Index of /php/manual/en/


../
feeds/                                             27-Sep-2020 11:03                   -
images/                                            27-Sep-2020 11:03                   -
styles/                                            27-Sep-2020 11:02                   -
toc/                                               27-Sep-2020 11:03                   -
about.formats.php                                  27-Sep-2020 11:03                4128
about.generate.php                                 27-Sep-2020 11:03                2688
about.howtohelp.php                                27-Sep-2020 11:03                2922
about.more.php                                     27-Sep-2020 11:03                1723
about.notes.php                                    27-Sep-2020 11:03                2303
about.php                                          27-Sep-2020 11:03                1745
about.phpversions.php                              27-Sep-2020 11:03                3251
about.prototypes.php                               27-Sep-2020 11:03                7190
about.translations.php                             27-Sep-2020 11:03                3073
aliases.php                                        27-Sep-2020 11:03               33804
apache.configuration.php                           27-Sep-2020 11:03                4986
apache.constants.php                               27-Sep-2020 11:03                1035
apache.installation.php                            27-Sep-2020 11:03                1139
apache.requirements.php                            27-Sep-2020 11:03                1083
apache.resources.php                               27-Sep-2020 11:03                1081
apache.setup.php                                   27-Sep-2020 11:03                1476
apcu.configuration.php                             27-Sep-2020 11:02               15058
apcu.constants.php                                 27-Sep-2020 11:02                6408
apcu.installation.php                              27-Sep-2020 11:02                2657
apcu.requirements.php                              27-Sep-2020 11:02                1071
apcu.resources.php                                 27-Sep-2020 11:02                1069
apcu.setup.php                                     27-Sep-2020 11:02                1436
apcuiterator.construct.php                         27-Sep-2020 11:02                6748
apcuiterator.current.php                           27-Sep-2020 11:02                2865
apcuiterator.gettotalcount.php                     27-Sep-2020 11:02                3051
apcuiterator.gettotalhits.php                      27-Sep-2020 11:02                3136
apcuiterator.gettotalsize.php                      27-Sep-2020 11:02                2929
apcuiterator.key.php                               27-Sep-2020 11:02                2617
apcuiterator.next.php                              27-Sep-2020 11:02                2831
apcuiterator.rewind.php                            27-Sep-2020 11:02                2616
apcuiterator.valid.php                             27-Sep-2020 11:02                2695
appendices.php                                     27-Sep-2020 11:03               16073
appenditerator.append.php                          27-Sep-2020 11:03                5384
appenditerator.construct.php                       27-Sep-2020 11:03               10629
appenditerator.current.php                         27-Sep-2020 11:03                3395
appenditerator.getarrayiterator.php                27-Sep-2020 11:03                3016
appenditerator.getinneriterator.php                27-Sep-2020 11:03                6717
appenditerator.getiteratorindex.php                27-Sep-2020 11:03                6646
appenditerator.key.php                             27-Sep-2020 11:03                8104
appenditerator.next.php                            27-Sep-2020 11:03                3294
appenditerator.rewind.php                          27-Sep-2020 11:03                3288
appenditerator.valid.php                           27-Sep-2020 11:03                3136
array.configuration.php                            27-Sep-2020 11:03                1130
array.constants.php                                27-Sep-2020 11:03                9558
array.installation.php                             27-Sep-2020 11:03                1113
array.requirements.php                             27-Sep-2020 11:03                1077
array.resources.php                                27-Sep-2020 11:03                1075
array.setup.php                                    27-Sep-2020 11:03                1444
array.sorting.php                                  27-Sep-2020 11:03                6494
arrayaccess.offsetexists.php                       27-Sep-2020 11:02                9138
arrayaccess.offsetget.php                          27-Sep-2020 11:02                4798
arrayaccess.offsetset.php                          27-Sep-2020 11:02                5031
