-2021 12:02                8866
function.time-sleep-until.php                      24-Jan-2021 12:02                5944
function.time.php                                  24-Jan-2021 12:02                5542
function.timezone-abbreviations-list.php           24-Jan-2021 12:02                1768
function.timezone-identifiers-list.php             24-Jan-2021 12:02                1786
function.timezone-location-get.php                 24-Jan-2021 12:02                1746
function.timezone-name-from-abbr.php               24-Jan-2021 12:02                5825
function.timezone-name-get.php                     24-Jan-2021 12:02                1694
function.timezone-offset-get.php                   24-Jan-2021 12:02                1690
function.timezone-open.php                         24-Jan-2021 12:02                1684
function.timezone-transitions-get.php              24-Jan-2021 12:02                1746
function.timezone-version-get.php                  24-Jan-2021 12:02                3034
function.tmpfile.php                               24-Jan-2021 12:02                4756
function.token-get-all.php                         24-Jan-2021 12:02                6701
function.token-name.php                            24-Jan-2021 12:02                3949
function.touch.php                                 24-Jan-2021 12:02                6825
function.trader-acos.php                           24-Jan-2021 12:02                2237
function.trader-ad.php                             24-Jan-2021 12:02                2873
function.trader-add.php                            24-Jan-2021 12:02                2519
function.trader-adosc.php                          24-Jan-2021 12:02                3576
function.trader-adx.php                            24-Jan-2021 12:02                2964
function.trader-adxr.php                           24-Jan-2021 12:02                2974
function.trader-apo.php                            24-Jan-2021 12:02                3178
function.trader-aroon.php                          24-Jan-2021 12:02                2699
function.trader-aroonosc.php                       24-Jan-2021 12:02                2733
function.trader-asin.php                           24-Jan-2021 12:02                2255
function.trader-atan.php                           24-Jan-2021 12:02                2248
function.trader-atr.php                            24-Jan-2021 12:02                2954
function.trader-avgprice.php                       24-Jan-2021 12:02                2924
function.trader-bbands.php                         24-Jan-2021 12:02                3857
function.trader-beta.php                           24-Jan-2021 12:02                2673
function.trader-bop.php                            24-Jan-2021 12:02                2878
function.trader-cci.php                            24-Jan-2021 12:02                2959
function.trader-cdl2crows.php                      24-Jan-2021 12:02                2945
function.trader-cdl3blackcrows.php                 24-Jan-2021 12:02                3002
function.trader-cdl3inside.php                     24-Jan-2021 12:02                2987
function.trader-cdl3linestrike.php                 24-Jan-2021 12:02                3006
function.trader-cdl3outside.php                    24-Jan-2021 12:02                3001
function.trader-cdl3starsinsouth.php               24-Jan-2021 12:02                3045
function.trader-cdl3whitesoldiers.php              24-Jan-2021 12:02                3068
function.trader-cdlabandonedbaby.php               24-Jan-2021 12:02                3371
function.trader-cdladvanceblock.php                24-Jan-2021 12:02                3023
function.trader-cdlbelthold.php                    24-Jan-2021 12:02                2983
function.trader-cdlbreakaway.php                   24-Jan-2021 12:02                2996
function.trader-cdlclosingmarubozu.php             24-Jan-2021 12:02                3061
function.trader-cdlconcealbabyswall.php            24-Jan-2021 12:02                3083
function.trader-cdlcounterattack.php               24-Jan-2021 12:02                3050
function.trader-cdldarkcloudcover.php              24-Jan-2021 12:02                3364
function.trader-cdldoji.php                        24-Jan-2021 12:02                2944
function.trader-cdldojistar.php                    24-Jan-2021 12:02                2975
function.trader-cdldragonflydoji.php               24-Jan-2021 12:02                3025
function.trader-cdlengulfing.php                   24-Jan-2021 12:02                3014
function.trader-cdleveningdojistar.php             24-Jan-2021 12:02                3380
function.trader-cdleveningstar.php                 24-Jan-2021 12:02                3361
function.trader-cdlgapsidesidewhite.php            24-Jan-2021 12:02                3090
function.trader-cdlgravestonedoji.php              24-Jan-2021 12:02                3045
function.trader-cdlhammer.php                      24-Jan-2021 12:02                2968
function.trader-cdlhangingman.php                  24-Jan-2021 12:02                2985
function.trader-cdlharami.php                      24-Jan-2021 12:02                2970
function.trader-cdlharamicross.php                 24-Jan-2021 12:02                3007
function.trader-cdlhighwave.php                    24-Jan-2021 12:02                2984
function.trader-cdlhikkake.php                     24-Jan-2021 12:02                2974
function.trader-cdlhikkakemod.php                  24-Jan-2021 12:02                3012
function.trader-cdlhomingpigeon.php                24-Jan-2021 12:02                3031
function.trader-cdlidentical3crows.php             24-Jan-2021 12:02                3052
function.trader-cdlinneck.php                      24-Jan-2021 12:02                2987
function.trader-cdlinvertedhammer.php              24-Jan-2021 12:02                3027
function.trader-cdlkicking.php                     24-Jan-2021 12:02                2988
function.trader-cdlkickingbylength.php             24-Jan-2021 12:02                3086
function.trader-cdlladderbottom.php                24-Jan-2021 12:02                3039
function.trader-cdllongleggeddoji.php              24-Jan-2021 12:02                3042
function.trader-cdllongline.php                    24-Jan-2021 12:02                2992
function.trader-cdlmarubozu.php                    24-Jan-2021 12:02                2978
function.trader-cdlmatchinglow.php                 24-Jan-2021 12:02                3001
function.trader-cdlmathold.php                     24-Jan-2021 12:02                3311
function.trader-cdlmorningdojistar.php             24-Jan-2021 12:02                3376
function.trader-cdlmorningstar.php                 24-Jan-2021 12:02                3341
function.trader-cdlonneck.php                      24-Jan-2021 12:02                2967
function.trader-cdlpiercing.php                    24-Jan-2021 12:02                2982
function.trader-cdlrickshawman.php                 24-Jan-2021 12:02                3019
function.trader-cdlrisefall3methods.php            24-Jan-2021 12:02                3084
function.trader-cdlseparatinglines.php             24-Jan-2021 12:02                3067
function.trader-cdlshootingstar.php                24-Jan-2021 12:02                3029
function.trader-cdlshortline.php                   24-Jan-2021 12:02                3004
function.trader-cdlspinningtop.php                 24-Jan-2021 12:02                3017
function.trader-cdlstalledpattern.php              24-Jan-2021 12:02                3049
function.trader-cdlsticksandwich.php               24-Jan-2021 12:02                3031
function.trader-cdltakuri.php                      24-Jan-2021 12:02                3009
function.trader-cdltasukigap.php                   24-Jan-2021 12:02                2981
function.trader-cdlthrusting.php                   24-Jan-2021 12:02                2990
function.trader-cdltristar.php                     24-Jan-2021 12:02                2980
function.trader-cdlunique3river.php                24-Jan-2021 12:02                3026
function.trader-cdlupsidegap2crows.php             24-Jan-2021 12:02                3071
function.trader-cdlxsidegap3methods.php            24-Jan-2021 12:02                3069
function.trader-ceil.php                           24-Jan-2021 12:02                2272
function.trader-cmo.php                            24-Jan-2021 12:02                2440
function.trader-correl.php                         24-Jan-2021 12:02                2723
function.trader-cos.php                            24-Jan-2021 12:02                2239
function.trader-cosh.php                           24-Jan-2021 12:02                2254
function.trader-dema.php                           24-Jan-2021 12:02                2450
function.trader-div.php                            24-Jan-2021 12:02                2535
function.trader-dx.php                             24-Jan-2021 12:02                2941
function.trader-ema.php                            24-Jan-2021 12:02                2434
function.trader-errno.php                          24-Jan-2021 12:02                1837
function.trader-exp.php                            24-Jan-2021 12:02                2283
function.trader-floor.php                          24-Jan-2021 12:02                2263
function.trader-get-compat.php                     24-Jan-2021 12:02                2017
function.trader-get-unstable-period.php            24-Jan-2021 12:02                2474
function.trader-ht-dcperiod.php                    24-Jan-2021 12:02                2245
function.trader-ht-dcphase.php                     24-Jan-2021 12:02                2217
function.trader-ht-phasor.php                      24-Jan-2021 12:02                2199
function.trader-ht-sine.php                        24-Jan-2021 12:02                2180
function.trader-ht-trendline.php                   24-Jan-2021 12:02                2236
function.trader-ht-trendmode.php                   24-Jan-2021 12:02                2226
function.trader-kama.php                           24-Jan-2021 12:02                2488
function.trader-linearreg-angle.php                24-Jan-2021 12:02                2571
function.trader-linearreg-intercept.php            24-Jan-2021 12:02                2625
function.trader-linearreg-slope.php                24-Jan-2021 12:02                2581
function.trader-linearreg.php                      24-Jan-2021 12:02                2499
function.trader-ln.php                             24-Jan-2021 12:02                2242
function.trader-log10.php                          24-Jan-2021 12:02                2243
function.trader-ma.php                             24-Jan-2021 12:02                2806
function.trader-macd.php                           24-Jan-2021 12:02                3162
function.trader-macdext.php                        24-Jan-2021 12:02                4421
function.trader-macdfix.php                        24-Jan-2021 12:02                2531
function.trader-mama.php                           24-Jan-2021 12:02                2825
function.trader-mavp.php                           24-Jan-2021 12:02                3489
function.trader-max.php                            24-Jan-2021 12:02                2455
function.trader-maxindex.php                       24-Jan-2021 12:02                2507
function.trader-medprice.php                       24-Jan-2021 12:02                2413
function.trader-mfi.php                            24-Jan-2021 12:02                3220
function.trader-midpoint.php                       24-Jan-2021 12:02                2481
function.trader-midprice.php                       24-Jan-2021 12:02                2747
function.trader-min.php                            24-Jan-2021 12:02                2462
function.trader-minindex.php                       24-Jan-2021 12:02                2502
function.trader-minmax.php                         24-Jan-2021 12:02                2508
function.trader-minmaxindex.php                    24-Jan-2021 12:02                2554
function.trader-minus-di.php                       24-Jan-2021 12:02                3022
function.trader-minus-dm.php                       24-Jan-2021 12:02                2747
function.trader-mom.php                            24-Jan-2021 12:02                2426
function.trader-mult.php                           24-Jan-2021 12:02                2534
function.trader-natr.php                           24-Jan-2021 12:02                2964
function.trader-obv.php                            24-Jan-2021 12:02                2373
function.trader-plus-di.php                        24-Jan-2021 12:02                2994
function.trader-plus-dm.php                        24-Jan-2021 12:02                2735
function.trader-ppo.php                            24-Jan-2021 12:02                3182
function.trader-roc.php                            24-Jan-2021 12:02                2450
function.trader-rocp.php                           24-Jan-2021 12:02                2477
function.trader-rocr.php                           24-Jan-2021 12:02                2462
function.trader-rocr100.php                        24-Jan-2021 12:02                2499
function.trader-rsi.php                            24-Jan-2021 12:02                2431
function.trader-sar.php                            24-Jan-2021 12:02                3220
function.trader-sarext.php                         24-Jan-2021 12:02                6167
function.trader-set-compat.php                     24-Jan-2021 12:02                2417
function.trader-set-unstable-period.php            24-Jan-2021 12:02                2946
function.trader-sin.php                            24-Jan-2021 12:02                2263
function.trader-sinh.php                           24-Jan-2021 12:02                2250
function.trader-sma.php                            24-Jan-2021 12:02                2431
function.trader-sqrt.php                           24-Jan-2021 12:02                2243
function.trader-stddev.php                         24-Jan-2021 12:02                2722
function.trader-stoch.php                          24-Jan-2021 12:02                4522
function.trader-stochf.php                         24-Jan-2021 12:02                3782
function.trader-stochrsi.php                       24-Jan-2021 12:02                3613
function.trader-sub.php                            24-Jan-2021 12:02                2540
function.trader-sum.php                            24-Jan-2021 12:02                2413
function.trader-t3.php                             24-Jan-2021 12:02                2745
function.trader-tan.php                            24-Jan-2021 12:02                2232
function.trader-tanh.php                           24-Jan-2021 12:02                2255
function.trader-tema.php                           24-Jan-2021 12:02                2456
function.trader-trange.php                         24-Jan-2021 12:02                2647
function.trader-trima.php                          24-Jan-2021 12:02                2457
function.trader-trix.php                           24-Jan-2021 12:02                2468
function.trader-tsf.php                            24-Jan-2021 12:02                2438
function.trader-typprice.php                       24-Jan-2021 12:02                2668
function.trader-ultosc.php                         24-Jan-2021 12:02                3665
function.trader-var.php                            24-Jan-2021 12:02                2695
function.trader-wclprice.php                       24-Jan-2021 12:02                2673
function.trader-willr.php                          24-Jan-2021 12:02                2969
function.trader-wma.php                            24-Jan-2021 12:02                2455
function.trait-exists.php                          24-Jan-2021 12:02                2636
function.trigger-error.php                         24-Jan-2021 12:01                5948
function.trim.php                                  24-Jan-2021 12:02               12788
function.uasort.php                                24-Jan-2021 12:02                8079
function.ucfirst.php                               24-Jan-2021 12:02                5350
function.ucwords.php                               24-Jan-2021 12:02                8010
function.ui-draw-text-font-fontfamilies.php        24-Jan-2021 12:02                1872
function.ui-quit.php                               24-Jan-2021 12:02                1894
function.ui-run.php                                24-Jan-2021 12:02                2235
function.uksort.php                                24-Jan-2021 12:02                8075
function.umask.php                                 24-Jan-2021 12:02                4722
function.uniqid.php                                24-Jan-2021 12:02                6979
function.unixtojd.php                              24-Jan-2021 12:02                2689
function.unlink.php                                24-Jan-2021 12:02                5314
function.unpack.php                                24-Jan-2021 12:02               10155
function.unregister-tick-function.php              24-Jan-2021 12:02                2959
function.unserialize.php                           24-Jan-2021 12:02               10898
function.unset.php                                 24-Jan-2021 12:02               14614
function.untaint.php                               24-Jan-2021 12:02                2250
function.uopz-add-function.php                     24-Jan-2021 12:01                6238
function.uopz-allow-exit.php                       24-Jan-2021 12:01                4383
function.uopz-backup.php                           24-Jan-2021 12:01                4265
function.uopz-compose.php                          24-Jan-2021 12:01                6618
function.uopz-copy.php                             24-Jan-2021 12:01                4979
function.uopz-del-function.php                     24-Jan-2021 12:01                5941
function.uopz-delete.php                           24-Jan-2021 12:01                5731
function.uopz-extend.php                           24-Jan-2021 12:01                4574
function.uopz-flags.php                            24-Jan-2021 12:01               10549
function.uopz-function.php                         24-Jan-2021 12:01                6844
function.uopz-get-exit-status.php                  24-Jan-2021 12:01                3995
function.uopz-get-hook.php                         24-Jan-2021 12:01                5033
function.uopz-get-mock.php                         24-Jan-2021 12:01                5003
function.uopz-get-property.php                     24-Jan-2021 12:01                5980
function.uopz-get-return.php                       24-Jan-2021 12:01                4209
function.uopz-get-static.php                       24-Jan-2021 12:01                4659
function.uopz-implement.php                        24-Jan-2021 12:01                4596
function.uopz-overload.php                         24-Jan-2021 12:01                3753
function.uopz-redefine.php                         24-Jan-2021 12:01                4705
function.uopz-rename.php                           24-Jan-2021 12:01                6433
function.uopz-restore.php                          24-Jan-2021 12:01                4622
function.uopz-set-hook.php                         24-Jan-2021 12:01                5209
function.uopz-set-mock.php                         24-Jan-2021 12:01               12218
function.uopz-set-property.php                     24-Jan-2021 12:01                7441
function.uopz-set-return.php                       24-Jan-2021 12:01                9148
function.uopz-set-static.php                       24-Jan-2021 12:01                5319
function.uopz-undefine.php                         24-Jan-2021 12:01                4159
function.uopz-unset-hook.php                       24-Jan-2021 12:01                5091
function.uopz-unset-mock.php                       24-Jan-2021 12:01                5099
function.uopz-unset-return.php                     24-Jan-2021 12:01                4501
function.urldecode.php                             24-Jan-2021 12:02                6310
function.urlencode.php                             24-Jan-2021 12:02                7682
function.use-soap-error-handler.php                24-Jan-2021 12:02                3447
function.user-error.php                            24-Jan-2021 12:01                1572
function.usleep.php                                24-Jan-2021 12:02                4805
function.usort.php                                 24-Jan-2021 12:02               21678
function.utf8-decode.php                           24-Jan-2021 12:02                2069
function.utf8-encode.php                           24-Jan-2021 12:02                3345
function.var-dump.php                              24-Jan-2021 12:02                6136
function.var-export.php                            24-Jan-2021 12:02               17147
function.variant-abs.php                           24-Jan-2021 12:02                3850
function.variant-add.php                           24-Jan-2021 12:02                5232
function.variant-and.php                           24-Jan-2021 12:02                5936
function.variant-cast.php                          24-Jan-2021 12:02                3366
function.variant-cat.php                           24-Jan-2021 12:02                4450
function.variant-cmp.php                           24-Jan-2021 12:02                6811
function.variant-date-from-timestamp.php           24-Jan-2021 12:02                3398
function.variant-date-to-timestamp.php             24-Jan-2021 12:02                3470
function.variant-div.php                           24-Jan-2021 12:02                5966
function.variant-eqv.php                           24-Jan-2021 12:02                4059
function.variant-fix.php                           24-Jan-2021 12:02                5235
function.variant-get-type.php                      24-Jan-2021 12:02                3291
function.variant-idiv.php                          24-Jan-2021 12:02                5419
function.variant-imp.php                           24-Jan-2021 12:02                5479
function.variant-int.php                           24-Jan-2021 12:02                4733
function.variant-mod.php                           24-Jan-2021 12:02                4527
function.variant-mul.php                           24-Jan-2021 12:02                5536
function.variant-neg.php                           24-Jan-2021 12:02                3515
function.variant-not.php                           24-Jan-2021 12:02                3679
function.variant-or.php                            24-Jan-2021 12:02                6112
function.variant-pow.php                           24-Jan-2021 12:02                4350
function.variant-round.php                         24-Jan-2021 12:02                4082
function.variant-set-type.php                      24-Jan-2021 12:02                3478
function.variant-set.php                           24-Jan-2021 12:02                2788
function.variant-sub.php                           24-Jan-2021 12:02                5194
function.variant-xor.php                           24-Jan-2021 12:02                5463
function.version-compare.php                       24-Jan-2021 12:01               11118
function.vfprintf.php                              24-Jan-2021 12:02                5899
function.virtual.php                               24-Jan-2021 12:02                4417
function.vprintf.php                               24-Jan-2021 12:02                4604
function.vsprintf.php                              24-Jan-2021 12:02               15216
function.wddx-add-vars.php                         24-Jan-2021 12:02                3538
function.wddx-deserialize.php                      24-Jan-2021 12:02                3401
function.wddx-packet-end.php                       24-Jan-2021 12:02                2612
function.wddx-packet-start.php                     24-Jan-2021 12:02                2737
function.wddx-serialize-value.php                  24-Jan-2021 12:02                3017
function.wddx-serialize-vars.php                   24-Jan-2021 12:02                5904
function.win32-continue-service.php                24-Jan-2021 12:02                6077
function.win32-create-service.php                  24-Jan-2021 12:02               32126
function.win32-delete-service.php                  24-Jan-2021 12:02                6510
function.win32-get-last-control-message.php        24-Jan-2021 12:02                6655
function.win32-pause-service.php                   24-Jan-2021 12:02                6083
function.win32-query-service-status.php            24-Jan-2021 12:02                8033
function.win32-send-custom-control.php             24-Jan-2021 12:02                6589
function.win32-set-service-exit-code.php           24-Jan-2021 12:02                5407
function.win32-set-service-exit-mode.php           24-Jan-2021 12:02                5450
function.win32-set-service-status.php              24-Jan-2021 12:02                7832
function.win32-start-service-ctrl-dispatcher.php   24-Jan-2021 12:02               10703
function.win32-start-service.php                   24-Jan-2021 12:02                6085
function.win32-stop-service.php                    24-Jan-2021 12:02                6001
function.wincache-fcache-fileinfo.php              24-Jan-2021 12:02                9023
function.wincache-fcache-meminfo.php               24-Jan-2021 12:02                6742
function.wincache-lock.php                         24-Jan-2021 12:02                8434
function.wincache-ocache-fileinfo.php              24-Jan-2021 12:02                9686
function.wincache-ocache-meminfo.php               24-Jan-2021 12:02                6945
function.wincache-refresh-if-changed.php           24-Jan-2021 12:02                7693
function.wincache-rplist-fileinfo.php              24-Jan-2021 12:02                7065
function.wincache-rplist-meminfo.php               24-Jan-2021 12:02                6857
function.wincache-scache-info.php                  24-Jan-2021 12:02                9282
function.wincache-scache-meminfo.php               24-Jan-2021 12:02                6315
function.wincache-ucache-add.php                   24-Jan-2021 12:02               13105
function.wincache-ucache-cas.php                   24-Jan-2021 12:02                5950
function.wincache-ucache-clear.php                 24-Jan-2021 12:02                7225
function.wincache-ucache-dec.php                   24-Jan-2021 12:02                5988
function.wincache-ucache-delete.php                24-Jan-2021 12:02               11289
function.wincache-ucache-exists.php                24-Jan-2021 12:02                5934
function.wincache-ucache-get.php                   24-Jan-2021 12:02               10387
function.wincache-ucache-inc.php                   24-Jan-2021 12:02                5980
function.wincache-ucache-info.php                  24-Jan-2021 12:02               11005
function.wincache-ucache-meminfo.php               24-Jan-2021 12:02                6519
function.wincache-ucache-set.php                   24-Jan-2021 12:02               13333
function.wincache-unlock.php                       24-Jan-2021 12:02                7797
function.wordwrap.php                              24-Jan-2021 12:02                8574
function.xattr-get.php                             24-Jan-2021 12:02                5648
function.xattr-list.php                            24-Jan-2021 12:02                6262
function.xattr-remove.php                          24-Jan-2021 12:02                5834
function.xattr-set.php                             24-Jan-2021 12:02                7344
function.xattr-supported.php                       24-Jan-2021 12:02                4957
function.xdiff-file-bdiff-size.php                 24-Jan-2021 12:02                4699
function.xdiff-file-bdiff.php                      24-Jan-2021 12:02                5567
function.xdiff-file-bpatch.php                     24-Jan-2021 12:02                6228
function.xdiff-file-diff-binary.php                24-Jan-2021 12:02                5905
function.xdiff-file-diff.php                       24-Jan-2021 12:02                6666
function.xdiff-file-merge3.php                     24-Jan-2021 12:02                6435
function.xdiff-file-patch-binary.php               24-Jan-2021 12:02                6280
function.xdiff-file-patch.php                      24-Jan-2021 12:02                8519
function.xdiff-file-rabdiff.php                    24-Jan-2021 12:02                6137
function.xdiff-string-bdiff-size.php               24-Jan-2021 12:02                5025
function.xdiff-string-bdiff.php                    24-Jan-2021 12:02                3528
function.xdiff-string-bpatch.php                   24-Jan-2021 12:02                3640
function.xdiff-string-diff-binary.php              24-Jan-2021 12:02                3932
function.xdiff-string-diff.php                     24-Jan-2021 12:02                7177
function.xdiff-string-merge3.php                   24-Jan-2021 12:02                4307
function.xdiff-string-patch-binary.php             24-Jan-2021 12:02                4087
function.xdiff-string-patch.php                    24-Jan-2021 12:02                7865
function.xdiff-string-rabdiff.php                  24-Jan-2021 12:02                4113
function.xhprof-disable.php                        24-Jan-2021 12:02                3724
function.xhprof-enable.php                         24-Jan-2021 12:02                7563
function.xhprof-sample-disable.php                 24-Jan-2021 12:02                4521
function.xhprof-sample-enable.php                  24-Jan-2021 12:02                3266
function.xml-error-string.php                      24-Jan-2021 12:02                3057
function.xml-get-current-byte-index.php            24-Jan-2021 12:02                3480
function.xml-get-current-column-number.php         24-Jan-2021 12:02                3405
function.xml-get-current-line-number.php           24-Jan-2021 12:02                3221
function.xml-get-error-code.php                    24-Jan-2021 12:02                3031
function.xml-parse-into-struct.php                 24-Jan-2021 12:02               18920
function.xml-parse.php                             24-Jan-2021 12:02                4415
function.xml-parser-create-ns.php                  24-Jan-2021 12:02                3526
function.xml-parser-create.php                     24-Jan-2021 12:02                3023
function.xml-parser-free.php                       24-Jan-2021 12:02                2253
function.xml-parser-get-option.php                 24-Jan-2021 12:02                3125
function.xml-parser-set-option.php                 24-Jan-2021 12:02                4761
function.xml-set-character-data-handler.php        24-Jan-2021 12:02                4893
function.xml-set-default-handler.php               24-Jan-2021 12:02                4767
function.xml-set-element-handler.php               24-Jan-2021 12:02                7432
function.xml-set-end-namespace-decl-handler.php    24-Jan-2021 12:02                5972
function.xml-set-external-entity-ref-handler.php   24-Jan-2021 12:02                6648
function.xml-set-notation-decl-handler.php         24-Jan-2021 12:02                6375
function.xml-set-object.php                        24-Jan-2021 12:02                8283
function.xml-set-processing-instruction-handler..> 24-Jan-2021 12:02                5863
function.xml-set-start-namespace-decl-handler.php  24-Jan-2021 12:02                6076
function.xml-set-unparsed-entity-decl-handler.php  24-Jan-2021 12:02                7042
function.xmlrpc-decode-request.php                 24-Jan-2021 12:02                2495
function.xmlrpc-decode.php                         24-Jan-2021 12:02                3898
function.xmlrpc-encode-request.php                 24-Jan-2021 12:02                8649
function.xmlrpc-encode.php                         24-Jan-2021 12:02                2188
function.xmlrpc-get-type.php                       24-Jan-2021 12:02                6396
function.xmlrpc-is-fault.php                       24-Jan-2021 12:02                3540
function.xmlrpc-parse-method-descriptions.php      24-Jan-2021 12:02                2284
function.xmlrpc-server-add-introspection-data.php  24-Jan-2021 12:02                2403
function.xmlrpc-server-call-method.php             24-Jan-2021 12:02                2699
function.xmlrpc-server-create.php                  24-Jan-2021 12:02                2062
function.xmlrpc-server-destroy.php                 24-Jan-2021 12:02                2207
function.xmlrpc-server-register-introspection-c..> 24-Jan-2021 12:02                2472
function.xmlrpc-server-register-method.php         24-Jan-2021 12:02                2505
function.xmlrpc-set-type.php                       24-Jan-2021 12:02                5086
function.yaml-emit-file.php                        24-Jan-2021 12:02                5574
function.yaml-emit.php                             24-Jan-2021 12:02               12586
function.yaml-parse-file.php                       24-Jan-2021 12:02                5485
function.yaml-parse-url.php                        24-Jan-2021 12:02                5814
function.yaml-parse.php                            24-Jan-2021 12:02                9735
function.yaz-addinfo.php                           24-Jan-2021 12:02                3181
function.yaz-ccl-conf.php                          24-Jan-2021 12:02                5538
function.yaz-ccl-parse.php                         24-Jan-2021 12:02                6483
function.yaz-close.php                             24-Jan-2021 12:02                3174
function.yaz-connect.php                           24-Jan-2021 12:02                8820
function.yaz-database.php                          24-Jan-2021 12:02                3044
function.yaz-element.php                           24-Jan-2021 12:02                3479
function.yaz-errno.php                             24-Jan-2021 12:02                3423
function.yaz-error.php                             24-Jan-2021 12:02                3176
function.yaz-es-result.php                         24-Jan-2021 12:02                3077
function.yaz-es.php                                24-Jan-2021 12:02                7007
function.yaz-get-option.php                        24-Jan-2021 12:02                3099
function.yaz-hits.php                              24-Jan-2021 12:02                4588
function.yaz-itemorder.php                         24-Jan-2021 12:02                6795
function.yaz-present.php                           24-Jan-2021 12:02                2673
function.yaz-range.php                             24-Jan-2021 12:02                3310
function.yaz-record.php                            24-Jan-2021 12:02               14259
function.yaz-scan-result.php                       24-Jan-2021 12:02                3728
function.yaz-scan.php                              24-Jan-2021 12:02                9496
function.yaz-schema.php                            24-Jan-2021 12:02                3193
function.yaz-search.php                            24-Jan-2021 12:02                8238
function.yaz-set-option.php                        24-Jan-2021 12:02                6572
function.yaz-sort.php                              24-Jan-2021 12:02                5362
function.yaz-syntax.php                            24-Jan-2021 12:02                3151
function.yaz-wait.php                              24-Jan-2021 12:02                3880
function.zend-thread-id.php                        24-Jan-2021 12:01                3352
function.zend-version.php                          24-Jan-2021 12:01                3597
function.zip-close.php                             24-Jan-2021 12:02                2842
function.zip-entry-close.php                       24-Jan-2021 12:02                3035
function.zip-entry-compressedsize.php              24-Jan-2021 12:02                3032
function.zip-entry-compressionmethod.php           24-Jan-2021 12:02                3108
function.zip-entry-filesize.php                    24-Jan-2021 12:02                2979
function.zip-entry-name.php                        24-Jan-2021 12:02                2908
function.zip-entry-open.php                        24-Jan-2021 12:02                4549
function.zip-entry-read.php                        24-Jan-2021 12:02                3782
function.zip-open.php                              24-Jan-2021 12:02                3096
function.zip-read.php                              24-Jan-2021 12:02                3443
function.zlib-decode.php                           24-Jan-2021 12:02                3059
function.zlib-encode.php                           24-Jan-2021 12:02                4797
function.zlib-get-coding-type.php                  24-Jan-2021 12:02                2438
function.zookeeper-dispatch.php                    24-Jan-2021 12:02                8080
functional.parallel.php                            24-Jan-2021 12:02                2425
functions.anonymous.php                            24-Jan-2021 12:01               25245
functions.arguments.php                            24-Jan-2021 12:01               27307
functions.arrow.php                                24-Jan-2021 12:01               10504
functions.internal.php                             24-Jan-2021 12:01                4524
functions.returning-values.php                     24-Jan-2021 12:01                5354
functions.user-defined.php                         24-Jan-2021 12:01                9360
functions.variable-functions.php                   24-Jan-2021 12:01               12369
gearman.configuration.php                          24-Jan-2021 12:02                1100
gearman.constants.php                              24-Jan-2021 12:02               17644
gearman.examples-reverse-bg.php                    24-Jan-2021 12:02               11579
gearman.examples-reverse-task.php                  24-Jan-2021 12:02               18758
gearman.examples-reverse.php                       24-Jan-2021 12:02               14197
gearman.examples.php                               24-Jan-2021 12:02                1454
gearman.installation.php                           24-Jan-2021 12:02                1392
gearman.requirements.php                           24-Jan-2021 12:02                1361
gearman.resources.php                              24-Jan-2021 12:02                1087
gearman.setup.php                                  24-Jan-2021 12:02                1427
gearmanclient.addoptions.php                       24-Jan-2021 12:02                2752
gearmanclient.addserver.php                        24-Jan-2021 12:02                4818
gearmanclient.addservers.php                       24-Jan-2021 12:02                4302
gearmanclient.addtask.php                          24-Jan-2021 12:02               14898
gearmanclient.addtaskbackground.php                24-Jan-2021 12:02               21212
gearmanclient.addtaskhigh.php                      24-Jan-2021 12:02               11019
gearmanclient.addtaskhighbackground.php            24-Jan-2021 12:02                5577
gearmanclient.addtasklow.php                       24-Jan-2021 12:02               11002
gearmanclient.addtasklowbackground.php             24-Jan-2021 12:02                5571
gearmanclient.addtaskstatus.php                    24-Jan-2021 12:02                9758
gearmanclient.clearcallbacks.php                   24-Jan-2021 12:02                4211
gearmanclient.clone.php                            24-Jan-2021 12:02                2368
gearmanclient.construct.php                        24-Jan-2021 12:02                2627
gearmanclient.context.php                          24-Jan-2021 12:02                2705
gearmanclient.data.php                             24-Jan-2021 12:02                2975
gearmanclient.do.php                               24-Jan-2021 12:02               23726
gearmanclient.dobackground.php                     24-Jan-2021 12:02                9576
gearmanclient.dohigh.php                           24-Jan-2021 12:02                4566
gearmanclient.dohighbackground.php                 24-Jan-2021 12:02                4445
gearmanclient.dojobhandle.php                      24-Jan-2021 12:02                2758
gearmanclient.dolow.php                            24-Jan-2021 12:02                4553
gearmanclient.dolowbackground.php                  24-Jan-2021 12:02                4428
gearmanclient.donormal.php                         24-Jan-2021 12:02               24046
gearmanclient.dostatus.php                         24-Jan-2021 12:02                8627
gearmanclient.echo.php                             24-Jan-2021 12:02                2647
gearmanclient.error.php                            24-Jan-2021 12:02                2452
gearmanclient.geterrno.php                         24-Jan-2021 12:02                2473
gearmanclient.jobstatus.php                        24-Jan-2021 12:02                8491
gearmanclient.ping.php                             24-Jan-2021 12:02                2620
gearmanclient.removeoptions.php                    24-Jan-2021 12:02                2395
gearmanclient.returncode.php                       24-Jan-2021 12:02                2106
gearmanclient.runtasks.php                         24-Jan-2021 12:02                3424
gearmanclient.setclientcallback.php                24-Jan-2021 12:02                5188
gearmanclient.setcompletecallback.php              24-Jan-2021 12:02                4990
gearmanclient.setcontext.php                       24-Jan-2021 12:02                2953
gearmanclient.setcreatedcallback.php               24-Jan-2021 12:02                4495
gearmanclient.setdata.php                          24-Jan-2021 12:02                3150
gearmanclient.setdatacallback.php                  24-Jan-2021 12:02                4549
gearmanclient.setexceptioncallback.php             24-Jan-2021 12:02                4495
gearmanclient.setfailcallback.php                  24-Jan-2021 12:02                4555
gearmanclient.setoptions.php                       24-Jan-2021 12:02                2384
gearmanclient.setstatuscallback.php                24-Jan-2021 12:02                4553
gearmanclient.settimeout.php                       24-Jan-2021 12:02                2426
gearmanclient.setwarningcallback.php               24-Jan-2021 12:02                4555
gearmanclient.setworkloadcallback.php              24-Jan-2021 12:02                4708
gearmanclient.timeout.php                          24-Jan-2021 12:02                2569
gearmanclient.wait.php                             24-Jan-2021 12:02                2515
gearmanjob.complete.php                            24-Jan-2021 12:02                3270
gearmanjob.construct.php                           24-Jan-2021 12:02                2139
gearmanjob.data.php                                24-Jan-2021 12:02                3234
gearmanjob.exception.php                           24-Jan-2021 12:02                3451
gearmanjob.fail.php                                24-Jan-2021 12:02                3435
gearmanjob.functionname.php                        24-Jan-2021 12:02                2493
gearmanjob.handle.php                              24-Jan-2021 12:02                2386
gearmanjob.returncode.php                          24-Jan-2021 12:02                2429
gearmanjob.sendcomplete.php                        24-Jan-2021 12:02                2985
gearmanjob.senddata.php                            24-Jan-2021 12:02                2956
gearmanjob.sendexception.php                       24-Jan-2021 12:02                3179
gearmanjob.sendfail.php                            24-Jan-2021 12:02                3148
gearmanjob.sendstatus.php                          24-Jan-2021 12:02                3649
gearmanjob.sendwarning.php                         24-Jan-2021 12:02                3177
gearmanjob.setreturn.php                           24-Jan-2021 12:02                2323
gearmanjob.status.php                              24-Jan-2021 12:02                3936
gearmanjob.unique.php                              24-Jan-2021 12:02                2639
gearmanjob.warning.php                             24-Jan-2021 12:02                3464
gearmanjob.workload.php                            24-Jan-2021 12:02                2642
gearmanjob.workloadsize.php                        24-Jan-2021 12:02                2443
gearmantask.construct.php                          24-Jan-2021 12:02                2158
gearmantask.create.php                             24-Jan-2021 12:02                2526
gearmantask.data.php                               24-Jan-2021 12:02                2441
gearmantask.datasize.php                           24-Jan-2021 12:02                2462
gearmantask.function.php                           24-Jan-2021 12:02                2454
gearmantask.functionname.php                       24-Jan-2021 12:02                2140
gearmantask.isknown.php                            24-Jan-2021 12:02                2164
gearmantask.isrunning.php                          24-Jan-2021 12:02                2162
gearmantask.jobhandle.php                          24-Jan-2021 12:02                2532
gearmantask.recvdata.php                           24-Jan-2021 12:02                3085
gearmantask.returncode.php                         24-Jan-2021 12:02                2455
gearmantask.senddata.php                           24-Jan-2021 12:02                3012
gearmantask.sendworkload.php                       24-Jan-2021 12:02                3041
gearmantask.taskdenominator.php                    24-Jan-2021 12:02                2648
gearmantask.tasknumerator.php                      24-Jan-2021 12:02                2622
gearmantask.unique.php                             24-Jan-2021 12:02                2856
gearmantask.uuid.php                               24-Jan-2021 12:02                3149
gearmanworker.addfunction.php                      24-Jan-2021 12:02                7601
gearmanworker.addoptions.php                       24-Jan-2021 12:02                3139
gearmanworker.addserver.php                        24-Jan-2021 12:02                4475
gearmanworker.addservers.php                       24-Jan-2021 12:02                3954
gearmanworker.clone.php                            24-Jan-2021 12:02                2128
gearmanworker.construct.php                        24-Jan-2021 12:02                2600
gearmanworker.echo.php                             24-Jan-2021 12:02                2798
gearmanworker.error.php                            24-Jan-2021 12:02                2405
gearmanworker.geterrno.php                         24-Jan-2021 12:02                2440
gearmanworker.options.php                          24-Jan-2021 12:02                2448
gearmanworker.register.php                         24-Jan-2021 12:02                3516
gearmanworker.removeoptions.php                    24-Jan-2021 12:02                3158
gearmanworker.returncode.php                       24-Jan-2021 12:02                2648
gearmanworker.setid.php                            24-Jan-2021 12:02                3722
gearmanworker.setoptions.php                       24-Jan-2021 12:02                3309
gearmanworker.settimeout.php                       24-Jan-2021 12:02                7971
gearmanworker.timeout.php                          24-Jan-2021 12:02                2548
gearmanworker.unregister.php                       24-Jan-2021 12:02                3128
gearmanworker.unregisterall.php                    24-Jan-2021 12:02                2820
gearmanworker.wait.php                             24-Jan-2021 12:02                8308
gearmanworker.work.php                             24-Jan-2021 12:02                5240
gender-gender.connect.php                          24-Jan-2021 12:02                2326
gender-gender.construct.php                        24-Jan-2021 12:02                2396
gender-gender.country.php                          24-Jan-2021 12:02                3462
gender-gender.get.php                              24-Jan-2021 12:02                2597
gender-gender.isnick.php                           24-Jan-2021 12:02                3043
gender-gender.similarnames.php                     24-Jan-2021 12:02                2701
gender.example.admin.php                           24-Jan-2021 12:02                9216
gender.examples.php                                24-Jan-2021 12:02                1231
gender.installation.php                            24-Jan-2021 12:02                1771
gender.setup.php                                   24-Jan-2021 12:02                1226
generator.current.php                              24-Jan-2021 12:01                2002
generator.key.php                                  24-Jan-2021 12:01                3826
generator.next.php                                 24-Jan-2021 12:01                1903
generator.rewind.php                               24-Jan-2021 12:01                2017
generator.send.php                                 24-Jan-2021 12:01                5005
generator.throw.php                                24-Jan-2021 12:01                2189
generator.valid.php                                24-Jan-2021 12:01                2001
generator.wakeup.php                               24-Jan-2021 12:01                2038
geoip.configuration.php                            24-Jan-2021 12:02                2197
geoip.constants.php                                24-Jan-2021 12:02                4353
geoip.installation.php                             24-Jan-2021 12:02                1517
geoip.requirements.php                             24-Jan-2021 12:02                1526
geoip.resources.php                                24-Jan-2021 12:02                1045
geoip.setup.php                                    24-Jan-2021 12:02                1393
gettext.configuration.php                          24-Jan-2021 12:02                1100
gettext.constants.php                              24-Jan-2021 12:02                1018
gettext.installation.php                           24-Jan-2021 12:02                1238
gettext.requirements.php                           24-Jan-2021 12:02                1222
gettext.resources.php                              24-Jan-2021 12:02                1057
gettext.setup.php                                  24-Jan-2021 12:02                1434
getting-started.php                                24-Jan-2021 12:01                1895
globiterator.construct.php                         24-Jan-2021 12:02                6321
globiterator.count.php                             24-Jan-2021 12:02                4214
gmagick.addimage.php                               24-Jan-2021 12:02                2702
gmagick.addnoiseimage.php                          24-Jan-2021 12:02                2694
gmagick.annotateimage.php                          24-Jan-2021 12:02                3779
gmagick.blurimage.php                              24-Jan-2021 12:02                2909
gmagick.borderimage.php                            24-Jan-2021 12:02                3245
gmagick.charcoalimage.php                          24-Jan-2021 12:02                2906
gmagick.chopimage.php                              24-Jan-2021 12:02                3347
gmagick.clear.php                                  24-Jan-2021 12:02                2269
gmagick.commentimage.php                           24-Jan-2021 12:02                2558
gmagick.compositeimage.php                         24-Jan-2021 12:02                3490
gmagick.configuration.php                          24-Jan-2021 12:02                1103
gmagick.constants.php                              24-Jan-2021 12:02               66044
gmagick.construct.php                              24-Jan-2021 12:02                2514
gmagick.cropimage.php                              24-Jan-2021 12:02                3485
gmagick.cropthumbnailimage.php                     24-Jan-2021 12:02                2939
gmagick.current.php                                24-Jan-2021 12:02                2331
gmagick.cyclecolormapimage.php                     24-Jan-2021 12:02                2762
gmagick.deconstructimages.php                      24-Jan-2021 12:02                2549
gmagick.despeckleimage.php                         24-Jan-2021 12:02                3449
gmagick.destroy.php                                24-Jan-2021 12:02                2154
gmagick.drawimage.php                              24-Jan-2021 12:02                2657
gmagick.edgeimage.php                              24-Jan-2021 12:02                2633
gmagick.embossimage.php                            24-Jan-2021 12:02                3087
gmagick.enhanceimage.php                           24-Jan-2021 12:02                2186
gmagick.equalizeimage.php                          24-Jan-2021 12:02                2143
gmagick.examples.php                               24-Jan-2021 12:02                3579
gmagick.flipimage.php                              24-Jan-2021 12:02                2494
gmagick.flopimage.php                              24-Jan-2021 12:02                2480
gmagick.frameimage.php                             24-Jan-2021 12:02                3913
gmagick.gammaimage.php                             24-Jan-2021 12:02                2843
gmagick.getcopyright.php                           24-Jan-2021 12:02                2188
gmagick.getfilename.php                            24-Jan-2021 12:02                2138
gmagick.getimagebackgroundcolor.php                24-Jan-2021 12:02                2493
gmagick.getimageblueprimary.php                    24-Jan-2021 12:02                2766
gmagick.getimagebordercolor.php                    24-Jan-2021 12:02                2454
gmagick.getimagechanneldepth.php                   24-Jan-2021 12:02                2486
gmagick.getimagecolors.php                         24-Jan-2021 12:02                2343