arrayaccess.offsetunset.php                        27-Sep-2020 11:02                2722
arrayiterator.append.php                           27-Sep-2020 11:03                3361
arrayiterator.asort.php                            27-Sep-2020 11:03                3050
arrayiterator.construct.php                        27-Sep-2020 11:03                4175
arrayiterator.count.php                            27-Sep-2020 11:03                3087
arrayiterator.current.php                          27-Sep-2020 11:03                5421
arrayiterator.getarraycopy.php                     27-Sep-2020 11:03                2927
arrayiterator.getflags.php                         27-Sep-2020 11:03                2829
arrayiterator.key.php                              27-Sep-2020 11:03                3793
arrayiterator.ksort.php                            27-Sep-2020 11:03                3048
arrayiterator.natcasesort.php                      27-Sep-2020 11:03                3377
arrayiterator.natsort.php                          27-Sep-2020 11:03                3307
arrayiterator.next.php                             27-Sep-2020 11:03                4617
arrayiterator.offsetexists.php                     27-Sep-2020 11:03                3064
arrayiterator.offsetget.php                        27-Sep-2020 11:03                3296
arrayiterator.offsetset.php                        27-Sep-2020 11:03                3542
arrayiterator.offsetunset.php                      27-Sep-2020 11:03                3652
arrayiterator.rewind.php                           27-Sep-2020 11:03                4594
arrayiterator.seek.php                             27-Sep-2020 11:03                2402
arrayiterator.serialize.php                        27-Sep-2020 11:03                2692
arrayiterator.setflags.php                         27-Sep-2020 11:03                3924
arrayiterator.uasort.php                           27-Sep-2020 11:03                4369
arrayiterator.uksort.php                           27-Sep-2020 11:03                4292
arrayiterator.unserialize.php                      27-Sep-2020 11:03                2922
arrayiterator.valid.php                            27-Sep-2020 11:03                4551
arrayobject.append.php                             27-Sep-2020 11:03                5324
arrayobject.asort.php                              27-Sep-2020 11:03                6312
arrayobject.construct.php                          27-Sep-2020 11:03                6962
arrayobject.count.php                              27-Sep-2020 11:03                5283
arrayobject.exchangearray.php                      27-Sep-2020 11:03                6366
arrayobject.getarraycopy.php                       27-Sep-2020 11:03                5198
arrayobject.getflags.php                           27-Sep-2020 11:03                6089
arrayobject.getiterator.php                        27-Sep-2020 11:03                5414
arrayobject.getiteratorclass.php                   27-Sep-2020 11:03                6656
arrayobject.ksort.php                              27-Sep-2020 11:03                6065
arrayobject.natcasesort.php                        27-Sep-2020 11:03                7081
arrayobject.natsort.php                            27-Sep-2020 11:03                6826
arrayobject.offsetexists.php                       27-Sep-2020 11:03                4697
arrayobject.offsetget.php                          27-Sep-2020 11:03                4980
arrayobject.offsetset.php                          27-Sep-2020 11:03                6760
arrayobject.offsetunset.php                        27-Sep-2020 11:03                4126
arrayobject.serialize.php                          27-Sep-2020 11:03                4919
arrayobject.setflags.php                           27-Sep-2020 11:03                6701
arrayobject.setiteratorclass.php                   27-Sep-2020 11:03                5818
arrayobject.uasort.php                             27-Sep-2020 11:03                8957
arrayobject.uksort.php                             27-Sep-2020 11:03                8388
arrayobject.unserialize.php                        27-Sep-2020 11:03                3369
bc.configuration.php                               27-Sep-2020 11:03                2356
bc.constants.php                                   27-Sep-2020 11:03                1013
bc.installation.php                                27-Sep-2020 11:03                1308
bc.requirements.php                                27-Sep-2020 11:03                1059
bc.resources.php                                   27-Sep-2020 11:03                1057
bc.setup.php                                       27-Sep-2020 11:03                1438
blenc.configuration.php                            27-Sep-2020 11:02                2224
blenc.constants.php                                27-Sep-2020 11:02                1472
blenc.installation.php                             27-Sep-2020 11:02                2436