gmagick.getimagecolorspace.php                     24-Jan-2021 12:02                2297
gmagick.getimagecompose.php                        24-Jan-2021 12:02                2380
gmagick.getimagedelay.php                          24-Jan-2021 12:02                2279
gmagick.getimagedepth.php                          24-Jan-2021 12:02                2249
gmagick.getimagedispose.php                        24-Jan-2021 12:02                2301
gmagick.getimageextrema.php                        24-Jan-2021 12:02                2475
gmagick.getimagefilename.php                       24-Jan-2021 12:02                2382
gmagick.getimageformat.php                         24-Jan-2021 12:02                2367
gmagick.getimagegamma.php                          24-Jan-2021 12:02                2275
gmagick.getimagegreenprimary.php                   24-Jan-2021 12:02                2482
gmagick.getimageheight.php                         24-Jan-2021 12:02                2300
gmagick.getimagehistogram.php                      24-Jan-2021 12:02                2416
gmagick.getimageindex.php                          24-Jan-2021 12:02                2355
gmagick.getimageinterlacescheme.php                24-Jan-2021 12:02                2410
gmagick.getimageiterations.php                     24-Jan-2021 12:02                2342
gmagick.getimagematte.php                          24-Jan-2021 12:02                2481
gmagick.getimagemattecolor.php                     24-Jan-2021 12:02                2448
gmagick.getimageprofile.php                        24-Jan-2021 12:02                2439
gmagick.getimageredprimary.php                     24-Jan-2021 12:02                2505
gmagick.getimagerenderingintent.php                24-Jan-2021 12:02                2421
gmagick.getimageresolution.php                     24-Jan-2021 12:02                2358
gmagick.getimagescene.php                          24-Jan-2021 12:02                2266
gmagick.getimagesignature.php                      24-Jan-2021 12:02                2375
gmagick.getimagetype.php                           24-Jan-2021 12:02                2274
gmagick.getimageunits.php                          24-Jan-2021 12:02                2074
gmagick.getimagewhitepoint.php                     24-Jan-2021 12:02                2485
gmagick.getimagewidth.php                          24-Jan-2021 12:02                2280
gmagick.getpackagename.php                         24-Jan-2021 12:02                2331
gmagick.getquantumdepth.php                        24-Jan-2021 12:02                2347
gmagick.getreleasedate.php                         24-Jan-2021 12:02                2365
gmagick.getsamplingfactors.php                     24-Jan-2021 12:02                2416
gmagick.getsize.php                                24-Jan-2021 12:02                2420
gmagick.getversion.php                             24-Jan-2021 12:02                2314
gmagick.hasnextimage.php                           24-Jan-2021 12:02                2530
gmagick.haspreviousimage.php                       24-Jan-2021 12:02                2570
gmagick.implodeimage.php                           24-Jan-2021 12:02                2717
gmagick.installation.php                           24-Jan-2021 12:02                1770
gmagick.labelimage.php                             24-Jan-2021 12:02                2561
gmagick.levelimage.php                             24-Jan-2021 12:02                4177
gmagick.magnifyimage.php                           24-Jan-2021 12:02                2387
gmagick.mapimage.php                               24-Jan-2021 12:02                2985
gmagick.medianfilterimage.php                      24-Jan-2021 12:02                2735
gmagick.minifyimage.php                            24-Jan-2021 12:02                2390
gmagick.modulateimage.php                          24-Jan-2021 12:02                3497
gmagick.motionblurimage.php                        24-Jan-2021 12:02                3467
gmagick.newimage.php                               24-Jan-2021 12:02                3389
gmagick.nextimage.php                              24-Jan-2021 12:02                2344
gmagick.normalizeimage.php                         24-Jan-2021 12:02                2727
gmagick.oilpaintimage.php                          24-Jan-2021 12:02                2812
gmagick.previousimage.php                          24-Jan-2021 12:02                2410
gmagick.profileimage.php                           24-Jan-2021 12:02                3068
gmagick.quantizeimage.php                          24-Jan-2021 12:02                4796
gmagick.quantizeimages.php                         24-Jan-2021 12:02                4798
gmagick.queryfontmetrics.php                       24-Jan-2021 12:02                2631
gmagick.queryfonts.php                             24-Jan-2021 12:02                2409
gmagick.queryformats.php                           24-Jan-2021 12:02                2624
gmagick.radialblurimage.php                        24-Jan-2021 12:02                2897
gmagick.raiseimage.php                             24-Jan-2021 12:02                3801
gmagick.read.php                                   24-Jan-2021 12:02                2475
gmagick.readimage.php                              24-Jan-2021 12:02                2521
gmagick.readimageblob.php                          24-Jan-2021 12:02                2891
gmagick.readimagefile.php                          24-Jan-2021 12:02                2757
gmagick.reducenoiseimage.php                       24-Jan-2021 12:02                2867
gmagick.removeimage.php                            24-Jan-2021 12:02                2340
gmagick.removeimageprofile.php                     24-Jan-2021 12:02                2629
gmagick.requirements.php                           24-Jan-2021 12:02                1539
gmagick.resampleimage.php                          24-Jan-2021 12:02                3455
gmagick.resizeimage.php                            24-Jan-2021 12:02                3589
gmagick.rollimage.php                              24-Jan-2021 12:02                2748
gmagick.rotateimage.php                            24-Jan-2021 12:02                3020
gmagick.scaleimage.php                             24-Jan-2021 12:02                3119
gmagick.separateimagechannel.php                   24-Jan-2021 12:02                2896
gmagick.setcompressionquality.php                  24-Jan-2021 12:02                3936
gmagick.setfilename.php                            24-Jan-2021 12:02                2648
gmagick.setimagebackgroundcolor.php                24-Jan-2021 12:02                2765
gmagick.setimageblueprimary.php                    24-Jan-2021 12:02                2955
gmagick.setimagebordercolor.php                    24-Jan-2021 12:02                2731
gmagick.setimagechanneldepth.php                   24-Jan-2021 12:02                3088
gmagick.setimagecolorspace.php                     24-Jan-2021 12:02                2914
gmagick.setimagecompose.php                        24-Jan-2021 12:02                2630
gmagick.setimagedelay.php                          24-Jan-2021 12:02                2581
gmagick.setimagedepth.php                          24-Jan-2021 12:02                2579
gmagick.setimagedispose.php                        24-Jan-2021 12:02                2620
gmagick.setimagefilename.php                       24-Jan-2021 12:02                2668
gmagick.setimageformat.php                         24-Jan-2021 12:02                2634
gmagick.setimagegamma.php                          24-Jan-2021 12:02                2572
gmagick.setimagegreenprimary.php                   24-Jan-2021 12:02                2963
gmagick.setimageindex.php                          24-Jan-2021 12:02                2720
gmagick.setimageinterlacescheme.php                24-Jan-2021 12:02                2780
gmagick.setimageiterations.php                     24-Jan-2021 12:02                2672
gmagick.setimageprofile.php                        24-Jan-2021 12:02                3118
gmagick.setimageredprimary.php                     24-Jan-2021 12:02                2933
gmagick.setimagerenderingintent.php                24-Jan-2021 12:02                2818
gmagick.setimageresolution.php                     24-Jan-2021 12:02                2927
gmagick.setimagescene.php                          24-Jan-2021 12:02                2570
gmagick.setimagetype.php                           24-Jan-2021 12:02                2741
gmagick.setimageunits.php                          24-Jan-2021 12:02                2696
gmagick.setimagewhitepoint.php                     24-Jan-2021 12:02                2895
gmagick.setsamplingfactors.php                     24-Jan-2021 12:02                2711
gmagick.setsize.php                                24-Jan-2021 12:02                2861
gmagick.setup.php                                  24-Jan-2021 12:02                1357
gmagick.shearimage.php                             24-Jan-2021 12:02                3648
gmagick.solarizeimage.php                          24-Jan-2021 12:02                2827
gmagick.spreadimage.php                            24-Jan-2021 12:02                2672
gmagick.stripimage.php                             24-Jan-2021 12:02                2320
gmagick.swirlimage.php                             24-Jan-2021 12:02                2754
gmagick.thumbnailimage.php                         24-Jan-2021 12:02                3345
gmagick.trimimage.php                              24-Jan-2021 12:02                2808
gmagick.write.php                                  24-Jan-2021 12:02                1602
gmagick.writeimage.php                             24-Jan-2021 12:02                2853
gmagickdraw.annotate.php                           24-Jan-2021 12:02                2838
gmagickdraw.arc.php                                24-Jan-2021 12:02                3684
gmagickdraw.bezier.php                             24-Jan-2021 12:02                2376
gmagickdraw.ellipse.php                            24-Jan-2021 12:02                3600
gmagickdraw.getfillcolor.php                       24-Jan-2021 12:02                2268
gmagickdraw.getfillopacity.php                     24-Jan-2021 12:02                2190
gmagickdraw.getfont.php                            24-Jan-2021 12:02                2239
gmagickdraw.getfontsize.php                        24-Jan-2021 12:02                2147
gmagickdraw.getfontstyle.php                       24-Jan-2021 12:02                2191
gmagickdraw.getfontweight.php                      24-Jan-2021 12:02                2154
gmagickdraw.getstrokecolor.php                     24-Jan-2021 12:02                2325
gmagickdraw.getstrokeopacity.php                   24-Jan-2021 12:02                2189
gmagickdraw.getstrokewidth.php                     24-Jan-2021 12:02                2215
gmagickdraw.gettextdecoration.php                  24-Jan-2021 12:02                2221
gmagickdraw.gettextencoding.php                    24-Jan-2021 12:02                2359
gmagickdraw.line.php                               24-Jan-2021 12:02                3124
gmagickdraw.point.php                              24-Jan-2021 12:02                2619
gmagickdraw.polygon.php                            24-Jan-2021 12:02                2442
gmagickdraw.polyline.php                           24-Jan-2021 12:02                2476
gmagickdraw.rectangle.php                          24-Jan-2021 12:02                3219
gmagickdraw.rotate.php                             24-Jan-2021 12:02                2434
gmagickdraw.roundrectangle.php                     24-Jan-2021 12:02                3837
gmagickdraw.scale.php                              24-Jan-2021 12:02                2683
gmagickdraw.setfillcolor.php                       24-Jan-2021 12:02                2740
gmagickdraw.setfillopacity.php                     24-Jan-2021 12:02                2524
gmagickdraw.setfont.php                            24-Jan-2021 12:02                2429
gmagickdraw.setfontsize.php                        24-Jan-2021 12:02                2457
gmagickdraw.setfontstyle.php                       24-Jan-2021 12:02                2587
gmagickdraw.setfontweight.php                      24-Jan-2021 12:02                2457
gmagickdraw.setstrokecolor.php                     24-Jan-2021 12:02                2762
gmagickdraw.setstrokeopacity.php                   24-Jan-2021 12:02                2540
gmagickdraw.setstrokewidth.php                     24-Jan-2021 12:02                2502
gmagickdraw.settextdecoration.php                  24-Jan-2021 12:02                2585
gmagickdraw.settextencoding.php                    24-Jan-2021 12:02                2793
gmagickpixel.construct.php                         24-Jan-2021 12:02                2492
gmagickpixel.getcolor.php                          24-Jan-2021 12:02                3435
gmagickpixel.getcolorcount.php                     24-Jan-2021 12:02                2220
gmagickpixel.getcolorvalue.php                     24-Jan-2021 12:02                2588
gmagickpixel.setcolor.php                          24-Jan-2021 12:02                2599
gmagickpixel.setcolorvalue.php                     24-Jan-2021 12:02                2909
gmp.configuration.php                              24-Jan-2021 12:02                1076
gmp.constants.php                                  24-Jan-2021 12:02                2947
gmp.examples.php                                   24-Jan-2021 12:02                3136
gmp.installation.php                               24-Jan-2021 12:02                1193
gmp.requirements.php                               24-Jan-2021 12:02                1518
gmp.resources.php                                  24-Jan-2021 12:02                1202
gmp.setup.php                                      24-Jan-2021 12:02                1383
gnupg.configuration.php                            24-Jan-2021 12:02                1088
gnupg.constants.php                                24-Jan-2021 12:02                6253
gnupg.examples-clearsign.php                       24-Jan-2021 12:02                6617
gnupg.examples.php                                 24-Jan-2021 12:02                1238
gnupg.installation.php                             24-Jan-2021 12:02                1375
gnupg.requirements.php                             24-Jan-2021 12:02                1130
gnupg.resources.php                                24-Jan-2021 12:02                1045
gnupg.setup.php                                    24-Jan-2021 12:02                1408
hash.configuration.php                             24-Jan-2021 12:02                1082
hash.constants.php                                 24-Jan-2021 12:02                1473
hash.installation.php                              24-Jan-2021 12:02                1480
hash.requirements.php                              24-Jan-2021 12:02                1053
hash.resources.php                                 24-Jan-2021 12:02                1195
hash.setup.php                                     24-Jan-2021 12:02                1390
history.php                                        24-Jan-2021 12:02                1789
history.php.books.php                              24-Jan-2021 12:02                2155
history.php.php                                    24-Jan-2021 12:02                6113
history.php.publications.php                       24-Jan-2021 12:02                1623
history.php.related.php                            24-Jan-2021 12:02                5338
hrtime-performancecounter.getfrequency.php         24-Jan-2021 12:02                2468
hrtime-performancecounter.getticks.php             24-Jan-2021 12:02                2349
hrtime-performancecounter.gettickssince.php        24-Jan-2021 12:02                2612
hrtime-stopwatch.getelapsedticks.php               24-Jan-2021 12:02                2249
hrtime-stopwatch.getelapsedtime.php                24-Jan-2021 12:02                2615
hrtime-stopwatch.getlastelapsedticks.php           24-Jan-2021 12:02                2317
hrtime-stopwatch.getlastelapsedtime.php            24-Jan-2021 12:02                2635
hrtime-stopwatch.isrunning.php                     24-Jan-2021 12:02                2218
hrtime-stopwatch.start.php                         24-Jan-2021 12:02                2216
hrtime-stopwatch.stop.php                          24-Jan-2021 12:02                2096
hrtime.example.basic.php                           24-Jan-2021 12:02                5872
hrtime.examples.php                                24-Jan-2021 12:02                1225
hrtime.installation.php                            24-Jan-2021 12:02                1771
hrtime.setup.php                                   24-Jan-2021 12:02                1223
ibase.configuration.php                            24-Jan-2021 12:02                6933
ibase.constants.php                                24-Jan-2021 12:02               17965
ibase.installation.php                             24-Jan-2021 12:02                2972
ibase.requirements.php                             24-Jan-2021 12:02                1027
ibase.resources.php                                24-Jan-2021 12:02                1045
ibase.setup.php                                    24-Jan-2021 12:02                1426
ibm-db2.configuration.php                          24-Jan-2021 12:02                9117
ibm-db2.constants.php                              24-Jan-2021 12:02                6638
ibm-db2.installation.php                           24-Jan-2021 12:02                3391
ibm-db2.requirements.php                           24-Jan-2021 12:02                3067
ibm-db2.resources.php                              24-Jan-2021 12:02                1129
ibm-db2.setup.php                                  24-Jan-2021 12:02                1436
iconv.configuration.php                            24-Jan-2021 12:02                4319
iconv.constants.php                                24-Jan-2021 12:02                3093
iconv.installation.php                             24-Jan-2021 12:02                1347
iconv.requirements.php                             24-Jan-2021 12:02                1288
iconv.resources.php                                24-Jan-2021 12:02                1045
iconv.setup.php                                    24-Jan-2021 12:02                1418
image.configuration.php                            24-Jan-2021 12:02                2941
image.constants.php                                24-Jan-2021 12:02               39910
image.examples-png.php                             24-Jan-2021 12:02                4714
image.examples-watermark.php                       24-Jan-2021 12:02                5743
image.examples.merged-watermark.php                24-Jan-2021 12:02                8595
image.examples.php                                 24-Jan-2021 12:02                1452
image.installation.php                             24-Jan-2021 12:02                5187
image.requirements.php                             24-Jan-2021 12:02                5060
image.resources.php                                24-Jan-2021 12:02                2452
image.setup.php                                    24-Jan-2021 12:02                1415
imagick.adaptiveblurimage.php                      24-Jan-2021 12:02                6477
imagick.adaptiveresizeimage.php                    24-Jan-2021 12:02                8472
imagick.adaptivesharpenimage.php                   24-Jan-2021 12:02                6104
imagick.adaptivethresholdimage.php                 24-Jan-2021 12:02                6020
imagick.addimage.php                               24-Jan-2021 12:02                2676
imagick.addnoiseimage.php                          24-Jan-2021 12:02                5288
imagick.affinetransformimage.php                   24-Jan-2021 12:02                6851
imagick.animateimages.php                          24-Jan-2021 12:02                2856
imagick.annotateimage.php                          24-Jan-2021 12:02                8406
imagick.appendimages.php                           24-Jan-2021 12:02                6570
imagick.autolevelimage.php                         24-Jan-2021 12:02                4253
imagick.averageimages.php                          24-Jan-2021 12:02                2389
imagick.blackthresholdimage.php                    24-Jan-2021 12:02                5220
imagick.blueshiftimage.php                         24-Jan-2021 12:02                4322
imagick.blurimage.php                              24-Jan-2021 12:02                5433
imagick.borderimage.php                            24-Jan-2021 12:02                5894
imagick.brightnesscontrastimage.php                24-Jan-2021 12:02                5373
imagick.charcoalimage.php                          24-Jan-2021 12:02                4794
imagick.chopimage.php                              24-Jan-2021 12:02                6647
imagick.clampimage.php                             24-Jan-2021 12:02                2342
imagick.clear.php                                  24-Jan-2021 12:02                1859
imagick.clipimage.php                              24-Jan-2021 12:02                2086
imagick.clipimagepath.php                          24-Jan-2021 12:02                2800
imagick.clippathimage.php                          24-Jan-2021 12:02                3111
imagick.clone.php                                  24-Jan-2021 12:02                3962
imagick.clutimage.php                              24-Jan-2021 12:02                5817
imagick.coalesceimages.php                         24-Jan-2021 12:02                2487
imagick.colorfloodfillimage.php                    24-Jan-2021 12:02                4971
imagick.colorizeimage.php                          24-Jan-2021 12:02                6832
imagick.colormatriximage.php                       24-Jan-2021 12:02                8279
imagick.combineimages.php                          24-Jan-2021 12:02                3116
imagick.commentimage.php                           24-Jan-2021 12:02                4820
imagick.compareimagechannels.php                   24-Jan-2021 12:02                3656
imagick.compareimagelayers.php                     24-Jan-2021 12:02                5337
imagick.compareimages.php                          24-Jan-2021 12:02                5475
imagick.compositeimage.php                         24-Jan-2021 12:02                4072
imagick.configuration.php                          24-Jan-2021 12:02                3820
imagick.constants.php                              24-Jan-2021 12:02              104256
imagick.construct.php                              24-Jan-2021 12:02                2698
imagick.contrastimage.php                          24-Jan-2021 12:02                4941
imagick.contraststretchimage.php                   24-Jan-2021 12:02                3464
imagick.convolveimage.php                          24-Jan-2021 12:02                5853
imagick.count.php                                  24-Jan-2021 12:02                2483
imagick.cropimage.php                              24-Jan-2021 12:02                5719
imagick.cropthumbnailimage.php                     24-Jan-2021 12:02                2790
imagick.current.php                                24-Jan-2021 12:02                2162
imagick.cyclecolormapimage.php                     24-Jan-2021 12:02                2695
imagick.decipherimage.php                          24-Jan-2021 12:02                2948
imagick.deconstructimages.php                      24-Jan-2021 12:02                2297
imagick.deleteimageartifact.php                    24-Jan-2021 12:02                3357
imagick.deleteimageproperty.php                    24-Jan-2021 12:02                2334
imagick.deskewimage.php                            24-Jan-2021 12:02               11521
imagick.despeckleimage.php                         24-Jan-2021 12:02                3946
imagick.destroy.php                                24-Jan-2021 12:02                1993
imagick.displayimage.php                           24-Jan-2021 12:02                2496
imagick.displayimages.php                          24-Jan-2021 12:02                2539
imagick.distortimage.php                           24-Jan-2021 12:02               12744
imagick.drawimage.php                              24-Jan-2021 12:02                2422
imagick.edgeimage.php                              24-Jan-2021 12:02                4504
imagick.embossimage.php                            24-Jan-2021 12:02                5159
imagick.encipherimage.php                          24-Jan-2021 12:02                2944
imagick.enhanceimage.php                           24-Jan-2021 12:02                3917
imagick.equalizeimage.php                          24-Jan-2021 12:02                3882
imagick.evaluateimage.php                          24-Jan-2021 12:02                5640
imagick.examples-1.php                             24-Jan-2021 12:02               32411
imagick.examples.php                               24-Jan-2021 12:02                1238
imagick.exportimagepixels.php                      24-Jan-2021 12:02                7354
imagick.extentimage.php                            24-Jan-2021 12:02                4711
imagick.filter.php                                 24-Jan-2021 12:02                7669
imagick.flattenimages.php                          24-Jan-2021 12:02                2442
imagick.flipimage.php                              24-Jan-2021 12:02                3899
imagick.floodfillpaintimage.php                    24-Jan-2021 12:02               11233
imagick.flopimage.php                              24-Jan-2021 12:02                3929
imagick.forwardfouriertransformimage.php           24-Jan-2021 12:02               12861
imagick.frameimage.php                             24-Jan-2021 12:02                8245
imagick.functionimage.php                          24-Jan-2021 12:02               13511
imagick.fximage.php                                24-Jan-2021 12:02                5991
imagick.gammaimage.php                             24-Jan-2021 12:02                5502
imagick.gaussianblurimage.php                      24-Jan-2021 12:02                5991
imagick.getcolorspace.php                          24-Jan-2021 12:02                2055
imagick.getcompression.php                         24-Jan-2021 12:02                1907
imagick.getcompressionquality.php                  24-Jan-2021 12:02                1971
imagick.getcopyright.php                           24-Jan-2021 12:02                2016
imagick.getfilename.php                            24-Jan-2021 12:02                2075
imagick.getfont.php                                24-Jan-2021 12:02                2688
imagick.getformat.php                              24-Jan-2021 12:02                2037
imagick.getgravity.php                             24-Jan-2021 12:02                2044
imagick.gethomeurl.php                             24-Jan-2021 12:02                1893