blenc.requirements.php                             27-Sep-2020 11:02                1032
blenc.resources.php                                27-Sep-2020 11:02                1034
blenc.setup.php                                    27-Sep-2020 11:02                1462
book.apache.php                                    27-Sep-2020 11:03                3159
book.apcu.php                                      27-Sep-2020 11:02                4128
book.array.php                                     27-Sep-2020 11:03               11350
book.bc.php                                        27-Sep-2020 11:03                2800
book.blenc.php                                     27-Sep-2020 11:02                1929
book.bson.php                                      27-Sep-2020 11:03               19780
book.bzip2.php                                     27-Sep-2020 11:02                2778
book.calendar.php                                  27-Sep-2020 11:03                3896
book.classkit.php                                  27-Sep-2020 11:03                2603
book.classobj.php                                  27-Sep-2020 11:03                4217
book.cmark.php                                     27-Sep-2020 11:03                8576
book.com.php                                       27-Sep-2020 11:03                7787
book.componere.php                                 27-Sep-2020 11:02                6031
book.csprng.php                                    27-Sep-2020 11:02                2032
book.ctype.php                                     27-Sep-2020 11:03                3002
book.cubrid.php                                    27-Sep-2020 11:03               13704
book.curl.php                                      27-Sep-2020 11:03                6269
book.datetime.php                                  27-Sep-2020 11:03               15221
book.dba.php                                       27-Sep-2020 11:03                3282
book.dbase.php                                     27-Sep-2020 11:03                3088
book.dbplus.php                                    27-Sep-2020 11:03                6587
book.dbx.php                                       27-Sep-2020 11:03                2669
book.dio.php                                       27-Sep-2020 11:03                2807
book.dir.php                                       27-Sep-2020 11:03                2926
book.dom.php                                       27-Sep-2020 11:03               16557
book.ds.php                                        27-Sep-2020 11:03               24967
book.eio.php                                       27-Sep-2020 11:03                7796
book.enchant.php                                   27-Sep-2020 11:03                4793
book.errorfunc.php                                 27-Sep-2020 11:02                3294
book.ev.php                                        27-Sep-2020 11:03               13235
book.event.php                                     27-Sep-2020 11:03               22762
book.exec.php                                      27-Sep-2020 11:03                3061
book.exif.php                                      27-Sep-2020 11:03                2347
book.expect.php                                    27-Sep-2020 11:03                2344
book.fann.php                                      27-Sep-2020 11:03               22961
book.fbsql.php                                     27-Sep-2020 11:03                8494
book.fdf.php                                       27-Sep-2020 11:03                5466
book.ffi.php                                       27-Sep-2020 11:02                3957
book.fileinfo.php                                  27-Sep-2020 11:03                2913
book.filepro.php                                   27-Sep-2020 11:03                2609
book.filesystem.php                                27-Sep-2020 11:03                9081
book.filter.php                                    27-Sep-2020 11:03                3278
book.fpm.php                                       27-Sep-2020 11:03                1558
book.ftp.php                                       27-Sep-2020 11:03                5665
book.funchand.php                                  27-Sep-2020 11:03                3477
book.gearman.php                                   27-Sep-2020 11:03               14547
book.gender.php                                    27-Sep-2020 11:03                2458
book.geoip.php                                     27-Sep-2020 11:03                4220
book.gettext.php                                   27-Sep-2020 11:03                2778
book.gmagick.php                                   27-Sep-2020 11:03               22440
book.gmp.php                                       27-Sep-2020 11:03                6112
book.gnupg.php                                     27-Sep-2020 11:03                4219
book.hash.php                                      27-Sep-2020 11:03                3784
book.hrtime.php                                    27-Sep-2020 11:03                3345
book.ibase.php                                     27-Sep-2020 11:03               11870
book.ibm-db2.php                                   27-Sep-2020 11:03                8492
book.iconv.php                                     27-Sep-2020 11:03                3095
book.ifx.php                                       27-Sep-2020 11:03                5716
book.iisfunc.php                                   27-Sep-2020 11:03                3754
book.image.php                                     27-Sep-2020 11:03               14448
book.imagick.php                                   27-Sep-2020 11:03               62158
book.imap.php                                      27-Sep-2020 11:03                9886
book.info.php                                      27-Sep-2020 11:02                7818
book.ingres.php                                    27-Sep-2020 11:03                5942
book.inotify.php                                   27-Sep-2020 11:03                2408
book.intl.php                                      27-Sep-2020 11:03               43762
book.json.php                                      27-Sep-2020 11:03                2666
book.judy.php                                      27-Sep-2020 11:03                3967
book.ldap.php                                      27-Sep-2020 11:03                8373
book.libxml.php                                    27-Sep-2020 11:03                2830
book.lua.php                                       27-Sep-2020 11:03                2505
book.luasandbox.php                                27-Sep-2020 11:03                5424
book.lzf.php                                       27-Sep-2020 11:02                2055
book.mail.php                                      27-Sep-2020 11:03                1933
book.mailparse.php                                 27-Sep-2020 11:03                3769
book.math.php                                      27-Sep-2020 11:03                5805
book.maxdb.php                                     27-Sep-2020 11:03               14338
book.mbstring.php                                  27-Sep-2020 11:03                9345
book.mcrypt.php                                    27-Sep-2020 11:03                6822
book.memcache.php                                  27-Sep-2020 11:03                4070
book.memcached.php                                 27-Sep-2020 11:03                7934
book.memtrack.php                                  27-Sep-2020 11:02                1891
book.mhash.php                                     27-Sep-2020 11:03                2337
book.mime-magic.php                                27-Sep-2020 11:03                1756
book.misc.php                                      27-Sep-2020 11:03                5106
book.mongo.php                                     27-Sep-2020 11:03                7014
book.mongodb.php                                   27-Sep-2020 11:03               20948
book.mqseries.php                                  27-Sep-2020 11:03                3037
book.msql.php                                      27-Sep-2020 11:03                5670
book.mysql-xdevapi.php                             27-Sep-2020 11:03               28769
book.mysql.php                                     27-Sep-2020 11:03                7462
book.mysqli.php                                    27-Sep-2020 11:03               19654
book.mysqlnd-memcache.php                          27-Sep-2020 11:03                2677
book.mysqlnd-ms.php                                27-Sep-2020 11:03                6785
book.mysqlnd-mux.php                               27-Sep-2020 11:03                2245
book.mysqlnd-qc.php                                27-Sep-2020 11:03                4568
book.mysqlnd-uh.php                                27-Sep-2020 11:03               11092
book.mysqlnd.php                                   27-Sep-2020 11:03                2334
book.ncurses.php                                   27-Sep-2020 11:02               20610
book.network.php                                   27-Sep-2020 11:03                5662
book.nsapi.php                                     27-Sep-2020 11:03                2140
book.oauth.php                                     27-Sep-2020 11:03                7043
book.oci8.php                                      27-Sep-2020 11:03               16592
book.opcache.php                                   27-Sep-2020 11:02                2539
book.openal.php                                    27-Sep-2020 11:02                4290
book.openssl.php                                   27-Sep-2020 11:03                9465
book.outcontrol.php                                27-Sep-2020 11:02                3994
book.paradox.php                                   27-Sep-2020 11:03                4390
book.parallel.php                                  27-Sep-2020 11:03                5590
book.parle.php                                     27-Sep-2020 11:03                8683