imagick.getimage.php                               24-Jan-2021 12:02                2145
imagick.getimagealphachannel.php                   24-Jan-2021 12:02                2468
imagick.getimageartifact.php                       24-Jan-2021 12:02                3306
imagick.getimageattribute.php                      24-Jan-2021 12:02                2543
imagick.getimagebackgroundcolor.php                24-Jan-2021 12:02                2277
imagick.getimageblob.php                           24-Jan-2021 12:02                2329
imagick.getimageblueprimary.php                    24-Jan-2021 12:02                2710
imagick.getimagebordercolor.php                    24-Jan-2021 12:02                2241
imagick.getimagechanneldepth.php                   24-Jan-2021 12:02                2827
imagick.getimagechanneldistortion.php              24-Jan-2021 12:02                3734
imagick.getimagechanneldistortions.php             24-Jan-2021 12:02                3991
imagick.getimagechannelextrema.php                 24-Jan-2021 12:02                3319
imagick.getimagechannelkurtosis.php                24-Jan-2021 12:02                3249
imagick.getimagechannelmean.php                    24-Jan-2021 12:02                3011
imagick.getimagechannelrange.php                   24-Jan-2021 12:02                3105
imagick.getimagechannelstatistics.php              24-Jan-2021 12:02                2163
imagick.getimageclipmask.php                       24-Jan-2021 12:02                2607
imagick.getimagecolormapcolor.php                  24-Jan-2021 12:02                2719
imagick.getimagecolors.php                         24-Jan-2021 12:02                1993
imagick.getimagecolorspace.php                     24-Jan-2021 12:02                2030
imagick.getimagecompose.php                        24-Jan-2021 12:02                1989
imagick.getimagecompression.php                    24-Jan-2021 12:02                1985
imagick.getimagecompressionquality.php             24-Jan-2021 12:02                2069
imagick.getimagedelay.php                          24-Jan-2021 12:02                2066
imagick.getimagedepth.php                          24-Jan-2021 12:02                1846
imagick.getimagedispose.php                        24-Jan-2021 12:02                2102
imagick.getimagedistortion.php                     24-Jan-2021 12:02                3066
imagick.getimageextrema.php                        24-Jan-2021 12:02                2490
imagick.getimagefilename.php                       24-Jan-2021 12:02                2172
imagick.getimageformat.php                         24-Jan-2021 12:02                2158
imagick.getimagegamma.php                          24-Jan-2021 12:02                2061
imagick.getimagegeometry.php                       24-Jan-2021 12:02                3764
imagick.getimagegravity.php                        24-Jan-2021 12:02                2323
imagick.getimagegreenprimary.php                   24-Jan-2021 12:02                2313
imagick.getimageheight.php                         24-Jan-2021 12:02                2090
imagick.getimagehistogram.php                      24-Jan-2021 12:02               19412
imagick.getimageindex.php                          24-Jan-2021 12:02                2601
imagick.getimageinterlacescheme.php                24-Jan-2021 12:02                2083
imagick.getimageinterpolatemethod.php              24-Jan-2021 12:02                2337
imagick.getimageiterations.php                     24-Jan-2021 12:02                2140
imagick.getimagelength.php                         24-Jan-2021 12:02                3062
imagick.getimagematte.php                          24-Jan-2021 12:02                2315
imagick.getimagemattecolor.php                     24-Jan-2021 12:02                2457
imagick.getimagemimetype.php                       24-Jan-2021 12:02                2061
imagick.getimageorientation.php                    24-Jan-2021 12:02                2246
imagick.getimagepage.php                           24-Jan-2021 12:02                2321
imagick.getimagepixelcolor.php                     24-Jan-2021 12:02                2924
imagick.getimageprofile.php                        24-Jan-2021 12:02                2555
imagick.getimageprofiles.php                       24-Jan-2021 12:02                3079
imagick.getimageproperties.php                     24-Jan-2021 12:02                5503
imagick.getimageproperty.php                       24-Jan-2021 12:02                4732
imagick.getimageredprimary.php                     24-Jan-2021 12:02                2354
imagick.getimageregion.php                         24-Jan-2021 12:02                3511
imagick.getimagerenderingintent.php                24-Jan-2021 12:02                2258
imagick.getimageresolution.php                     24-Jan-2021 12:02                2092
imagick.getimagesblob.php                          24-Jan-2021 12:02                2169
imagick.getimagescene.php                          24-Jan-2021 12:02                2048
imagick.getimagesignature.php                      24-Jan-2021 12:02                2167
imagick.getimagesize.php                           24-Jan-2021 12:02                2281
imagick.getimagetickspersecond.php                 24-Jan-2021 12:02                2172
imagick.getimagetotalinkdensity.php                24-Jan-2021 12:02                2073
imagick.getimagetype.php                           24-Jan-2021 12:02                3681
imagick.getimageunits.php                          24-Jan-2021 12:02                2049
imagick.getimagevirtualpixelmethod.php             24-Jan-2021 12:02                2235
imagick.getimagewhitepoint.php                     24-Jan-2021 12:02                2301
imagick.getimagewidth.php                          24-Jan-2021 12:02                2066
imagick.getinterlacescheme.php                     24-Jan-2021 12:02                2202
imagick.getiteratorindex.php                       24-Jan-2021 12:02                5794
imagick.getnumberimages.php                        24-Jan-2021 12:02                2153
imagick.getoption.php                              24-Jan-2021 12:02                2539
imagick.getpackagename.php                         24-Jan-2021 12:02                2126
imagick.getpage.php                                24-Jan-2021 12:02                2159
imagick.getpixeliterator.php                       24-Jan-2021 12:02                6508
imagick.getpixelregioniterator.php                 24-Jan-2021 12:02                6540
imagick.getpointsize.php                           24-Jan-2021 12:02                2356
imagick.getquantum.php                             24-Jan-2021 12:02                2030
imagick.getquantumdepth.php                        24-Jan-2021 12:02                2241
imagick.getquantumrange.php                        24-Jan-2021 12:02                2381
imagick.getregistry.php                            24-Jan-2021 12:02                2267
imagick.getreleasedate.php                         24-Jan-2021 12:02                2150
imagick.getresource.php                            24-Jan-2021 12:02                2698
imagick.getresourcelimit.php                       24-Jan-2021 12:02                3115
imagick.getsamplingfactors.php                     24-Jan-2021 12:02                2208
imagick.getsize.php                                24-Jan-2021 12:02                5545
imagick.getsizeoffset.php                          24-Jan-2021 12:02                2175
imagick.getversion.php                             24-Jan-2021 12:02                2150
imagick.haldclutimage.php                          24-Jan-2021 12:02                5905
imagick.hasnextimage.php                           24-Jan-2021 12:02                2132
imagick.haspreviousimage.php                       24-Jan-2021 12:02                2162
imagick.identifyformat.php                         24-Jan-2021 12:02                4386
imagick.identifyimage.php                          24-Jan-2021 12:02                3730
imagick.implodeimage.php                           24-Jan-2021 12:02                4486
imagick.importimagepixels.php                      24-Jan-2021 12:02               11353
imagick.installation.php                           24-Jan-2021 12:02                1926
imagick.inversefouriertransformimage.php           24-Jan-2021 12:02                3116
imagick.labelimage.php                             24-Jan-2021 12:02                2301
imagick.levelimage.php                             24-Jan-2021 12:02                7475
imagick.linearstretchimage.php                     24-Jan-2021 12:02                5532
imagick.liquidrescaleimage.php                     24-Jan-2021 12:02                3941
imagick.listregistry.php                           24-Jan-2021 12:02                2147
imagick.magnifyimage.php                           24-Jan-2021 12:02                3920
imagick.mapimage.php                               24-Jan-2021 12:02                2946
imagick.mattefloodfillimage.php                    24-Jan-2021 12:02                5147
imagick.medianfilterimage.php                      24-Jan-2021 12:02                4952
imagick.mergeimagelayers.php                       24-Jan-2021 12:02                6465
imagick.minifyimage.php                            24-Jan-2021 12:02                1965
imagick.modulateimage.php                          24-Jan-2021 12:02                5385
imagick.montageimage.php                           24-Jan-2021 12:02                4012
imagick.morphimages.php                            24-Jan-2021 12:02                2591
imagick.morphology.php                             24-Jan-2021 12:02               76208
imagick.mosaicimages.php                           24-Jan-2021 12:02                2349
imagick.motionblurimage.php                        24-Jan-2021 12:02                6404
imagick.negateimage.php                            24-Jan-2021 12:02                5350
imagick.newimage.php                               24-Jan-2021 12:02                7106
imagick.newpseudoimage.php                         24-Jan-2021 12:02                5584
imagick.nextimage.php                              24-Jan-2021 12:02                1901
imagick.normalizeimage.php                         24-Jan-2021 12:02                6352
imagick.oilpaintimage.php                          24-Jan-2021 12:02                4443
imagick.opaquepaintimage.php                       24-Jan-2021 12:02                4412
imagick.optimizeimagelayers.php                    24-Jan-2021 12:02                4978
imagick.orderedposterizeimage.php                  24-Jan-2021 12:02                6626
imagick.paintfloodfillimage.php                    24-Jan-2021 12:02                5147
imagick.paintopaqueimage.php                       24-Jan-2021 12:02                4999
imagick.painttransparentimage.php                  24-Jan-2021 12:02                4323
imagick.pingimage.php                              24-Jan-2021 12:02                2424
imagick.pingimageblob.php                          24-Jan-2021 12:02                5889
imagick.pingimagefile.php                          24-Jan-2021 12:02                5605
imagick.polaroidimage.php                          24-Jan-2021 12:02                4545
imagick.posterizeimage.php                         24-Jan-2021 12:02                5464
imagick.previewimages.php                          24-Jan-2021 12:02                2819
imagick.previousimage.php                          24-Jan-2021 12:02                1947
imagick.profileimage.php                           24-Jan-2021 12:02                2913
imagick.quantizeimage.php                          24-Jan-2021 12:02                6242
imagick.quantizeimages.php                         24-Jan-2021 12:02                3393
imagick.queryfontmetrics.php                       24-Jan-2021 12:02                5452
imagick.queryfonts.php                             24-Jan-2021 12:02                4892
imagick.queryformats.php                           24-Jan-2021 12:02                8115
imagick.radialblurimage.php                        24-Jan-2021 12:02                5391
imagick.raiseimage.php                             24-Jan-2021 12:02                6102
imagick.randomthresholdimage.php                   24-Jan-2021 12:02                6307
imagick.readimage.php                              24-Jan-2021 12:02                2266
imagick.readimageblob.php                          24-Jan-2021 12:02                5670
imagick.readimagefile.php                          24-Jan-2021 12:02                2796
imagick.readimages.php                             24-Jan-2021 12:02                2287
imagick.recolorimage.php                           24-Jan-2021 12:02                6463
imagick.reducenoiseimage.php                       24-Jan-2021 12:02                5003
imagick.remapimage.php                             24-Jan-2021 12:02                3134
imagick.removeimage.php                            24-Jan-2021 12:02                2088
imagick.removeimageprofile.php                     24-Jan-2021 12:02                2547
imagick.render.php                                 24-Jan-2021 12:02                1870
imagick.requirements.php                           24-Jan-2021 12:02                1813
imagick.resampleimage.php                          24-Jan-2021 12:02                5216
imagick.resetimagepage.php                         24-Jan-2021 12:02                2488
imagick.resizeimage.php                            24-Jan-2021 12:02               11477
imagick.resources.php                              24-Jan-2021 12:02                1057
imagick.rollimage.php                              24-Jan-2021 12:02                4605
imagick.rotateimage.php                            24-Jan-2021 12:02                5574
imagick.rotationalblurimage.php                    24-Jan-2021 12:02                5463
imagick.roundcorners.php                           24-Jan-2021 12:02                5983
imagick.sampleimage.php                            24-Jan-2021 12:02                2639
imagick.scaleimage.php                             24-Jan-2021 12:02                6369
imagick.segmentimage.php                           24-Jan-2021 12:02                6355
imagick.selectiveblurimage.php                     24-Jan-2021 12:02                6081
imagick.separateimagechannel.php                   24-Jan-2021 12:02                5223
imagick.sepiatoneimage.php                         24-Jan-2021 12:02                4720
imagick.setbackgroundcolor.php                     24-Jan-2021 12:02                3057
imagick.setcolorspace.php                          24-Jan-2021 12:02                2680
imagick.setcompression.php                         24-Jan-2021 12:02                2480
imagick.setcompressionquality.php                  24-Jan-2021 12:02                7150
imagick.setfilename.php                            24-Jan-2021 12:02                2351
imagick.setfirstiterator.php                       24-Jan-2021 12:02                1936
imagick.setfont.php                                24-Jan-2021 12:02                5395
imagick.setformat.php                              24-Jan-2021 12:02                2255
imagick.setgravity.php                             24-Jan-2021 12:02                2466
imagick.setimage.php                               24-Jan-2021 12:02                4585
imagick.setimagealphachannel.php                   24-Jan-2021 12:02                3361
imagick.setimageartifact.php                       24-Jan-2021 12:02                7226
imagick.setimageattribute.php                      24-Jan-2021 12:02                2905
imagick.setimagebackgroundcolor.php                24-Jan-2021 12:02                3281
imagick.setimagebias.php                           24-Jan-2021 12:02                6885
imagick.setimagebiasquantum.php                    24-Jan-2021 12:02                2656
imagick.setimageblueprimary.php                    24-Jan-2021 12:02                2810
imagick.setimagebordercolor.php                    24-Jan-2021 12:02                3263
imagick.setimagechanneldepth.php                   24-Jan-2021 12:02                2826
imagick.setimageclipmask.php                       24-Jan-2021 12:02                9220
imagick.setimagecolormapcolor.php                  24-Jan-2021 12:02                2906
imagick.setimagecolorspace.php                     24-Jan-2021 12:02                2922
imagick.setimagecompose.php                        24-Jan-2021 12:02                2644
imagick.setimagecompression.php                    24-Jan-2021 12:02                2574
imagick.setimagecompressionquality.php             24-Jan-2021 12:02                2618
imagick.setimagedelay.php                          24-Jan-2021 12:02                6174
imagick.setimagedepth.php                          24-Jan-2021 12:02                2464
imagick.setimagedispose.php                        24-Jan-2021 12:02                2506
imagick.setimageextent.php                         24-Jan-2021 12:02                2732
imagick.setimagefilename.php                       24-Jan-2021 12:02                2555
imagick.setimageformat.php                         24-Jan-2021 12:02                2368
imagick.setimagegamma.php                          24-Jan-2021 12:02                2468
imagick.setimagegravity.php                        24-Jan-2021 12:02                2626
imagick.setimagegreenprimary.php                   24-Jan-2021 12:02                2802
imagick.setimageindex.php                          24-Jan-2021 12:02                3054
imagick.setimageinterlacescheme.php                24-Jan-2021 12:02                2618
imagick.setimageinterpolatemethod.php              24-Jan-2021 12:02                2543
imagick.setimageiterations.php                     24-Jan-2021 12:02                4755
imagick.setimagematte.php                          24-Jan-2021 12:02                2448
imagick.setimagemattecolor.php                     24-Jan-2021 12:02                3465
imagick.setimageopacity.php                        24-Jan-2021 12:02                4791
imagick.setimageorientation.php                    24-Jan-2021 12:02                4566
imagick.setimagepage.php                           24-Jan-2021 12:02                3160
imagick.setimageprofile.php                        24-Jan-2021 12:02                2946
imagick.setimageproperty.php                       24-Jan-2021 12:02                4846
imagick.setimageredprimary.php                     24-Jan-2021 12:02                2800
imagick.setimagerenderingintent.php                24-Jan-2021 12:02                2624
imagick.setimageresolution.php                     24-Jan-2021 12:02                4799
imagick.setimagescene.php                          24-Jan-2021 12:02                2488
imagick.setimagetickspersecond.php                 24-Jan-2021 12:02                8158
imagick.setimagetype.php                           24-Jan-2021 12:02                2287
imagick.setimageunits.php                          24-Jan-2021 12:02                2322
imagick.setimagevirtualpixelmethod.php             24-Jan-2021 12:02                2429
imagick.setimagewhitepoint.php                     24-Jan-2021 12:02                2798
imagick.setinterlacescheme.php                     24-Jan-2021 12:02                2365
imagick.setiteratorindex.php                       24-Jan-2021 12:02                6037
imagick.setlastiterator.php                        24-Jan-2021 12:02                1952
imagick.setoption.php                              24-Jan-2021 12:02               12779
imagick.setpage.php                                24-Jan-2021 12:02                2918
imagick.setpointsize.php                           24-Jan-2021 12:02                5085
imagick.setprogressmonitor.php                     24-Jan-2021 12:02               12646
imagick.setregistry.php                            24-Jan-2021 12:02                2673
imagick.setresolution.php                          24-Jan-2021 12:02                3439
imagick.setresourcelimit.php                       24-Jan-2021 12:02                3343
imagick.setsamplingfactors.php                     24-Jan-2021 12:02                7001
imagick.setsize.php                                24-Jan-2021 12:02                2557
imagick.setsizeoffset.php                          24-Jan-2021 12:02                2985
imagick.settype.php                                24-Jan-2021 12:02                2238
imagick.setup.php                                  24-Jan-2021 12:02                1431
imagick.shadeimage.php                             24-Jan-2021 12:02                5362
imagick.shadowimage.php                            24-Jan-2021 12:02                5029
imagick.sharpenimage.php                           24-Jan-2021 12:02                5371
imagick.shaveimage.php                             24-Jan-2021 12:02                4536
imagick.shearimage.php                             24-Jan-2021 12:02                6315
imagick.sigmoidalcontrastimage.php                 24-Jan-2021 12:02                7565
imagick.sketchimage.php                            24-Jan-2021 12:02                5581
imagick.smushimages.php                            24-Jan-2021 12:02                5704
imagick.solarizeimage.php                          24-Jan-2021 12:02                4696
imagick.sparsecolorimage.php                       24-Jan-2021 12:02               31118
imagick.spliceimage.php                            24-Jan-2021 12:02                5417
imagick.spreadimage.php                            24-Jan-2021 12:02                4498
imagick.statisticimage.php                         24-Jan-2021 12:02                6490
imagick.steganoimage.php                           24-Jan-2021 12:02                2821
imagick.stereoimage.php                            24-Jan-2021 12:02                2599
imagick.stripimage.php                             24-Jan-2021 12:02                2036
imagick.subimagematch.php                          24-Jan-2021 12:02                7552
imagick.swirlimage.php                             24-Jan-2021 12:02                4551
imagick.textureimage.php                           24-Jan-2021 12:02                6272
imagick.thresholdimage.php                         24-Jan-2021 12:02                5071
imagick.thumbnailimage.php                         24-Jan-2021 12:02                6792
imagick.tintimage.php                              24-Jan-2021 12:02                7875
imagick.tostring.php                               24-Jan-2021 12:02                2765
imagick.transformimage.php                         24-Jan-2021 12:02                5834
imagick.transformimagecolorspace.php               24-Jan-2021 12:02                8045
imagick.transparentpaintimage.php                  24-Jan-2021 12:02                7057
imagick.transposeimage.php                         24-Jan-2021 12:02                4272
imagick.transverseimage.php                        24-Jan-2021 12:02                4260
imagick.trimimage.php                              24-Jan-2021 12:02                5566
imagick.uniqueimagecolors.php                      24-Jan-2021 12:02                5314
imagick.unsharpmaskimage.php                       24-Jan-2021 12:02                6225
imagick.valid.php                                  24-Jan-2021 12:02                1852
imagick.vignetteimage.php                          24-Jan-2021 12:02                6202
imagick.waveimage.php                              24-Jan-2021 12:02                6166
imagick.whitethresholdimage.php                    24-Jan-2021 12:02                5128
imagick.writeimage.php                             24-Jan-2021 12:02                2668
imagick.writeimagefile.php                         24-Jan-2021 12:02                2651
imagick.writeimages.php                            24-Jan-2021 12:02                2534
imagick.writeimagesfile.php                        24-Jan-2021 12:02                2699
imagickdraw.affine.php                             24-Jan-2021 12:02               18543
imagickdraw.annotation.php                         24-Jan-2021 12:02                2940
imagickdraw.arc.php                                24-Jan-2021 12:02                9583
imagickdraw.bezier.php                             24-Jan-2021 12:02               19465
imagickdraw.circle.php                             24-Jan-2021 12:02                8989
imagickdraw.clear.php                              24-Jan-2021 12:02                2050
imagickdraw.clone.php                              24-Jan-2021 12:02                2164
imagickdraw.color.php                              24-Jan-2021 12:02                2980
imagickdraw.comment.php                            24-Jan-2021 12:02                2429
imagickdraw.composite.php                          24-Jan-2021 12:02               11743
imagickdraw.construct.php                          24-Jan-2021 12:02                1971
imagickdraw.destroy.php                            24-Jan-2021 12:02                2017
imagickdraw.ellipse.php                            24-Jan-2021 12:02               12175
imagickdraw.getclippath.php                        24-Jan-2021 12:02                2096
imagickdraw.getcliprule.php                        24-Jan-2021 12:02                2099
imagickdraw.getclipunits.php                       24-Jan-2021 12:02                2078
imagickdraw.getfillcolor.php                       24-Jan-2021 12:02                2147
imagickdraw.getfillopacity.php                     24-Jan-2021 12:02                2129
imagickdraw.getfillrule.php                        24-Jan-2021 12:02                2051
imagickdraw.getfont.php                            24-Jan-2021 12:02                2067
imagickdraw.getfontfamily.php                      24-Jan-2021 12:02                2121
imagickdraw.getfontsize.php                        24-Jan-2021 12:02                2116
imagickdraw.getfontstretch.php                     24-Jan-2021 12:02                2125
imagickdraw.getfontstyle.php                       24-Jan-2021 12:02                2153
imagickdraw.getfontweight.php                      24-Jan-2021 12:02                2097
imagickdraw.getgravity.php                         24-Jan-2021 12:02                2127
imagickdraw.getstrokeantialias.php                 24-Jan-2021 12:02                2381
imagickdraw.getstrokecolor.php                     24-Jan-2021 12:02                2536
imagickdraw.getstrokedasharray.php                 24-Jan-2021 12:02                2252
imagickdraw.getstrokedashoffset.php                24-Jan-2021 12:02                2225
imagickdraw.getstrokelinecap.php                   24-Jan-2021 12:02                2251
imagickdraw.getstrokelinejoin.php                  24-Jan-2021 12:02                2277
imagickdraw.getstrokemiterlimit.php                24-Jan-2021 12:02                2487