book.password.php                                  27-Sep-2020 11:03                2427
book.pcntl.php                                     27-Sep-2020 11:03                4702
book.pcre.php                                      27-Sep-2020 11:03                3556
book.pdf.php                                       27-Sep-2020 11:03               20156
book.pdo.php                                       27-Sep-2020 11:03                7754
book.pgsql.php                                     27-Sep-2020 11:03               11810
book.phar.php                                      27-Sep-2020 11:02               16462
book.phpdbg.php                                    27-Sep-2020 11:02                2769
book.pht.php                                       27-Sep-2020 11:03                6266
book.posix.php                                     27-Sep-2020 11:03                6015
book.proctitle.php                                 27-Sep-2020 11:03                2049
book.ps.php                                        27-Sep-2020 11:03                9041
book.pspell.php                                    27-Sep-2020 11:03                4101
book.pthreads.php                                  27-Sep-2020 11:03                7204
book.quickhash.php                                 27-Sep-2020 11:03                8763
book.radius.php                                    27-Sep-2020 11:02                5391
book.rar.php                                       27-Sep-2020 11:02                5116
book.readline.php                                  27-Sep-2020 11:02                3503
book.recode.php                                    27-Sep-2020 11:03                2148
book.reflection.php                                27-Sep-2020 11:03               29448
book.regex.php                                     27-Sep-2020 11:03                2574
book.rpminfo.php                                   27-Sep-2020 11:03                2263
book.rrd.php                                       27-Sep-2020 11:03                4963
book.runkit7.php                                   27-Sep-2020 11:02                4080
book.scoutapm.php                                  27-Sep-2020 11:03                2052
book.sdo-das-xml.php                               27-Sep-2020 11:03                3936
book.sdo.php                                       27-Sep-2020 11:03                8870
book.sdodasrel.php                                 27-Sep-2020 11:03                3474
book.seaslog.php                                   27-Sep-2020 11:03                5019
book.sem.php                                       27-Sep-2020 11:03                3734
book.session.php                                   27-Sep-2020 11:03                8050
book.shmop.php                                     27-Sep-2020 11:03                2576
book.simplexml.php                                 27-Sep-2020 11:03                5398
book.snmp.php                                      27-Sep-2020 11:03                5699
book.soap.php                                      27-Sep-2020 11:03                6517
book.sockets.php                                   27-Sep-2020 11:03                6657
book.sodium.php                                    27-Sep-2020 11:03               12961
book.solr.php                                      27-Sep-2020 11:03               53034
book.sphinx.php                                    27-Sep-2020 11:03                5872
book.spl-types.php                                 27-Sep-2020 11:03                2477
book.spl.php                                       27-Sep-2020 11:03                9862
book.sqlite.php                                    27-Sep-2020 11:03                6089
book.sqlite3.php                                   27-Sep-2020 11:03                6494
book.sqlsrv.php                                    27-Sep-2020 11:03                5187
book.ssdeep.php                                    27-Sep-2020 11:03                2180
book.ssh2.php                                      27-Sep-2020 11:03                4903
book.stomp.php                                     27-Sep-2020 11:03                3999
book.stream.php                                    27-Sep-2020 11:03               11424
book.strings.php                                   27-Sep-2020 11:03               11875
book.svm.php                                       27-Sep-2020 11:03                3536
book.svn.php                                       27-Sep-2020 11:03                7725
book.swoole.php                                    27-Sep-2020 11:03               36941
book.sync.php                                      27-Sep-2020 11:03                4640
book.taint.php                                     27-Sep-2020 11:03                2378
book.tcpwrap.php                                   27-Sep-2020 11:03                1901
book.tidy.php                                      27-Sep-2020 11:03                6453
book.tokenizer.php                                 27-Sep-2020 11:03                2129
book.tokyo-tyrant.php                              27-Sep-2020 11:03                7950
book.trader.php                                    27-Sep-2020 11:03               17347
book.ui.php                                        27-Sep-2020 11:03               27785
book.uodbc.php                                     27-Sep-2020 11:03                6401
book.uopz.php                                      27-Sep-2020 11:02                4951
book.url.php                                       27-Sep-2020 11:03                2791
book.v8js.php                                      27-Sep-2020 11:03                2952
book.var.php                                       27-Sep-2020 11:03                5269
book.varnish.php                                   27-Sep-2020 11:03                5219
book.wddx.php                                      27-Sep-2020 11:03                2657
book.weakref.php                                   27-Sep-2020 11:02                3531
book.win32service.php                              27-Sep-2020 11:03                4882
book.wincache.php                                  27-Sep-2020 11:02                5435
book.wkhtmltox.php                                 27-Sep-2020 11:03                3163
book.xattr.php                                     27-Sep-2020 11:03                2289
book.xdiff.php                                     27-Sep-2020 11:03                3944
book.xhprof.php                                    27-Sep-2020 11:02                2298
book.xlswriter.php                                 27-Sep-2020 11:03                4267
book.xml.php                                       27-Sep-2020 11:03                5372
book.xmldiff.php                                   27-Sep-2020 11:03                2981
book.xmlreader.php                                 27-Sep-2020 11:03                4736
book.xmlrpc.php                                    27-Sep-2020 11:03                3604
book.xmlwriter.php                                 27-Sep-2020 11:03                6793
book.xsl.php                                       27-Sep-2020 11:03                3625
book.yac.php                                       27-Sep-2020 11:02                2444
book.yaconf.php                                    27-Sep-2020 11:03                1992
book.yaf.php                                       27-Sep-2020 11:03               34503
book.yaml.php                                      27-Sep-2020 11:03                2619
book.yar.php                                       27-Sep-2020 11:03                3532
book.yaz.php                                       27-Sep-2020 11:03                4207
book.zip.php                                       27-Sep-2020 11:02                9305
book.zlib.php                                      27-Sep-2020 11:02                4610
book.zmq.php                                       27-Sep-2020 11:03                5361
book.zookeeper.php                                 27-Sep-2020 11:03                6501
bzip2.configuration.php                            27-Sep-2020 11:02                1130
bzip2.constants.php                                27-Sep-2020 11:02                1025
bzip2.examples.php                                 27-Sep-2020 11:02                4163
bzip2.installation.php                             27-Sep-2020 11:02                1248
bzip2.requirements.php                             27-Sep-2020 11:02                1243
bzip2.resources.php                                27-Sep-2020 11:02                1133
bzip2.setup.php                                    27-Sep-2020 11:02                1464
cachingiterator.construct.php                      27-Sep-2020 11:03                2621
cachingiterator.count.php                          27-Sep-2020 11:03                2341
cachingiterator.current.php                        27-Sep-2020 11:03                2738
cachingiterator.getcache.php                       27-Sep-2020 11:03                5561
cachingiterator.getflags.php                       27-Sep-2020 11:03                2350
cachingiterator.getinneriterator.php               27-Sep-2020 11:03                2481
cachingiterator.hasnext.php                        27-Sep-2020 11:03                2383
cachingiterator.key.php                            27-Sep-2020 11:03                2135
cachingiterator.next.php                           27-Sep-2020 11:03                2289
cachingiterator.offsetexists.php                   27-Sep-2020 11:03                2716
cachingiterator.offsetget.php                      27-Sep-2020 11:03                2491
cachingiterator.offsetset.php                      27-Sep-2020 11:03                2973
cachingiterator.offsetunset.php                    27-Sep-2020 11:03                2531
cachingiterator.rewind.php                         27-Sep-2020 11:03                2303