imagickdraw.getstrokeopacity.php                   24-Jan-2021 12:02                2148
imagickdraw.getstrokewidth.php                     24-Jan-2021 12:02                2163
imagickdraw.gettextalignment.php                   24-Jan-2021 12:02                2150
imagickdraw.gettextantialias.php                   24-Jan-2021 12:02                2264
imagickdraw.gettextdecoration.php                  24-Jan-2021 12:02                2175
imagickdraw.gettextencoding.php                    24-Jan-2021 12:02                2221
imagickdraw.gettextinterlinespacing.php            24-Jan-2021 12:02                2176
imagickdraw.gettextinterwordspacing.php            24-Jan-2021 12:02                2204
imagickdraw.gettextkerning.php                     24-Jan-2021 12:02                2118
imagickdraw.gettextundercolor.php                  24-Jan-2021 12:02                2245
imagickdraw.getvectorgraphics.php                  24-Jan-2021 12:02                2232
imagickdraw.line.php                               24-Jan-2021 12:02                8165
imagickdraw.matte.php                              24-Jan-2021 12:02                8133
imagickdraw.pathclose.php                          24-Jan-2021 12:02                2223
imagickdraw.pathcurvetoabsolute.php                24-Jan-2021 12:02                4200
imagickdraw.pathcurvetoquadraticbezierabsolute.php 24-Jan-2021 12:02               11950
imagickdraw.pathcurvetoquadraticbezierrelative.php 24-Jan-2021 12:02                3720
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 24-Jan-2021 12:02               10663
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 24-Jan-2021 12:02               10765
imagickdraw.pathcurvetorelative.php                24-Jan-2021 12:02                4216
imagickdraw.pathcurvetosmoothabsolute.php          24-Jan-2021 12:02                4101
imagickdraw.pathcurvetosmoothrelative.php          24-Jan-2021 12:02                4108
imagickdraw.pathellipticarcabsolute.php            24-Jan-2021 12:02                4774
imagickdraw.pathellipticarcrelative.php            24-Jan-2021 12:02                4744
imagickdraw.pathfinish.php                         24-Jan-2021 12:02                2055
imagickdraw.pathlinetoabsolute.php                 24-Jan-2021 12:02                2874
imagickdraw.pathlinetohorizontalabsolute.php       24-Jan-2021 12:02                2764
imagickdraw.pathlinetohorizontalrelative.php       24-Jan-2021 12:02                2759
imagickdraw.pathlinetorelative.php                 24-Jan-2021 12:02                2924
imagickdraw.pathlinetoverticalabsolute.php         24-Jan-2021 12:02                2730
imagickdraw.pathlinetoverticalrelative.php         24-Jan-2021 12:02                2735
imagickdraw.pathmovetoabsolute.php                 24-Jan-2021 12:02                2921
imagickdraw.pathmovetorelative.php                 24-Jan-2021 12:02                2857
imagickdraw.pathstart.php                          24-Jan-2021 12:02               12313
imagickdraw.point.php                              24-Jan-2021 12:02                6911
imagickdraw.polygon.php                            24-Jan-2021 12:02                9341
imagickdraw.polyline.php                           24-Jan-2021 12:02                9334
imagickdraw.pop.php                                24-Jan-2021 12:02                2334
imagickdraw.popclippath.php                        24-Jan-2021 12:02                2013
imagickdraw.popdefs.php                            24-Jan-2021 12:02                7945
imagickdraw.poppattern.php                         24-Jan-2021 12:02                2102
imagickdraw.push.php                               24-Jan-2021 12:02                8483
imagickdraw.pushclippath.php                       24-Jan-2021 12:02                2558
imagickdraw.pushdefs.php                           24-Jan-2021 12:02                2226
imagickdraw.pushpattern.php                        24-Jan-2021 12:02               14936
imagickdraw.rectangle.php                          24-Jan-2021 12:02                8401
imagickdraw.render.php                             24-Jan-2021 12:02                2148
imagickdraw.resetvectorgraphics.php                24-Jan-2021 12:02                2140
imagickdraw.rotate.php                             24-Jan-2021 12:02                7851
imagickdraw.roundrectangle.php                     24-Jan-2021 12:02                9062
imagickdraw.scale.php                              24-Jan-2021 12:02                8154
imagickdraw.setclippath.php                        24-Jan-2021 12:02                8587
imagickdraw.setcliprule.php                        24-Jan-2021 12:02                9550
imagickdraw.setclipunits.php                       24-Jan-2021 12:02                9036
imagickdraw.setfillalpha.php                       24-Jan-2021 12:02                7862
imagickdraw.setfillcolor.php                       24-Jan-2021 12:02                7937
imagickdraw.setfillopacity.php                     24-Jan-2021 12:02                7923
imagickdraw.setfillpatternurl.php                  24-Jan-2021 12:02                2871
imagickdraw.setfillrule.php                        24-Jan-2021 12:02               14497
imagickdraw.setfont.php                            24-Jan-2021 12:02                9454
imagickdraw.setfontfamily.php                      24-Jan-2021 12:02               10150
imagickdraw.setfontsize.php                        24-Jan-2021 12:02                8524
imagickdraw.setfontstretch.php                     24-Jan-2021 12:02               10210
imagickdraw.setfontstyle.php                       24-Jan-2021 12:02                9024
imagickdraw.setfontweight.php                      24-Jan-2021 12:02                9365
imagickdraw.setgravity.php                         24-Jan-2021 12:02               11121
imagickdraw.setresolution.php                      24-Jan-2021 12:02                2548
imagickdraw.setstrokealpha.php                     24-Jan-2021 12:02                8570
imagickdraw.setstrokeantialias.php                 24-Jan-2021 12:02                9124
imagickdraw.setstrokecolor.php                     24-Jan-2021 12:02                8687
imagickdraw.setstrokedasharray.php                 24-Jan-2021 12:02               13790
imagickdraw.setstrokedashoffset.php                24-Jan-2021 12:02               10196
imagickdraw.setstrokelinecap.php                   24-Jan-2021 12:02                8707
imagickdraw.setstrokelinejoin.php                  24-Jan-2021 12:02               12285
imagickdraw.setstrokemiterlimit.php                24-Jan-2021 12:02               12020
imagickdraw.setstrokeopacity.php                   24-Jan-2021 12:02               10494
imagickdraw.setstrokepatternurl.php                24-Jan-2021 12:02                2599
imagickdraw.setstrokewidth.php                     24-Jan-2021 12:02                8601
imagickdraw.settextalignment.php                   24-Jan-2021 12:02                9501
imagickdraw.settextantialias.php                   24-Jan-2021 12:02                9103
imagickdraw.settextdecoration.php                  24-Jan-2021 12:02                7386
imagickdraw.settextencoding.php                    24-Jan-2021 12:02                2855
imagickdraw.settextinterlinespacing.php            24-Jan-2021 12:02                2570
imagickdraw.settextinterwordspacing.php            24-Jan-2021 12:02                2440
imagickdraw.settextkerning.php                     24-Jan-2021 12:02                2498
imagickdraw.settextundercolor.php                  24-Jan-2021 12:02                7944
imagickdraw.setvectorgraphics.php                  24-Jan-2021 12:02                9236
imagickdraw.setviewbox.php                         24-Jan-2021 12:02               10640
imagickdraw.skewx.php                              24-Jan-2021 12:02                8364
imagickdraw.skewy.php                              24-Jan-2021 12:02                8353
imagickdraw.translate.php                          24-Jan-2021 12:02                8647
imagickpixel.clear.php                             24-Jan-2021 12:02                2113
imagickpixel.construct.php                         24-Jan-2021 12:02               13683
imagickpixel.destroy.php                           24-Jan-2021 12:02                2200
imagickpixel.getcolor.php                          24-Jan-2021 12:02                7526
imagickpixel.getcolorasstring.php                  24-Jan-2021 12:02                4691
imagickpixel.getcolorcount.php                     24-Jan-2021 12:02                4688
imagickpixel.getcolorquantum.php                   24-Jan-2021 12:02                2597
imagickpixel.getcolorvalue.php                     24-Jan-2021 12:02                8592
imagickpixel.getcolorvaluequantum.php              24-Jan-2021 12:02                6424
imagickpixel.gethsl.php                            24-Jan-2021 12:02                3997
imagickpixel.getindex.php                          24-Jan-2021 12:02                2046
imagickpixel.ispixelsimilar.php                    24-Jan-2021 12:02                3337
imagickpixel.ispixelsimilarquantum.php             24-Jan-2021 12:02                2863
imagickpixel.issimilar.php                         24-Jan-2021 12:02               22673
imagickpixel.setcolor.php                          24-Jan-2021 12:02                7521
imagickpixel.setcolorcount.php                     24-Jan-2021 12:02                2342
imagickpixel.setcolorvalue.php                     24-Jan-2021 12:02                4813
imagickpixel.setcolorvaluequantum.php              24-Jan-2021 12:02                8369
imagickpixel.sethsl.php                            24-Jan-2021 12:02                7371
imagickpixel.setindex.php                          24-Jan-2021 12:02                2282
imagickpixeliterator.clear.php                     24-Jan-2021 12:02                7046
imagickpixeliterator.construct.php                 24-Jan-2021 12:02                6759
imagickpixeliterator.destroy.php                   24-Jan-2021 12:02                2233
imagickpixeliterator.getcurrentiteratorrow.php     24-Jan-2021 12:02                2379
imagickpixeliterator.getiteratorrow.php            24-Jan-2021 12:02                2311
imagickpixeliterator.getnextiteratorrow.php        24-Jan-2021 12:02                7842
imagickpixeliterator.getpreviousiteratorrow.php    24-Jan-2021 12:02                2447
imagickpixeliterator.newpixeliterator.php          24-Jan-2021 12:02                2478
imagickpixeliterator.newpixelregioniterator.php    24-Jan-2021 12:02                3702
imagickpixeliterator.resetiterator.php             24-Jan-2021 12:02               10331
imagickpixeliterator.setiteratorfirstrow.php       24-Jan-2021 12:02                2315
imagickpixeliterator.setiteratorlastrow.php        24-Jan-2021 12:02                2309
imagickpixeliterator.setiteratorrow.php            24-Jan-2021 12:02                7712
imagickpixeliterator.synciterator.php              24-Jan-2021 12:02                2172
imap.configuration.php                             24-Jan-2021 12:02                2960
imap.constants.php                                 24-Jan-2021 12:02               17309
imap.installation.php                              24-Jan-2021 12:02                2425
imap.requirements.php                              24-Jan-2021 12:02                2887
imap.resources.php                                 24-Jan-2021 12:02                1204
imap.setup.php                                     24-Jan-2021 12:02                1406
index.php                                          24-Jan-2021 12:02               12377
indexes.examples.php                               24-Jan-2021 12:02              727553
indexes.functions.php                              24-Jan-2021 12:02             1179969
indexes.php                                        24-Jan-2021 12:02                1290
infiniteiterator.construct.php                     24-Jan-2021 12:02                5447
infiniteiterator.next.php                          24-Jan-2021 12:02                2953
info.configuration.php                             24-Jan-2021 12:01               17745
info.constants.php                                 24-Jan-2021 12:01               14781
info.installation.php                              24-Jan-2021 12:01                1061
info.requirements.php                              24-Jan-2021 12:01                1021
info.resources.php                                 24-Jan-2021 12:01                1039
info.setup.php                                     24-Jan-2021 12:01                1394
ingres.configuration.php                           24-Jan-2021 12:02               13655
ingres.constants.php                               24-Jan-2021 12:02               21484
ingres.examples-basic.php                          24-Jan-2021 12:02                6021
ingres.examples.php                                24-Jan-2021 12:02                1233
ingres.installation.php                            24-Jan-2021 12:02                4158
ingres.requirements.php                            24-Jan-2021 12:02                1252
ingres.resources.php                               24-Jan-2021 12:02                1571
ingres.setup.php                                   24-Jan-2021 12:02                1425
ini.core.php                                       24-Jan-2021 12:02               80945
ini.list.php                                       24-Jan-2021 12:02              120358
ini.php                                            24-Jan-2021 12:02                1415
ini.sections.php                                   24-Jan-2021 12:02                3875
inotify.configuration.php                          24-Jan-2021 12:02                1104
inotify.constants.php                              24-Jan-2021 12:02                7585
inotify.install.php                                24-Jan-2021 12:02                1541
inotify.requirements.php                           24-Jan-2021 12:02                1076
inotify.resources.php                              24-Jan-2021 12:02                1186
inotify.setup.php                                  24-Jan-2021 12:02                1430
install.cloud.azure.php                            24-Jan-2021 12:01                3813
install.cloud.ec2.php                              24-Jan-2021 12:01                1292
install.cloud.php                                  24-Jan-2021 12:01                1455
install.fpm.configuration.php                      24-Jan-2021 12:01               23776
install.fpm.install.php                            24-Jan-2021 12:01                2164
install.fpm.php                                    24-Jan-2021 12:01                3225
install.general.php                                24-Jan-2021 12:01                3806
install.macosx.bundled.php                         24-Jan-2021 12:01                9825
install.macosx.compile.php                         24-Jan-2021 12:01                1187
install.macosx.packages.php                        24-Jan-2021 12:01                2426
install.macosx.php                                 24-Jan-2021 12:01                1685
install.pecl.downloads.php                         24-Jan-2021 12:01                3041
install.pecl.intro.php                             24-Jan-2021 12:01                2605
install.pecl.pear.php                              24-Jan-2021 12:01                2687
install.pecl.php                                   24-Jan-2021 12:01                1754
install.pecl.php-config.php                        24-Jan-2021 12:01                3463
install.pecl.phpize.php                            24-Jan-2021 12:01                2619
install.pecl.static.php                            24-Jan-2021 12:01                2830
install.pecl.windows.php                           24-Jan-2021 12:01                8323
install.php                                        24-Jan-2021 12:01                5097
install.problems.bugs.php                          24-Jan-2021 12:01                1687
install.problems.faq.php                           24-Jan-2021 12:01                1192
install.problems.php                               24-Jan-2021 12:01                1418
install.problems.support.php                       24-Jan-2021 12:01                2054
install.unix.apache.php                            24-Jan-2021 12:01               10826
install.unix.apache2.php                           24-Jan-2021 12:01               11647
install.unix.commandline.php                       24-Jan-2021 12:01                3490
install.unix.debian.php                            24-Jan-2021 12:01                6209
install.unix.hpux.php                              24-Jan-2021 12:01                1795
install.unix.lighttpd-14.php                       24-Jan-2021 12:01                5669
install.unix.litespeed.php                         24-Jan-2021 12:01                8101
install.unix.nginx.php                             24-Jan-2021 12:01                7867
install.unix.openbsd.php                           24-Jan-2021 12:01                6041
install.unix.php                                   24-Jan-2021 12:01                6386
install.unix.solaris.php                           24-Jan-2021 12:01                3665
install.windows.legacy.index.php                   24-Jan-2021 12:01               77464
install.windows.manual.php                         24-Jan-2021 12:01                5643
install.windows.pecl.php                           24-Jan-2021 12:01                1470
install.windows.php                                24-Jan-2021 12:01                3137
install.windows.recommended.php                    24-Jan-2021 12:01                4550
install.windows.requirements.php                   24-Jan-2021 12:01                3147
install.windows.tools.php                          24-Jan-2021 12:01                1429
install.windows.troubleshooting.php                24-Jan-2021 12:01                1538
intl.configuration.php                             24-Jan-2021 12:02                4828
intl.constants.php                                 24-Jan-2021 12:02                7194
intl.examples.basic.php                            24-Jan-2021 12:02                4348
intl.examples.php                                  24-Jan-2021 12:02                1253
intl.installation.php                              24-Jan-2021 12:02                2197
intl.requirements.php                              24-Jan-2021 12:02                1437
intl.resources.php                                 24-Jan-2021 12:02                1039
intl.setup.php                                     24-Jan-2021 12:02                1402
intlbreakiterator.construct.php                    24-Jan-2021 12:02                2240
intlbreakiterator.createcharacterinstance.php      24-Jan-2021 12:02                2790
intlbreakiterator.createcodepointinstance.php      24-Jan-2021 12:02                2548
intlbreakiterator.createlineinstance.php           24-Jan-2021 12:02                2756
intlbreakiterator.createsentenceinstance.php       24-Jan-2021 12:02                2754
intlbreakiterator.createtitleinstance.php          24-Jan-2021 12:02                2737
intlbreakiterator.createwordinstance.php           24-Jan-2021 12:02                2692
intlbreakiterator.current.php                      24-Jan-2021 12:02                2222
intlbreakiterator.first.php                        24-Jan-2021 12:02                2208
intlbreakiterator.following.php                    24-Jan-2021 12:02                2468
intlbreakiterator.geterrorcode.php                 24-Jan-2021 12:02                2697
intlbreakiterator.geterrormessage.php              24-Jan-2021 12:02                2739
intlbreakiterator.getlocale.php                    24-Jan-2021 12:02                2477
intlbreakiterator.getpartsiterator.php             24-Jan-2021 12:02                3260
intlbreakiterator.gettext.php                      24-Jan-2021 12:02                2228
intlbreakiterator.isboundary.php                   24-Jan-2021 12:02                2436
intlbreakiterator.last.php                         24-Jan-2021 12:02                2208
intlbreakiterator.next.php                         24-Jan-2021 12:02                2414
intlbreakiterator.preceding.php                    24-Jan-2021 12:02                2446
intlbreakiterator.previous.php                     24-Jan-2021 12:02                2260
intlbreakiterator.settext.php                      24-Jan-2021 12:02                2403
intlcalendar.add.php                               24-Jan-2021 12:02                8155
intlcalendar.after.php                             24-Jan-2021 12:02                6466
intlcalendar.before.php                            24-Jan-2021 12:02                3708
intlcalendar.clear.php                             24-Jan-2021 12:02               20396
intlcalendar.construct.php                         24-Jan-2021 12:02                2363
intlcalendar.createinstance.php                    24-Jan-2021 12:02               11882
intlcalendar.equals.php                            24-Jan-2021 12:02               10678
intlcalendar.fielddifference.php                   24-Jan-2021 12:02               11065
intlcalendar.fromdatetime.php                      24-Jan-2021 12:02                6458
intlcalendar.get.php                               24-Jan-2021 12:02                8456
intlcalendar.getactualmaximum.php                  24-Jan-2021 12:02                8168
intlcalendar.getactualminimum.php                  24-Jan-2021 12:02                5346
intlcalendar.getavailablelocales.php               24-Jan-2021 12:02                4036
intlcalendar.getdayofweektype.php                  24-Jan-2021 12:02                9618
intlcalendar.geterrorcode.php                      24-Jan-2021 12:02                8640
intlcalendar.geterrormessage.php                   24-Jan-2021 12:02                5587
intlcalendar.getfirstdayofweek.php                 24-Jan-2021 12:02                8262
intlcalendar.getgreatestminimum.php                24-Jan-2021 12:02                4194
intlcalendar.getkeywordvaluesforlocale.php         24-Jan-2021 12:02                7431
intlcalendar.getleastmaximum.php                   24-Jan-2021 12:02                7972
intlcalendar.getlocale.php                         24-Jan-2021 12:02                5745
intlcalendar.getmaximum.php                        24-Jan-2021 12:02                4891
intlcalendar.getminimaldaysinfirstweek.php         24-Jan-2021 12:02                8800
intlcalendar.getminimum.php                        24-Jan-2021 12:02                4146
intlcalendar.getnow.php                            24-Jan-2021 12:02                5186
intlcalendar.getrepeatedwalltimeoption.php         24-Jan-2021 12:02               10083
intlcalendar.getskippedwalltimeoption.php          24-Jan-2021 12:02               12493
intlcalendar.gettime.php                           24-Jan-2021 12:02                5997
intlcalendar.gettimezone.php                       24-Jan-2021 12:02                7026
intlcalendar.gettype.php                           24-Jan-2021 12:02                5392
intlcalendar.getweekendtransition.php              24-Jan-2021 12:02                4511
intlcalendar.indaylighttime.php                    24-Jan-2021 12:02                8592
intlcalendar.isequivalentto.php                    24-Jan-2021 12:02                8284
intlcalendar.islenient.php                         24-Jan-2021 12:02                8124
intlcalendar.isset.php                             24-Jan-2021 12:02                4382
intlcalendar.isweekend.php                         24-Jan-2021 12:02                8322
intlcalendar.roll.php                              24-Jan-2021 12:02                8927
intlcalendar.set.php                               24-Jan-2021 12:02               13627
intlcalendar.setfirstdayofweek.php                 24-Jan-2021 12:02                7726
intlcalendar.setlenient.php                        24-Jan-2021 12:02                3944
intlcalendar.setminimaldaysinfirstweek.php         24-Jan-2021 12:02                3893
intlcalendar.setrepeatedwalltimeoption.php         24-Jan-2021 12:02                5245
intlcalendar.setskippedwalltimeoption.php          24-Jan-2021 12:02                5955
intlcalendar.settime.php                           24-Jan-2021 12:02                8369
intlcalendar.settimezone.php                       24-Jan-2021 12:02               10274
intlcalendar.todatetime.php                        24-Jan-2021 12:02                6555
intlchar.charage.php                               24-Jan-2021 12:02                5289
intlchar.chardigitvalue.php                        24-Jan-2021 12:02                4957
intlchar.chardirection.php                         24-Jan-2021 12:02                8427
intlchar.charfromname.php                          24-Jan-2021 12:02                6577
intlchar.charmirror.php                            24-Jan-2021 12:02                5812
intlchar.charname.php                              24-Jan-2021 12:02                6863
intlchar.chartype.php                              24-Jan-2021 12:02                8558
intlchar.chr.php                                   24-Jan-2021 12:02                4950
intlchar.digit.php                                 24-Jan-2021 12:02                7451
intlchar.enumcharnames.php                         24-Jan-2021 12:02                7454
intlchar.enumchartypes.php                         24-Jan-2021 12:02                5604
intlchar.foldcase.php                              24-Jan-2021 12:02                3356
intlchar.fordigit.php                              24-Jan-2021 12:02                6722
intlchar.getbidipairedbracket.php                  24-Jan-2021 12:02                5342
intlchar.getblockcode.php                          24-Jan-2021 12:02                5039
intlchar.getcombiningclass.php                     24-Jan-2021 12:02                4348
intlchar.getfc-nfkc-closure.php                    24-Jan-2021 12:02                4178
intlchar.getintpropertymaxvalue.php                24-Jan-2021 12:02                6177
intlchar.getintpropertyminvalue.php                24-Jan-2021 12:02                6170
intlchar.getintpropertyvalue.php                   24-Jan-2021 12:02                7422
intlchar.getnumericvalue.php                       24-Jan-2021 12:02                4860
intlchar.getpropertyenum.php                       24-Jan-2021 12:02                6357
intlchar.getpropertyname.php                       24-Jan-2021 12:02                7999
intlchar.getpropertyvalueenum.php                  24-Jan-2021 12:02                7692
intlchar.getpropertyvaluename.php                  24-Jan-2021 12:02                9689
intlchar.getunicodeversion.php                     24-Jan-2021 12:02                3743
intlchar.hasbinaryproperty.php                     24-Jan-2021 12:02                8287
intlchar.isalnum.php                               24-Jan-2021 12:02                5086
intlchar.isalpha.php                               24-Jan-2021 12:02                4974
intlchar.isbase.php                                24-Jan-2021 12:02                5454
intlchar.isblank.php                               24-Jan-2021 12:02                6163
intlchar.iscntrl.php                               24-Jan-2021 12:02                5763
intlchar.isdefined.php                             24-Jan-2021 12:02                6193
intlchar.isdigit.php                               24-Jan-2021 12:02                5312
intlchar.isgraph.php                               24-Jan-2021 12:02                5008
intlchar.isidignorable.php                         24-Jan-2021 12:02                5586
intlchar.isidpart.php                              24-Jan-2021 12:02                6171
intlchar.isidstart.php                             24-Jan-2021 12:02                5675
intlchar.isisocontrol.php                          24-Jan-2021 12:02                4924
intlchar.isjavaidpart.php                          24-Jan-2021 12:02                6264
intlchar.isjavaidstart.php                         24-Jan-2021 12:02                5963
intlchar.isjavaspacechar.php                       24-Jan-2021 12:02                6199
intlchar.islower.php                               24-Jan-2021 12:02                6475
intlchar.ismirrored.php                            24-Jan-2021 12:02                5036
intlchar.isprint.php                               24-Jan-2021 12:02                5283
intlchar.ispunct.php                               24-Jan-2021 12:02                4755
intlchar.isspace.php                               24-Jan-2021 12:02                5850
intlchar.istitle.php                               24-Jan-2021 12:02                5911
intlchar.isualphabetic.php                         24-Jan-2021 12:02                5264
intlchar.isulowercase.php                          24-Jan-2021 12:02                6247
intlchar.isupper.php                               24-Jan-2021 12:02                6473
intlchar.isuuppercase.php                          24-Jan-2021 12:02                6285
intlchar.isuwhitespace.php                         24-Jan-2021 12:02                6790
intlchar.iswhitespace.php                          24-Jan-2021 12:02                6917
intlchar.isxdigit.php                              24-Jan-2021 12:02                6355
intlchar.ord.php                                   24-Jan-2021 12:02                5018
intlchar.tolower.php                               24-Jan-2021 12:02                6931
intlchar.totitle.php                               24-Jan-2021 12:02                6958
intlchar.toupper.php                               24-Jan-2021 12:02                6929
intlcodepointbreakiterator.getlastcodepoint.php    24-Jan-2021 12:02                2432
intldateformatter.create.php                       24-Jan-2021 12:02               24681
intldateformatter.format.php                       24-Jan-2021 12:02               26531
intldateformatter.formatobject.php                 24-Jan-2021 12:02               12969
intldateformatter.getcalendar.php                  24-Jan-2021 12:02                9067
intldateformatter.getcalendarobject.php            24-Jan-2021 12:02                6867
intldateformatter.getdatetype.php                  24-Jan-2021 12:02               11826
intldateformatter.geterrorcode.php                 24-Jan-2021 12:02                9103
intldateformatter.geterrormessage.php              24-Jan-2021 12:02                9006
intldateformatter.getlocale.php                    24-Jan-2021 12:02               12041
intldateformatter.getpattern.php                   24-Jan-2021 12:02               10386
intldateformatter.gettimetype.php                  24-Jan-2021 12:02               11818
intldateformatter.gettimezone.php                  24-Jan-2021 12:02                8225
intldateformatter.gettimezoneid.php                24-Jan-2021 12:02                8538
intldateformatter.islenient.php                    24-Jan-2021 12:02               15741
intldateformatter.localtime.php                    24-Jan-2021 12:02               11289
intldateformatter.parse.php                        24-Jan-2021 12:02               11815
intldateformatter.setcalendar.php                  24-Jan-2021 12:02               14100
intldateformatter.setlenient.php                   24-Jan-2021 12:02               16436
intldateformatter.setpattern.php                   24-Jan-2021 12:02               11129
intldateformatter.settimezone.php                  24-Jan-2021 12:02               10921
intldateformatter.settimezoneid.php                24-Jan-2021 12:02               10202
intlgregoriancalendar.construct.php                24-Jan-2021 12:02                4829
intlgregoriancalendar.getgregorianchange.php       24-Jan-2021 12:02                2564
intlgregoriancalendar.isleapyear.php               24-Jan-2021 12:02                2661
intlgregoriancalendar.setgregorianchange.php       24-Jan-2021 12:02                2665
intliterator.current.php                           24-Jan-2021 12:02                2200
intliterator.key.php                               24-Jan-2021 12:02                2075
intliterator.next.php                              24-Jan-2021 12:02                2122
intliterator.rewind.php                            24-Jan-2021 12:02                2148
intliterator.valid.php                             24-Jan-2021 12:02                2088
intlpartsiterator.getbreakiterator.php             24-Jan-2021 12:02                2356
intlrulebasedbreakiterator.construct.php           24-Jan-2021 12:02                2816
intlrulebasedbreakiterator.getbinaryrules.php      24-Jan-2021 12:02                2430
intlrulebasedbreakiterator.getrules.php            24-Jan-2021 12:02                2400
intlrulebasedbreakiterator.getrulestatus.php       24-Jan-2021 12:02                2485
intlrulebasedbreakiterator.getrulestatusvec.php    24-Jan-2021 12:02                2488
intltimezone.countequivalentids.php                24-Jan-2021 12:02                3020
intltimezone.createdefault.php                     24-Jan-2021 12:02                2823
intltimezone.createenumeration.php                 24-Jan-2021 12:02                3490
intltimezone.createtimezone.php                    24-Jan-2021 12:02                3143
intltimezone.createtimezoneidenumeration.php       24-Jan-2021 12:02                4442
intltimezone.fromdatetimezone.php                  24-Jan-2021 12:02                3392
intltimezone.getcanonicalid.php                    24-Jan-2021 12:02                3482
intltimezone.getdisplayname.php                    24-Jan-2021 12:02                4043
intltimezone.getdstsavings.php                     24-Jan-2021 12:02                2840
intltimezone.getequivalentid.php                   24-Jan-2021 12:02                3331
intltimezone.geterrorcode.php                      24-Jan-2021 12:02                2782
intltimezone.geterrormessage.php                   24-Jan-2021 12:02                2803
intltimezone.getgmt.php                            24-Jan-2021 12:02                2679
intltimezone.getid.php                             24-Jan-2021 12:02                2664
intltimezone.getidforwindowsid.php                 24-Jan-2021 12:02                4382
intltimezone.getoffset.php                         24-Jan-2021 12:02                4134
intltimezone.getrawoffset.php                      24-Jan-2021 12:02                2792
intltimezone.getregion.php                         24-Jan-2021 12:02                3168
intltimezone.gettzdataversion.php                  24-Jan-2021 12:02                2691
intltimezone.getunknown.php                        24-Jan-2021 12:02                2859
intltimezone.getwindowsid.php                      24-Jan-2021 12:02                3923
intltimezone.hassamerules.php                      24-Jan-2021 12:02                3267
intltimezone.todatetimezone.php                    24-Jan-2021 12:02                3028
intltimezone.usedaylighttime.php                   24-Jan-2021 12:02                2813
intro-whatcando.php                                24-Jan-2021 12:01                7376
intro-whatis.php                                   24-Jan-2021 12:01                4133
intro.apache.php                                   24-Jan-2021 12:02                1886
intro.apcu.php                                     24-Jan-2021 12:01                1353
intro.array.php                                    24-Jan-2021 12:02                1662
intro.bc.php                                       24-Jan-2021 12:02                1112
intro.blenc.php                                    24-Jan-2021 12:01                3247
intro.bzip2.php                                    24-Jan-2021 12:02                1024
intro.calendar.php                                 24-Jan-2021 12:02                1790
intro.classkit.php                                 24-Jan-2021 12:02                1358
intro.classobj.php                                 24-Jan-2021 12:02                1478
intro.cmark.php                                    24-Jan-2021 12:02                6387
intro.com.php                                      24-Jan-2021 12:02                2950
intro.componere.php                                24-Jan-2021 12:01                5947
intro.csprng.php                                   24-Jan-2021 12:02                1526
intro.ctype.php                                    24-Jan-2021 12:02                3120
intro.cubrid.php                                   24-Jan-2021 12:02                1329
intro.curl.php                                     24-Jan-2021 12:02                1342
intro.datetime.php                                 24-Jan-2021 12:02                2089
intro.dba.php                                      24-Jan-2021 12:02                1358
intro.dbase.php                                    24-Jan-2021 12:02                6094
intro.dbplus.php                                   24-Jan-2021 12:02                2223
intro.dbx.php                                      24-Jan-2021 12:02                1572
intro.dio.php                                      24-Jan-2021 12:02                1818
intro.dom.php                                      24-Jan-2021 12:02                1509
intro.ds.php                                       24-Jan-2021 12:02                1224
intro.eio.php                                      24-Jan-2021 12:02               15443
intro.enchant.php                                  24-Jan-2021 12:02                2467
intro.errorfunc.php                                24-Jan-2021 12:01                1751
intro.ev.php                                       24-Jan-2021 12:02                2139
intro.event.php                                    24-Jan-2021 12:02                1840
intro.exec.php                                     24-Jan-2021 12:02                1584
intro.exif.php                                     24-Jan-2021 12:02                1301
intro.expect.php                                   24-Jan-2021 12:02                1289
intro.fann.php                                     24-Jan-2021 12:02                1211
intro.fbsql.php                                    24-Jan-2021 12:02                1691
intro.fdf.php                                      24-Jan-2021 12:02                3687
intro.ffi.php                                      24-Jan-2021 12:01                3003
intro.fileinfo.php                                 24-Jan-2021 12:02                1239
intro.filepro.php                                  24-Jan-2021 12:02                1552
intro.filesystem.php                               24-Jan-2021 12:02                1243
intro.filter.php                                   24-Jan-2021 12:02                2533
intro.fpm.php                                      24-Jan-2021 12:02                1206
intro.ftp.php                                      24-Jan-2021 12:02                1541
intro.funchand.php                                 24-Jan-2021 12:02                1034
intro.gearman.php                                  24-Jan-2021 12:02                1518
intro.gender.php                                   24-Jan-2021 12:02                1187
intro.geoip.php                                    24-Jan-2021 12:02                1145
intro.gettext.php                                  24-Jan-2021 12:02                1350
intro.gmagick.php                                  24-Jan-2021 12:02                1548
intro.gmp.php                                      24-Jan-2021 12:02                2931
intro.gnupg.php                                    24-Jan-2021 12:02                1077
intro.hash.php                                     24-Jan-2021 12:02                1061
intro.hrtime.php                                   24-Jan-2021 12:02                1522
intro.ibase.php                                    24-Jan-2021 12:02                2570
intro.ibm-db2.php                                  24-Jan-2021 12:02                1135
intro.iconv.php                                    24-Jan-2021 12:02                1743
intro.image.php                                    24-Jan-2021 12:02                6065
intro.imagick.php                                  24-Jan-2021 12:02                1567
intro.imap.php                                     24-Jan-2021 12:02                1318
intro.info.php                                     24-Jan-2021 12:01                1309
intro.ingres.php                                   24-Jan-2021 12:02                1348
intro.inotify.php                                  24-Jan-2021 12:02                2238
intro.intl.php                                     24-Jan-2021 12:02                4876
intro.json.php                                     24-Jan-2021 12:02                1535
intro.ldap.php                                     24-Jan-2021 12:02                3939
intro.libxml.php                                   24-Jan-2021 12:02                1628
intro.lua.php                                      24-Jan-2021 12:02                1119
intro.luasandbox.php                               24-Jan-2021 12:02                2224
intro.lzf.php                                      24-Jan-2021 12:02                1280
intro.mail.php                                     24-Jan-2021 12:02                1071
intro.mailparse.php                                24-Jan-2021 12:02                1792
intro.math.php                                     24-Jan-2021 12:02                1464
intro.mbstring.php                                 24-Jan-2021 12:02                2447
intro.mcrypt.php                                   24-Jan-2021 12:02                2129
intro.memcache.php                                 24-Jan-2021 12:02                1512
intro.memcached.php                                24-Jan-2021 12:02                1735
intro.memtrack.php                                 24-Jan-2021 12:01                2235
intro.mhash.php                                    24-Jan-2021 12:02                2644
intro.mime-magic.php                               24-Jan-2021 12:02                1831
intro.misc.php                                     24-Jan-2021 12:02                1017
intro.mqseries.php                                 24-Jan-2021 12:02                1598
intro.mysql-xdevapi.php                            24-Jan-2021 12:02                1729
intro.mysql.php                                    24-Jan-2021 12:02                1752
intro.mysqli.php                                   24-Jan-2021 12:02                2103
intro.mysqlnd-memcache.php                         24-Jan-2021 12:02                5738
intro.mysqlnd-ms.php                               24-Jan-2021 12:02               10871
intro.mysqlnd-mux.php                              24-Jan-2021 12:02                6118
intro.mysqlnd-qc.php                               24-Jan-2021 12:02                5269
intro.mysqlnd-uh.php                               24-Jan-2021 12:02                5802
intro.mysqlnd.php                                  24-Jan-2021 12:02                1808
intro.ncurses.php                                  24-Jan-2021 12:02                3315
intro.network.php                                  24-Jan-2021 12:02                1004
intro.oauth.php                                    24-Jan-2021 12:02                1153
intro.oci8.php                                     24-Jan-2021 12:02                1334
intro.opcache.php                                  24-Jan-2021 12:01                1443
intro.openal.php                                   24-Jan-2021 12:02                1137
intro.openssl.php                                  24-Jan-2021 12:02                1342
intro.outcontrol.php                               24-Jan-2021 12:01                2079
intro.paradox.php                                  24-Jan-2021 12:02                1879
intro.parallel.php                                 24-Jan-2021 12:02                6260
intro.parle.php                                    24-Jan-2021 12:02                3296
intro.password.php                                 24-Jan-2021 12:02                1426
intro.pcntl.php                                    24-Jan-2021 12:02                2537
intro.pcre.php                                     24-Jan-2021 12:02                2518
intro.pdo.php                                      24-Jan-2021 12:02                2005
intro.pgsql.php                                    24-Jan-2021 12:02                1435
intro.phar.php                                     24-Jan-2021 12:02                9908
intro.phpdbg.php                                   24-Jan-2021 12:01                5897
intro.pht.php                                      24-Jan-2021 12:02                3534
intro.posix.php                                    24-Jan-2021 12:02                1568
intro.proctitle.php                                24-Jan-2021 12:02                1269
intro.ps.php                                       24-Jan-2021 12:02                1622
intro.pspell.php                                   24-Jan-2021 12:02                1051
intro.pthreads.php                                 24-Jan-2021 12:02                8790
intro.quickhash.php                                24-Jan-2021 12:02                1120
intro.radius.php                                   24-Jan-2021 12:02                2023
intro.rar.php                                      24-Jan-2021 12:02                1400
intro.readline.php                                 24-Jan-2021 12:02                1746
intro.recode.php                                   24-Jan-2021 12:02                2111
intro.reflection.php                               24-Jan-2021 12:02                1569
intro.regex.php                                    24-Jan-2021 12:02                2445
intro.rpminfo.php                                  24-Jan-2021 12:02                1081
intro.rrd.php                                      24-Jan-2021 12:02                1295
intro.runkit7.php                                  24-Jan-2021 12:01                1334
intro.scoutapm.php                                 24-Jan-2021 12:02                1310
intro.seaslog.php                                  24-Jan-2021 12:02                3633
intro.sem.php                                      24-Jan-2021 12:02                2864
intro.session.php                                  24-Jan-2021 12:02                5337
intro.shmop.php                                    24-Jan-2021 12:02                1098
intro.simplexml.php                                24-Jan-2021 12:02                1148
intro.snmp.php                                     24-Jan-2021 12:02                1517
intro.soap.php                                     24-Jan-2021 12:02                1322
intro.sockets.php                                  24-Jan-2021 12:02                2192
intro.sodium.php                                   24-Jan-2021 12:02                 965
intro.solr.php                                     24-Jan-2021 12:02                1643
intro.sphinx.php                                   24-Jan-2021 12:02                1565
intro.spl-types.php                                24-Jan-2021 12:02                1699
intro.spl.php                                      24-Jan-2021 12:02                1194
intro.sqlite3.php                                  24-Jan-2021 12:02                1017
intro.sqlsrv.php                                   24-Jan-2021 12:02                2022
intro.ssdeep.php                                   24-Jan-2021 12:02                1615
intro.ssh2.php                                     24-Jan-2021 12:02                1199
intro.stats.php                                    24-Jan-2021 12:02                1368
intro.stomp.php                                    24-Jan-2021 12:02                1201
intro.stream.php                                   24-Jan-2021 12:02                3726
intro.strings.php                                  24-Jan-2021 12:02                1445
intro.svm.php                                      24-Jan-2021 12:02                1086
intro.svn.php                                      24-Jan-2021 12:02                1606
intro.swoole.php                                   24-Jan-2021 12:02                1491
intro.sync.php                                     24-Jan-2021 12:02                2212
intro.taint.php                                    24-Jan-2021 12:02                4374
intro.tcpwrap.php                                  24-Jan-2021 12:02                1128
intro.tidy.php                                     24-Jan-2021 12:02                1267
intro.tokenizer.php                                24-Jan-2021 12:02                1366
intro.tokyo-tyrant.php                             24-Jan-2021 12:02                1825
intro.trader.php                                   24-Jan-2021 12:02                2244
intro.ui.php                                       24-Jan-2021 12:02                1061
intro.uodbc.php                                    24-Jan-2021 12:02                2615
intro.uopz.php                                     24-Jan-2021 12:01                2261
intro.url.php                                      24-Jan-2021 12:02                 993
intro.v8js.php                                     24-Jan-2021 12:02                1086
intro.var.php                                      24-Jan-2021 12:02                1181
intro.varnish.php                                  24-Jan-2021 12:02                1173
intro.wddx.php                                     24-Jan-2021 12:02                2037
intro.weakref.php                                  24-Jan-2021 12:01                4589
intro.win32service.php                             24-Jan-2021 12:02                1251
intro.wincache.php                                 24-Jan-2021 12:01                4845
intro.wkhtmltox.php                                24-Jan-2021 12:02                1130
intro.xattr.php                                    24-Jan-2021 12:02                1047
intro.xdiff.php                                    24-Jan-2021 12:02                2469
intro.xhprof.php                                   24-Jan-2021 12:02                2397
intro.xlswriter.php                                24-Jan-2021 12:02                1043
intro.xml.php                                      24-Jan-2021 12:02                2101
intro.xmldiff.php                                  24-Jan-2021 12:02                1266
intro.xmlreader.php                                24-Jan-2021 12:02                1441
intro.xmlrpc.php                                   24-Jan-2021 12:02                1685
intro.xmlwriter.php                                24-Jan-2021 12:02                1402
intro.xsl.php                                      24-Jan-2021 12:02                1197
intro.yac.php                                      24-Jan-2021 12:02                1061
intro.yaconf.php                                   24-Jan-2021 12:02                2431
intro.yaf.php                                      24-Jan-2021 12:02                1461
intro.yaml.php                                     24-Jan-2021 12:02                1239
intro.yar.php                                      24-Jan-2021 12:02                1191
intro.yaz.php                                      24-Jan-2021 12:02                2354
intro.zip.php                                      24-Jan-2021 12:02                1024
intro.zlib.php                                     24-Jan-2021 12:02                2454
intro.zmq.php                                      24-Jan-2021 12:02                1225
intro.zookeeper.php                                24-Jan-2021 12:02                1301
introduction.php                                   24-Jan-2021 12:01                1297
iterator.current.php                               24-Jan-2021 12:01                2069
iterator.key.php                                   24-Jan-2021 12:01                2314
iterator.next.php                                  24-Jan-2021 12:01                2267
iterator.rewind.php                                24-Jan-2021 12:01                2477
iterator.valid.php                                 24-Jan-2021 12:01                2441
iteratoraggregate.getiterator.php                  24-Jan-2021 12:01                2578
iteratoriterator.construct.php                     24-Jan-2021 12:02                2709
iteratoriterator.current.php                       24-Jan-2021 12:02                2613
iteratoriterator.getinneriterator.php              24-Jan-2021 12:02                2725
iteratoriterator.key.php                           24-Jan-2021 12:02                2565
iteratoriterator.next.php                          24-Jan-2021 12:02                2660
iteratoriterator.rewind.php                        24-Jan-2021 12:02                2677
iteratoriterator.valid.php                         24-Jan-2021 12:02                2720
json.configuration.php                             24-Jan-2021 12:02                1082
json.constants.php                                 24-Jan-2021 12:02               12891
json.installation.php                              24-Jan-2021 12:02                1468
json.requirements.php                              24-Jan-2021 12:02                1053
json.resources.php                                 24-Jan-2021 12:02                1039
json.setup.php                                     24-Jan-2021 12:02                1374
jsonserializable.jsonserialize.php                 24-Jan-2021 12:02               12671
langref.php                                        24-Jan-2021 12:01               15981
language.attributes.classes.php                    24-Jan-2021 12:01                4370
language.attributes.overview.php                   24-Jan-2021 12:01                9845
language.attributes.php                            24-Jan-2021 12:01                1534
language.attributes.reflection.php                 24-Jan-2021 12:01                8105
language.attributes.syntax.php                     24-Jan-2021 12:01                4811
language.basic-syntax.comments.php                 24-Jan-2021 12:01                4059
language.basic-syntax.instruction-separation.php   24-Jan-2021 12:01                3955
language.basic-syntax.php                          24-Jan-2021 12:01                1498
language.basic-syntax.phpmode.php                  24-Jan-2021 12:01                4394
language.basic-syntax.phptags.php                  24-Jan-2021 12:01                5026
language.constants.php                             24-Jan-2021 12:01                5283
language.constants.predefined.php                  24-Jan-2021 12:01                5590
language.constants.syntax.php                      24-Jan-2021 12:01               10389
language.control-structures.php                    24-Jan-2021 12:01                2598
language.errors.basics.php                         24-Jan-2021 12:01                4348
language.errors.php                                24-Jan-2021 12:01                1711
language.errors.php7.php                           24-Jan-2021 12:01                4573
language.exceptions.extending.php                  24-Jan-2021 12:01               24189
language.exceptions.php                            24-Jan-2021 12:01               29391
language.expressions.php                           24-Jan-2021 12:01               14427
language.functions.php                             24-Jan-2021 12:01                1673
language.generators.comparison.php                 24-Jan-2021 12:01                9882
language.generators.overview.php                   24-Jan-2021 12:01                9568
language.generators.php                            24-Jan-2021 12:01                1474
language.generators.syntax.php                     24-Jan-2021 12:01               25987
language.namespaces.basics.php                     24-Jan-2021 12:01               12349
language.namespaces.definition.php                 24-Jan-2021 12:01                3832
language.namespaces.definitionmultiple.php         24-Jan-2021 12:01                9759
language.namespaces.dynamic.php                    24-Jan-2021 12:01                9785
language.namespaces.fallback.php                   24-Jan-2021 12:01                6444
language.namespaces.faq.php                        24-Jan-2021 12:01               35645
language.namespaces.global.php                     24-Jan-2021 12:01                2895
language.namespaces.importing.php                  24-Jan-2021 12:01               14509
language.namespaces.nested.php                     24-Jan-2021 12:01                2873
language.namespaces.nsconstants.php                24-Jan-2021 12:01                9632
language.namespaces.php                            24-Jan-2021 12:01                2277
language.namespaces.rationale.php                  24-Jan-2021 12:01                6176
language.namespaces.rules.php                      24-Jan-2021 12:01               13928
language.oop5.abstract.php                         24-Jan-2021 12:01               12532
language.oop5.anonymous.php                        24-Jan-2021 12:01               11822
language.oop5.autoload.php                         24-Jan-2021 12:01               11503
language.oop5.basic.php                            24-Jan-2021 12:01               26191
language.oop5.changelog.php                        24-Jan-2021 12:01               11391
language.oop5.cloning.php                          24-Jan-2021 12:01                8229
language.oop5.constants.php                        24-Jan-2021 12:01                5593
language.oop5.decon.php                            24-Jan-2021 12:01               24395
language.oop5.final.php                            24-Jan-2021 12:01                5159
language.oop5.inheritance.php                      24-Jan-2021 12:01                6018
language.oop5.interfaces.php                       24-Jan-2021 12:01               15389
language.oop5.iterations.php                       24-Jan-2021 12:01               19097
language.oop5.late-static-bindings.php             24-Jan-2021 12:01               15714
language.oop5.magic.php                            24-Jan-2021 12:01               38045
language.oop5.object-comparison.php                24-Jan-2021 12:01                9479
language.oop5.overloading.php                      24-Jan-2021 12:01               26403
language.oop5.paamayim-nekudotayim.php             24-Jan-2021 12:01                8713
language.oop5.php                                  24-Jan-2021 12:01                3059
language.oop5.properties.php                       24-Jan-2021 12:01                8286
language.oop5.references.php                       24-Jan-2021 12:01                5951
language.oop5.serialization.php                    24-Jan-2021 12:01                7458
language.oop5.static.php                           24-Jan-2021 12:01                8844
language.oop5.traits.php                           24-Jan-2021 12:01               32937
language.oop5.variance.php                         24-Jan-2021 12:01               15576
language.oop5.visibility.php                       24-Jan-2021 12:01               28732
language.operators.arithmetic.php                  24-Jan-2021 12:01                5748
language.operators.array.php                       24-Jan-2021 12:01                8970
language.operators.assignment.php                  24-Jan-2021 12:01               10968
language.operators.bitwise.php                     24-Jan-2021 12:01               46348
language.operators.comparison.php                  24-Jan-2021 12:01               36885
language.operators.errorcontrol.php                24-Jan-2021 12:01                5252
language.operators.execution.php                   24-Jan-2021 12:01                3175
language.operators.increment.php                   24-Jan-2021 12:01               10964
language.operators.logical.php                     24-Jan-2021 12:01                7395
language.operators.php                             24-Jan-2021 12:01                3512
language.operators.precedence.php                  24-Jan-2021 12:01               17039
language.operators.string.php                      24-Jan-2021 12:01                3068
language.operators.type.php                        24-Jan-2021 12:01               15117
language.references.arent.php                      24-Jan-2021 12:01                2960
language.references.pass.php                       24-Jan-2021 12:01                6684
language.references.php                            24-Jan-2021 12:01                1711
language.references.return.php                     24-Jan-2021 12:01                7090
language.references.spot.php                       24-Jan-2021 12:01                2463
language.references.unset.php                      24-Jan-2021 12:01                2079
language.references.whatare.php                    24-Jan-2021 12:01                1715
language.references.whatdo.php                     24-Jan-2021 12:01               18720
language.types.array.php                           24-Jan-2021 12:01               79935
language.types.boolean.php                         24-Jan-2021 12:01                8622
language.types.callable.php                        24-Jan-2021 12:01               12028
language.types.declarations.php                    24-Jan-2021 12:01               44511
language.types.float.php                           24-Jan-2021 12:01                7604
language.types.integer.php                         24-Jan-2021 12:01               16964
language.types.intro.php                           24-Jan-2021 12:01                7547
language.types.iterable.php                        24-Jan-2021 12:01                8565
language.types.null.php                            24-Jan-2021 12:01                3251
language.types.numeric-strings.php                 24-Jan-2021 12:01                8815
language.types.object.php                          24-Jan-2021 12:01                5248
language.types.php                                 24-Jan-2021 12:01                2223
language.types.resource.php                        24-Jan-2021 12:01                2488
language.types.string.php                          24-Jan-2021 12:01               72598
language.types.type-juggling.php                   24-Jan-2021 12:01               13701
language.variables.basics.php                      24-Jan-2021 12:01               13750
language.variables.external.php                    24-Jan-2021 12:01               18336
language.variables.php                             24-Jan-2021 12:01                1562
language.variables.predefined.php                  24-Jan-2021 12:01                2515
language.variables.scope.php                       24-Jan-2021 12:01               25316
language.variables.superglobals.php                24-Jan-2021 12:01                4895
language.variables.variable.php                    24-Jan-2021 12:01                9939
ldap.configuration.php                             24-Jan-2021 12:02                2111
ldap.constants.php                                 24-Jan-2021 12:02               24387
ldap.controls.php                                  24-Jan-2021 12:02                8600
ldap.examples-basic.php                            24-Jan-2021 12:02                9323
ldap.examples-controls.php                         24-Jan-2021 12:02               18898
ldap.examples.php                                  24-Jan-2021 12:02                1277
ldap.installation.php                              24-Jan-2021 12:02                2541
ldap.requirements.php                              24-Jan-2021 12:02                1378
ldap.resources.php                                 24-Jan-2021 12:02                1248
ldap.setup.php                                     24-Jan-2021 12:02                1401
ldap.using.php                                     24-Jan-2021 12:02                2095
libxml.configuration.php                           24-Jan-2021 12:02                1094
libxml.constants.php                               24-Jan-2021 12:02                9825
libxml.installation.php                            24-Jan-2021 12:02                2363
libxml.requirements.php                            24-Jan-2021 12:02                1120
libxml.resources.php                               24-Jan-2021 12:02                1051
libxml.setup.php                                   24-Jan-2021 12:02                1414
limititerator.construct.php                        24-Jan-2021 12:02                6113
limititerator.current.php                          24-Jan-2021 12:02                3421
limititerator.getinneriterator.php                 24-Jan-2021 12:02                2943
limititerator.getposition.php                      24-Jan-2021 12:02                5754
limititerator.key.php                              24-Jan-2021 12:02                3531
limititerator.next.php                             24-Jan-2021 12:02                3173
limititerator.rewind.php                           24-Jan-2021 12:02                3339
limititerator.seek.php                             24-Jan-2021 12:02                3911
limititerator.valid.php                            24-Jan-2021 12:02                3265
locale.acceptfromhttp.php                          24-Jan-2021 12:02                5350
locale.canonicalize.php                            24-Jan-2021 12:02                2458
locale.composelocale.php                           24-Jan-2021 12:02                8857
locale.filtermatches.php                           24-Jan-2021 12:02                8052
locale.getallvariants.php                          24-Jan-2021 12:02                5778
locale.getdefault.php                              24-Jan-2021 12:02                5658
locale.getdisplaylanguage.php                      24-Jan-2021 12:02                8209
locale.getdisplayname.php                          24-Jan-2021 12:02                8201
locale.getdisplayregion.php                        24-Jan-2021 12:02                8161
locale.getdisplayscript.php                        24-Jan-2021 12:02                8168
locale.getdisplayvariant.php                       24-Jan-2021 12:02                8207
locale.getkeywords.php                             24-Jan-2021 12:02                6478
locale.getprimarylanguage.php                      24-Jan-2021 12:02                5294
locale.getregion.php                               24-Jan-2021 12:02                5139
locale.getscript.php                               24-Jan-2021 12:02                5111
locale.lookup.php                                  24-Jan-2021 12:02                7947
locale.parselocale.php                             24-Jan-2021 12:02                7024
locale.setdefault.php                              24-Jan-2021 12:02                5011
lua.assign.php                                     24-Jan-2021 12:02                4402
lua.call.php                                       24-Jan-2021 12:02                7267
lua.configuration.php                              24-Jan-2021 12:02                1076
lua.construct.php                                  24-Jan-2021 12:02                2189
lua.eval.php                                       24-Jan-2021 12:02                3494
lua.getversion.php                                 24-Jan-2021 12:02                2038
lua.include.php                                    24-Jan-2021 12:02                2429
lua.installation.php                               24-Jan-2021 12:02                1813
lua.registercallback.php                           24-Jan-2021 12:02                4339
lua.requirements.php                               24-Jan-2021 12:02                1103
lua.resources.php                                  24-Jan-2021 12:02                1043
lua.setup.php                                      24-Jan-2021 12:02                1362
luaclosure.invoke.php                              24-Jan-2021 12:02                4508
luasandbox.callfunction.php                        24-Jan-2021 12:02                4774
luasandbox.configuration.php                       24-Jan-2021 12:02                1118
luasandbox.disableprofiler.php                     24-Jan-2021 12:02                2706
luasandbox.enableprofiler.php                      24-Jan-2021 12:02                3278
luasandbox.examples-basic.php                      24-Jan-2021 12:02                7316
luasandbox.examples.php                            24-Jan-2021 12:02                1331
luasandbox.getcpuusage.php                         24-Jan-2021 12:02                3450
luasandbox.getmemoryusage.php                      24-Jan-2021 12:02                3025
luasandbox.getpeakmemoryusage.php                  24-Jan-2021 12:02                3071
luasandbox.getprofilerfunctionreport.php           24-Jan-2021 12:02                5526
luasandbox.getversioninfo.php                      24-Jan-2021 12:02                2777
luasandbox.installation.php                        24-Jan-2021 12:02                2240
luasandbox.loadbinary.php                          24-Jan-2021 12:02                3370
luasandbox.loadstring.php                          24-Jan-2021 12:02                5471
luasandbox.pauseusagetimer.php                     24-Jan-2021 12:02               10137
luasandbox.registerlibrary.php                     24-Jan-2021 12:02                6760
luasandbox.requirements.php                        24-Jan-2021 12:02                1612
luasandbox.resources.php                           24-Jan-2021 12:02                1101
luasandbox.setcpulimit.php                         24-Jan-2021 12:02                5818
luasandbox.setmemorylimit.php                      24-Jan-2021 12:02                5468
luasandbox.setup.php                               24-Jan-2021 12:02                1446
luasandbox.unpauseusagetimer.php                   24-Jan-2021 12:02                3004
luasandbox.wrapphpfunction.php                     24-Jan-2021 12:02                4086
luasandboxfunction.call.php                        24-Jan-2021 12:02                6682
luasandboxfunction.construct.php                   24-Jan-2021 12:02                2505
luasandboxfunction.dump.php                        24-Jan-2021 12:02                2242
lzf.configuration.php                              24-Jan-2021 12:02                1076
lzf.constants.php                                  24-Jan-2021 12:02                 986
lzf.installation.php                               24-Jan-2021 12:02                2261
lzf.requirements.php                               24-Jan-2021 12:02                1015
lzf.resources.php                                  24-Jan-2021 12:02                1033
lzf.setup.php                                      24-Jan-2021 12:02                1383
mail.configuration.php                             24-Jan-2021 12:02                5924
mail.constants.php                                 24-Jan-2021 12:02                 994
mail.installation.php                              24-Jan-2021 12:02                1061
mail.requirements.php                              24-Jan-2021 12:02                1705
mail.resources.php                                 24-Jan-2021 12:02                1039
mail.setup.php                                     24-Jan-2021 12:02                1397
mailparse.configuration.php                        24-Jan-2021 12:02                1112
mailparse.constants.php                            24-Jan-2021 12:02                1777
mailparse.installation.php                         24-Jan-2021 12:02                2286
mailparse.requirements.php                         24-Jan-2021 12:02                1051
mailparse.resources.php                            24-Jan-2021 12:02                1069
mailparse.setup.php                                24-Jan-2021 12:02                1455
manual.php                                         24-Jan-2021 12:01                1160
math.configuration.php                             24-Jan-2021 12:02                1082
math.constants.php                                 24-Jan-2021 12:02                3317
math.installation.php                              24-Jan-2021 12:02                1061
math.requirements.php                              24-Jan-2021 12:02                1021
math.resources.php                                 24-Jan-2021 12:02                1039
math.setup.php                                     24-Jan-2021 12:02                1390
mbstring.configuration.php                         24-Jan-2021 12:02               13861
mbstring.constants.php                             24-Jan-2021 12:02                2394
mbstring.encodings.php                             24-Jan-2021 12:02               14641
mbstring.http.php                                  24-Jan-2021 12:02                4846
mbstring.installation.php                          24-Jan-2021 12:02                2349
mbstring.ja-basic.php                              24-Jan-2021 12:02                3378
mbstring.overload.php                              24-Jan-2021 12:02                8023
mbstring.php4.req.php                              24-Jan-2021 12:02                3580
mbstring.requirements.php                          24-Jan-2021 12:02                1045
mbstring.resources.php                             24-Jan-2021 12:02                1063
mbstring.setup.php                                 24-Jan-2021 12:02                1464
mbstring.supported-encodings.php                   24-Jan-2021 12:02                8006
mcrypt.ciphers.php                                 24-Jan-2021 12:02                6291
mcrypt.configuration.php                           24-Jan-2021 12:02                3143
mcrypt.constants.php                               24-Jan-2021 12:02                5601
mcrypt.examples.php                                24-Jan-2021 12:02                5523
mcrypt.installation.php                            24-Jan-2021 12:02                1516
mcrypt.requirements.php                            24-Jan-2021 12:02                1972
mcrypt.resources.php                               24-Jan-2021 12:02                1160
mcrypt.setup.php                                   24-Jan-2021 12:02                1425
memcache.add.php                                   24-Jan-2021 12:02                6831
memcache.addserver.php                             24-Jan-2021 12:02               11877
memcache.close.php                                 24-Jan-2021 12:02                4850
memcache.connect.php                               24-Jan-2021 12:02                6021
memcache.constants.php                             24-Jan-2021 12:02                1997
memcache.decrement.php                             24-Jan-2021 12:02                6958
memcache.delete.php                                24-Jan-2021 12:02                6661
memcache.examples-overview.php                     24-Jan-2021 12:02                6609
memcache.examples.php                              24-Jan-2021 12:02                1235
memcache.flush.php                                 24-Jan-2021 12:02                4237
memcache.get.php                                   24-Jan-2021 12:02                8571
memcache.getextendedstats.php                      24-Jan-2021 12:02                7928
memcache.getserverstatus.php                       24-Jan-2021 12:02                5953
memcache.getstats.php                              24-Jan-2021 12:02                4198
memcache.getversion.php                            24-Jan-2021 12:02                4605
memcache.increment.php                             24-Jan-2021 12:02                6779
memcache.ini.php                                   24-Jan-2021 12:02                8983
memcache.installation.php                          24-Jan-2021 12:02                1878
memcache.pconnect.php                              24-Jan-2021 12:02                5932
memcache.replace.php                               24-Jan-2021 12:02                6822
memcache.requirements.php                          24-Jan-2021 12:02                1274
memcache.resources.php                             24-Jan-2021 12:02                1132
memcache.set.php                                   24-Jan-2021 12:02                9114
memcache.setcompressthreshold.php                  24-Jan-2021 12:02                5546
memcache.setserverparams.php                       24-Jan-2021 12:02               10254
memcache.setup.php                                 24-Jan-2021 12:02                1445
memcached.add.php                                  24-Jan-2021 12:02                4265
memcached.addbykey.php                             24-Jan-2021 12:02                5250
memcached.addserver.php                            24-Jan-2021 12:02                6326
memcached.addservers.php                           24-Jan-2021 12:02                4990
memcached.append.php                               24-Jan-2021 12:02                6600
memcached.appendbykey.php                          24-Jan-2021 12:02                4370
memcached.callbacks.php                            24-Jan-2021 12:02                1350
memcached.callbacks.read-through.php               24-Jan-2021 12:02                4426
memcached.callbacks.result.php                     24-Jan-2021 12:02                4856
memcached.cas.php                                  24-Jan-2021 12:02                9353
memcached.casbykey.php                             24-Jan-2021 12:02                5069
memcached.configuration.php                        24-Jan-2021 12:02                9831
memcached.constants.php                            24-Jan-2021 12:02               18134
memcached.construct.php                            24-Jan-2021 12:02                4239
memcached.decrement.php                            24-Jan-2021 12:02                6356
memcached.decrementbykey.php                       24-Jan-2021 12:02                5302
memcached.delete.php                               24-Jan-2021 12:02                5443
memcached.deletebykey.php                          24-Jan-2021 12:02                4244
memcached.deletemulti.php                          24-Jan-2021 12:02                4736
memcached.deletemultibykey.php                     24-Jan-2021 12:02                4622
memcached.expiration.php                           24-Jan-2021 12:02                1750
memcached.fetch.php                                24-Jan-2021 12:02                6618
memcached.fetchall.php                             24-Jan-2021 12:02                6548
memcached.flush.php                                24-Jan-2021 12:02                4309
memcached.get.php                                  24-Jan-2021 12:02                9060
memcached.getallkeys.php                           24-Jan-2021 12:02                2576
memcached.getbykey.php                             24-Jan-2021 12:02                4998
memcached.getdelayed.php                           24-Jan-2021 12:02                8139
memcached.getdelayedbykey.php                      24-Jan-2021 12:02                4940
memcached.getmulti.php                             24-Jan-2021 12:02               20706
memcached.getmultibykey.php                        24-Jan-2021 12:02                4823
memcached.getoption.php                            24-Jan-2021 12:02                4902
memcached.getresultcode.php                        24-Jan-2021 12:02                4121
memcached.getresultmessage.php                     24-Jan-2021 12:02                4473
memcached.getserverbykey.php                       24-Jan-2021 12:02                7195
memcached.getserverlist.php                        24-Jan-2021 12:02                4424
memcached.getstats.php                             24-Jan-2021 12:02                4847
memcached.getversion.php                           24-Jan-2021 12:02                3769
memcached.increment.php                            24-Jan-2021 12:02                7541
memcached.incrementbykey.php                       24-Jan-2021 12:02                5235
memcached.installation.php                         24-Jan-2021 12:02                2133
memcached.ispersistent.php                         24-Jan-2021 12:02                2650
memcached.ispristine.php                           24-Jan-2021 12:02                2583
memcached.prepend.php                              24-Jan-2021 12:02                6613
memcached.prependbykey.php                         24-Jan-2021 12:02                4394
memcached.quit.php                                 24-Jan-2021 12:02                2144
memcached.replace.php                              24-Jan-2021 12:02                4298
memcached.replacebykey.php                         24-Jan-2021 12:02                5057
memcached.requirements.php                         24-Jan-2021 12:02                1369
memcached.resetserverlist.php                      24-Jan-2021 12:02                2888
memcached.resources.php                            24-Jan-2021 12:02                1069
memcached.sessions.php                             24-Jan-2021 12:02                2382
memcached.set.php                                  24-Jan-2021 12:02                8749
memcached.setbykey.php                             24-Jan-2021 12:02                6524
memcached.setmulti.php                             24-Jan-2021 12:02                6036
memcached.setmultibykey.php                        24-Jan-2021 12:02                4449
memcached.setoption.php                            24-Jan-2021 12:02                6290
memcached.setoptions.php                           24-Jan-2021 12:02                6709
memcached.setsaslauthdata.php                      24-Jan-2021 12:02                3060
memcached.setup.php                                24-Jan-2021 12:02                1457
memcached.touch.php                                24-Jan-2021 12:02                3320
memcached.touchbykey.php                           24-Jan-2021 12:02                4105
memtrack.constants.php                             24-Jan-2021 12:01                1022
memtrack.examples.basic.php                        24-Jan-2021 12:01                3329
memtrack.examples.php                              24-Jan-2021 12:01                1253
memtrack.ini.php                                   24-Jan-2021 12:01                4782
memtrack.installation.php                          24-Jan-2021 12:01                1388
memtrack.requirements.php                          24-Jan-2021 12:01                1045
memtrack.resources.php                             24-Jan-2021 12:01                1053
memtrack.setup.php                                 24-Jan-2021 12:01                1424
messageformatter.create.php                        24-Jan-2021 12:02               10576
messageformatter.format.php                        24-Jan-2021 12:02                9432
messageformatter.formatmessage.php                 24-Jan-2021 12:02                9649
messageformatter.geterrorcode.php                  24-Jan-2021 12:02                3769
messageformatter.geterrormessage.php               24-Jan-2021 12:02                7647
messageformatter.getlocale.php                     24-Jan-2021 12:02                5285
messageformatter.getpattern.php                    24-Jan-2021 12:02               10002
messageformatter.parse.php                         24-Jan-2021 12:02                9443
messageformatter.parsemessage.php                  24-Jan-2021 12:02               10048
messageformatter.setpattern.php                    24-Jan-2021 12:02               10686
mhash.configuration.php                            24-Jan-2021 12:02                1088
mhash.constants.php                                24-Jan-2021 12:02                4707
mhash.examples.php                                 24-Jan-2021 12:02                3317
mhash.installation.php                             24-Jan-2021 12:02                1456
mhash.requirements.php                             24-Jan-2021 12:02                1188
mhash.resources.php                                24-Jan-2021 12:02                1045
mhash.setup.php                                    24-Jan-2021 12:02                1407
migration56.changed-functions.php                  24-Jan-2021 12:02                6329
migration56.constants.php                          24-Jan-2021 12:02                5101
migration56.deprecated.php                         24-Jan-2021 12:02                6093
migration56.extensions.php                         24-Jan-2021 12:02                4185
migration56.incompatible.php                       24-Jan-2021 12:02                8540
migration56.new-features.php                       24-Jan-2021 12:02               30446
migration56.new-functions.php                      24-Jan-2021 12:02                7401
migration56.openssl.php                            24-Jan-2021 12:02               26112
migration56.php                                    24-Jan-2021 12:02                2254
migration70.changed-functions.php                  24-Jan-2021 12:02                4872
migration70.classes.php                            24-Jan-2021 12:02                3369
migration70.constants.php                          24-Jan-2021 12:02                6944
migration70.deprecated.php                         24-Jan-2021 12:02                5558
migration70.incompatible.php                       24-Jan-2021 12:02               60992
migration70.new-features.php                       24-Jan-2021 12:02               42439
migration70.new-functions.php                      24-Jan-2021 12:02                7182
migration70.other-changes.php                      24-Jan-2021 12:02                3177
migration70.php                                    24-Jan-2021 12:02                2620
migration70.removed-exts-sapis.php                 24-Jan-2021 12:02                3014
migration70.sapi-changes.php                       24-Jan-2021 12:02                1844
migration71.changed-functions.php                  24-Jan-2021 12:02                7213
migration71.constants.php                          24-Jan-2021 12:02                7099
migration71.deprecated.php                         24-Jan-2021 12:02                2075
migration71.incompatible.php                       24-Jan-2021 12:02               27179
migration71.new-features.php                       24-Jan-2021 12:02               27596
migration71.new-functions.php                      24-Jan-2021 12:02                4892
migration71.other-changes.php                      24-Jan-2021 12:02                7837
migration71.php                                    24-Jan-2021 12:02                2315
migration71.windows-support.php                    24-Jan-2021 12:02                7027
migration72.constants.php                          24-Jan-2021 12:02               24542
migration72.deprecated.php                         24-Jan-2021 12:02                9417
migration72.incompatible.php                       24-Jan-2021 12:02               19144
migration72.new-features.php                       24-Jan-2021 12:02               12817
migration72.new-functions.php                      24-Jan-2021 12:02               24265
migration72.other-changes.php                      24-Jan-2021 12:02                5317
migration72.php                                    24-Jan-2021 12:02                2204
migration73.constants.php                          24-Jan-2021 12:02               17596
migration73.deprecated.php                         24-Jan-2021 12:02                8291
migration73.incompatible.php                       24-Jan-2021 12:02               18171
migration73.new-features.php                       24-Jan-2021 12:02               15788
migration73.new-functions.php                      24-Jan-2021 12:02                7101
migration73.other-changes.php                      24-Jan-2021 12:02               15045
migration73.php                                    24-Jan-2021 12:02                2345
migration73.windows-support.php                    24-Jan-2021 12:02                1707
migration74.constants.php                          24-Jan-2021 12:02                5757
migration74.deprecated.php                         24-Jan-2021 12:02               14485
migration74.incompatible.php                       24-Jan-2021 12:02               15800
migration74.new-classes.php                        24-Jan-2021 12:02                1307
migration74.new-features.php                       24-Jan-2021 12:02               22098
migration74.new-functions.php                      24-Jan-2021 12:02                3137
migration74.other-changes.php                      24-Jan-2021 12:02               20529
migration74.php                                    24-Jan-2021 12:02                2555
migration74.removed-extensions.php                 24-Jan-2021 12:02                1760
migration74.windows-support.php                    24-Jan-2021 12:02                3633
migration80.deprecated.php                         24-Jan-2021 12:02               18592
migration80.incompatible.php                       24-Jan-2021 12:02               90146
migration80.new-features.php                       24-Jan-2021 12:02               31723
migration80.other-changes.php                      24-Jan-2021 12:02               13188
migration80.php                                    24-Jan-2021 12:02                2198
mime-magic.configuration.php                       24-Jan-2021 12:02                2649
mime-magic.constants.php                           24-Jan-2021 12:02                1032
mime-magic.installation.php                        24-Jan-2021 12:02                2763
mime-magic.requirements.php                        24-Jan-2021 12:02                1057
mime-magic.resources.php                           24-Jan-2021 12:02                1075
mime-magic.setup.php                               24-Jan-2021 12:02                1471
misc.configuration.php                             24-Jan-2021 12:02                5260
misc.constants.php                                 24-Jan-2021 12:02                1962
misc.installation.php                              24-Jan-2021 12:02                1061
misc.requirements.php                              24-Jan-2021 12:02                1021
misc.resources.php                                 24-Jan-2021 12:02                1039
misc.setup.php                                     24-Jan-2021 12:02                1382
mongo.configuration.php                            24-Jan-2021 12:02               12170
mongo.connecting.auth.php                          24-Jan-2021 12:02                6109
mongo.connecting.mongos.php                        24-Jan-2021 12:02                2868
mongo.connecting.persistent.php                    24-Jan-2021 12:02                5086
mongo.connecting.php                               24-Jan-2021 12:02                2074
mongo.connecting.pools.php                         24-Jan-2021 12:02                6674
mongo.connecting.rs.php                            24-Jan-2021 12:02                7048
mongo.connecting.uds.php                           24-Jan-2021 12:02                3194
mongo.connectutil.php                              24-Jan-2021 12:02                2386
mongo.constants.php                                24-Jan-2021 12:02                7825
mongo.construct.php                                24-Jan-2021 12:02                2642
mongo.context.php                                  24-Jan-2021 12:02                3691
mongo.core.php                                     24-Jan-2021 12:02                1901
mongo.exceptions.php                               24-Jan-2021 12:02                3040
mongo.getpoolsize.php                              24-Jan-2021 12:02                6494
mongo.getslave.php                                 24-Jan-2021 12:02                4141
mongo.getslaveokay.php                             24-Jan-2021 12:02                3268
mongo.gridfs.php                                   24-Jan-2021 12:02                1398
mongo.installation.php                             24-Jan-2021 12:02               10642
mongo.manual.php                                   24-Jan-2021 12:02                2503
mongo.miscellaneous.php                            24-Jan-2021 12:02                1363
mongo.pooldebug.php                                24-Jan-2021 12:02                4796
mongo.queries.php                                  24-Jan-2021 12:02               21347
mongo.readpreferences.php                          24-Jan-2021 12:02               19214
mongo.requirements.php                             24-Jan-2021 12:02                1027
mongo.security.php                                 24-Jan-2021 12:02                8906
mongo.setpoolsize.php                              24-Jan-2021 12:02                5963
mongo.setslaveokay.php                             24-Jan-2021 12:02                3571
mongo.setup.php                                    24-Jan-2021 12:02                1570
mongo.sqltomongo.php                               24-Jan-2021 12:02                8462
mongo.switchslave.php                              24-Jan-2021 12:02                4374
mongo.testing.php                                  24-Jan-2021 12:02                2292
mongo.trouble.php                                  24-Jan-2021 12:02                2114
mongo.tutorial.collection.php                      24-Jan-2021 12:02                3034
mongo.tutorial.connecting.php                      24-Jan-2021 12:02                3173
mongo.tutorial.counting.php                        24-Jan-2021 12:02                2342
mongo.tutorial.criteria.php                        24-Jan-2021 12:02                3695
mongo.tutorial.cursor.php                          24-Jan-2021 12:02                3793
mongo.tutorial.findone.php                         24-Jan-2021 12:02                7387
mongo.tutorial.indexes.php                         24-Jan-2021 12:02                3569
mongo.tutorial.insert.multiple.php                 24-Jan-2021 12:02                3878
mongo.tutorial.insert.php                          24-Jan-2021 12:02                4953
mongo.tutorial.multi.query.php                     24-Jan-2021 12:02                4297
mongo.tutorial.php                                 24-Jan-2021 12:02                6646
mongo.tutorial.selectdb.php                        24-Jan-2021 12:02                3693
mongo.types.php                                    24-Jan-2021 12:02               22104
mongo.updates.php                                  24-Jan-2021 12:02                9154
mongo.writeconcerns.php                            24-Jan-2021 12:02               25403
mongo.writes.php                                   24-Jan-2021 12:02                4063
mongobindata.construct.php                         24-Jan-2021 12:02                4590
mongobindata.tostring.php                          24-Jan-2021 12:02                2749
mongoclient.close.php                              24-Jan-2021 12:02                8797
mongoclient.connect.php                            24-Jan-2021 12:02                2602
mongoclient.construct.php                          24-Jan-2021 12:02               22982
mongoclient.dropdb.php                             24-Jan-2021 12:02                3269
mongoclient.get.php                                24-Jan-2021 12:02                4446
mongoclient.getconnections.php                     24-Jan-2021 12:02                4486
mongoclient.gethosts.php                           24-Jan-2021 12:02                5328
mongoclient.getreadpreference.php                  24-Jan-2021 12:02                6714
mongoclient.getwriteconcern.php                    24-Jan-2021 12:02                5347
mongoclient.killcursor.php                         24-Jan-2021 12:02                7452
mongoclient.listdbs.php                            24-Jan-2021 12:02                4692
mongoclient.selectcollection.php                   24-Jan-2021 12:02                5396
mongoclient.selectdb.php                           24-Jan-2021 12:02                3221
mongoclient.setreadpreference.php                  24-Jan-2021 12:02                6030
mongoclient.setwriteconcern.php                    24-Jan-2021 12:02                5316
mongoclient.tostring.php                           24-Jan-2021 12:02                2307
mongocode.construct.php                            24-Jan-2021 12:02                6629
mongocode.tostring.php                             24-Jan-2021 12:02                4197
mongocollection.--tostring.php                     24-Jan-2021 12:02                4283
mongocollection.aggregate.php                      24-Jan-2021 12:02               32032
mongocollection.aggregatecursor.php                24-Jan-2021 12:02               22308
mongocollection.batchinsert.php                    24-Jan-2021 12:02               25286
mongocollection.construct.php                      24-Jan-2021 12:02                2930
mongocollection.count.php                          24-Jan-2021 12:02                5910
mongocollection.createdbref.php                    24-Jan-2021 12:02                5956
mongocollection.createindex.php                    24-Jan-2021 12:02               22671
mongocollection.deleteindex.php                    24-Jan-2021 12:02               11308
mongocollection.deleteindexes.php                  24-Jan-2021 12:02                4383
mongocollection.distinct.php                       24-Jan-2021 12:02               11274
mongocollection.drop.php                           24-Jan-2021 12:02                3804
mongocollection.ensureindex.php                    24-Jan-2021 12:02               26338
mongocollection.find.php                           24-Jan-2021 12:02               22573
mongocollection.findandmodify.php                  24-Jan-2021 12:02               18453
mongocollection.findone.php                        24-Jan-2021 12:02               10093
mongocollection.get.php                            24-Jan-2021 12:02                4085
mongocollection.getdbref.php                       24-Jan-2021 12:02                5555
mongocollection.getindexinfo.php                   24-Jan-2021 12:02                5860
mongocollection.getname.php                        24-Jan-2021 12:02                4196
mongocollection.getreadpreference.php              24-Jan-2021 12:02                6859
mongocollection.getslaveokay.php                   24-Jan-2021 12:02                3294
mongocollection.getwriteconcern.php                24-Jan-2021 12:02                5483
mongocollection.group.php                          24-Jan-2021 12:02               17101
mongocollection.insert.php                         24-Jan-2021 12:02               23607
mongocollection.parallelcollectionscan.php         24-Jan-2021 12:02                7765
mongocollection.remove.php                         24-Jan-2021 12:02               12504
mongocollection.save.php                           24-Jan-2021 12:02               13485
mongocollection.setreadpreference.php              24-Jan-2021 12:02                6216
mongocollection.setslaveokay.php                   24-Jan-2021 12:02                3809
mongocollection.setwriteconcern.php                24-Jan-2021 12:02                5510
mongocollection.toindexstring.php                  24-Jan-2021 12:02                6344
mongocollection.update.php                         24-Jan-2021 12:02               24644
mongocollection.validate.php                       24-Jan-2021 12:02                2392
mongocommandcursor.batchsize.php                   24-Jan-2021 12:02                4153
mongocommandcursor.construct.php                   24-Jan-2021 12:02                8716
mongocommandcursor.createfromdocument.php          24-Jan-2021 12:02               10357
mongocommandcursor.current.php                     24-Jan-2021 12:02                2735
mongocommandcursor.dead.php                        24-Jan-2021 12:02                2995
mongocommandcursor.getreadpreference.php           24-Jan-2021 12:02                7384
mongocommandcursor.info.php                        24-Jan-2021 12:02                8480
mongocommandcursor.key.php                         24-Jan-2021 12:02                2392
mongocommandcursor.next.php                        24-Jan-2021 12:02                2825
mongocommandcursor.rewind.php                      24-Jan-2021 12:02                5323
mongocommandcursor.setreadpreference.php           24-Jan-2021 12:02                9496
mongocommandcursor.timeout.php                     24-Jan-2021 12:02                7332
mongocommandcursor.valid.php                       24-Jan-2021 12:02                2449
mongocursor.addoption.php                          24-Jan-2021 12:02               12620
mongocursor.awaitdata.php                          24-Jan-2021 12:02                7836
mongocursor.batchsize.php                          24-Jan-2021 12:02               10435
mongocursor.construct.php                          24-Jan-2021 12:02                3176
mongocursor.count.php                              24-Jan-2021 12:02                6332
mongocursor.current.php                            24-Jan-2021 12:02                2572
mongocursor.dead.php                               24-Jan-2021 12:02                3260
mongocursor.doquery.php                            24-Jan-2021 12:02                5946
mongocursor.explain.php                            24-Jan-2021 12:02                5639
mongocursor.fields.php                             24-Jan-2021 12:02                4250
mongocursor.getnext.php                            24-Jan-2021 12:02                1960
mongocursor.getreadpreference.php                  24-Jan-2021 12:02                6142
mongocursor.hasnext.php                            24-Jan-2021 12:02                2416
mongocursor.hint.php                               24-Jan-2021 12:02                3644
mongocursor.immortal.php                           24-Jan-2021 12:02                3772
mongocursor.info.php                               24-Jan-2021 12:02                7609
mongocursor.key.php                                24-Jan-2021 12:02                2498
mongocursor.limit.php                              24-Jan-2021 12:02                3285
mongocursor.maxtimems.php                          24-Jan-2021 12:02                5615
mongocursor.next.php                               24-Jan-2021 12:02                2701
mongocursor.partial.php                            24-Jan-2021 12:02                3777
mongocursor.reset.php                              24-Jan-2021 12:02                1955
mongocursor.rewind.php                             24-Jan-2021 12:02                3602
mongocursor.setflag.php                            24-Jan-2021 12:02                8595
mongocursor.setreadpreference.php                  24-Jan-2021 12:02                6429
mongocursor.skip.php                               24-Jan-2021 12:02                2920
mongocursor.slaveokay.php                          24-Jan-2021 12:02                9096
mongocursor.snapshot.php                           24-Jan-2021 12:02                3198
mongocursor.sort.php                               24-Jan-2021 12:02                5542
mongocursor.tailable.php                           24-Jan-2021 12:02                6697
mongocursor.timeout.php                            24-Jan-2021 12:02                7410
mongocursor.valid.php                              24-Jan-2021 12:02                2374
mongocursorexception.gethost.php                   24-Jan-2021 12:02                2248
mongocursorinterface.batchsize.php                 24-Jan-2021 12:02                2776
mongocursorinterface.dead.php                      24-Jan-2021 12:02                2587
mongocursorinterface.getreadpreference.php         24-Jan-2021 12:02                3149
mongocursorinterface.info.php                      24-Jan-2021 12:02                2550
mongocursorinterface.setreadpreference.php         24-Jan-2021 12:02                4039
mongocursorinterface.timeout.php                   24-Jan-2021 12:02                3600
mongodate.construct.php                            24-Jan-2021 12:02                5977
mongodate.todatetime.php                           24-Jan-2021 12:02                4527
mongodate.tostring.php                             24-Jan-2021 12:02                2740
mongodb-bson-binary.construct.php                  24-Jan-2021 12:02                6795
mongodb-bson-binary.getdata.php                    24-Jan-2021 12:02                4481
mongodb-bson-binary.gettype.php                    24-Jan-2021 12:02                4465
mongodb-bson-binary.jsonserialize.php              24-Jan-2021 12:02                5287
mongodb-bson-binary.serialize.php                  24-Jan-2021 12:02                3267
mongodb-bson-binary.tostring.php                   24-Jan-2021 12:02                4296
mongodb-bson-binary.unserialize.php                24-Jan-2021 12:02                4152
mongodb-bson-binaryinterface.getdata.php           24-Jan-2021 12:02                2646
mongodb-bson-binaryinterface.gettype.php           24-Jan-2021 12:02                2658
mongodb-bson-binaryinterface.tostring.php          24-Jan-2021 12:02                3128
mongodb-bson-dbpointer.construct.php               24-Jan-2021 12:02                2505
mongodb-bson-dbpointer.jsonserialize.php           24-Jan-2021 12:02                5353
mongodb-bson-dbpointer.serialize.php               24-Jan-2021 12:02                3339
mongodb-bson-dbpointer.tostring.php                24-Jan-2021 12:02                2489
mongodb-bson-dbpointer.unserialize.php             24-Jan-2021 12:02                3686
mongodb-bson-decimal128.construct.php              24-Jan-2021 12:02                5944
mongodb-bson-decimal128.jsonserialize.php          24-Jan-2021 12:02                5373
mongodb-bson-decimal128.serialize.php              24-Jan-2021 12:02                3363
mongodb-bson-decimal128.tostring.php               24-Jan-2021 12:02                4789
mongodb-bson-decimal128.unserialize.php            24-Jan-2021 12:02                4248
mongodb-bson-decimal128interface.tostring.php      24-Jan-2021 12:02                2804
mongodb-bson-int64.construct.php                   24-Jan-2021 12:02                2457
mongodb-bson-int64.jsonserialize.php               24-Jan-2021 12:02                5032
mongodb-bson-int64.serialize.php                   24-Jan-2021 12:02                3245
mongodb-bson-int64.tostring.php                    24-Jan-2021 12:02                3698
mongodb-bson-int64.unserialize.php                 24-Jan-2021 12:02                4122
mongodb-bson-javascript.construct.php              24-Jan-2021 12:02                6889
mongodb-bson-javascript.getcode.php                24-Jan-2021 12:02                4325
mongodb-bson-javascript.getscope.php               24-Jan-2021 12:02                5396
mongodb-bson-javascript.jsonserialize.php          24-Jan-2021 12:02                5369
mongodb-bson-javascript.serialize.php              24-Jan-2021 12:02                3363
mongodb-bson-javascript.tostring.php               24-Jan-2021 12:02                4162
mongodb-bson-javascript.unserialize.php            24-Jan-2021 12:02                4240
mongodb-bson-javascriptinterface.getcode.php       24-Jan-2021 12:02                2736
mongodb-bson-javascriptinterface.getscope.php      24-Jan-2021 12:02                2848
mongodb-bson-javascriptinterface.tostring.php      24-Jan-2021 12:02                3222
mongodb-bson-maxkey.construct.php                  24-Jan-2021 12:02                3612
mongodb-bson-maxkey.jsonserialize.php              24-Jan-2021 12:02                5293
mon