cachingiterator.setflags.php                       27-Sep-2020 11:03                2564
cachingiterator.tostring.php                       27-Sep-2020 11:03                2497
cachingiterator.valid.php                          27-Sep-2020 11:03                2420
calendar.configuration.php                         27-Sep-2020 11:03                1148
calendar.constants.php                             27-Sep-2020 11:03               11726
calendar.installation.php                          27-Sep-2020 11:03                1345
calendar.requirements.php                          27-Sep-2020 11:03                1095
calendar.resources.php                             27-Sep-2020 11:03                1093
calendar.setup.php                                 27-Sep-2020 11:03                1499
callbackfilteriterator.accept.php                  27-Sep-2020 11:03                3239
callbackfilteriterator.construct.php               27-Sep-2020 11:03                3936
cc.license.php                                     27-Sep-2020 11:03               20939
changelog.misc.php                                 27-Sep-2020 11:03                3258
changelog.mongo.php                                27-Sep-2020 11:03               32194
changelog.mysql.php                                27-Sep-2020 11:03                4493
changelog.mysqli.php                               27-Sep-2020 11:03                2130
changelog.strings.php                              27-Sep-2020 11:03                4420
class.OCI-Collection.php                           27-Sep-2020 11:03                5552
class.OCI-Lob.php                                  27-Sep-2020 11:03               10589
class.apcuiterator.php                             27-Sep-2020 11:02                6682
class.appenditerator.php                           27-Sep-2020 11:03                9197
class.argumentcounterror.php                       27-Sep-2020 11:02                5696
class.arithmeticerror.php                          27-Sep-2020 11:02                6020
class.arrayaccess.php                              27-Sep-2020 11:02               12972
class.arrayiterator.php                            27-Sep-2020 11:03               15802
class.arrayobject.php                              27-Sep-2020 11:03               15734
class.assertionerror.php                           27-Sep-2020 11:02                5711
class.badfunctioncallexception.php                 27-Sep-2020 11:03                6531
class.badmethodcallexception.php                   27-Sep-2020 11:03                6551
class.cachingiterator.php                          27-Sep-2020 11:03               13862
class.callbackfilteriterator.php                   27-Sep-2020 11:03               11192
class.closure.php                                  27-Sep-2020 11:02                6082
class.collator.php                                 27-Sep-2020 11:03               25157
class.collectable.php                              27-Sep-2020 11:03                3108
class.com-exception.php                            27-Sep-2020 11:03                5702
class.com.php                                      27-Sep-2020 11:03               12457
class.commonmark-cql.php                           27-Sep-2020 11:03                7446
class.commonmark-interfaces-ivisitable.php         27-Sep-2020 11:03                2759
class.commonmark-interfaces-ivisitor.php           27-Sep-2020 11:03                3899
class.commonmark-node-blockquote.php               27-Sep-2020 11:03                7759
class.commonmark-node-bulletlist.php               27-Sep-2020 11:03                9690
class.commonmark-node-code.php                     27-Sep-2020 11:03                8638
class.commonmark-node-codeblock.php                27-Sep-2020 11:03                9798
class.commonmark-node-customblock.php              27-Sep-2020 11:03                8262
class.commonmark-node-custominline.php             27-Sep-2020 11:03                8241
class.commonmark-node-document.php                 27-Sep-2020 11:03                7713
class.commonmark-node-heading.php                  27-Sep-2020 11:03                9049
class.commonmark-node-htmlblock.php                27-Sep-2020 11:03                8695
class.commonmark-node-htmlinline.php               27-Sep-2020 11:03                8670
class.commonmark-node-image.php                    27-Sep-2020 11:03                9687
class.commonmark-node-item.php                     27-Sep-2020 11:03                7732
class.commonmark-node-linebreak.php                27-Sep-2020 11:03                7741
class.commonmark-node-link.php                     27-Sep-2020 11:03                9681
class.commonmark-node-orderedlist.php              27-Sep-2020 11:03               10427
class.commonmark-node-paragraph.php                27-Sep-2020 11:03                7766
class.commonmark-node-softbreak.php                27-Sep-2020 11:03                7759
class.commonmark-node-text-emphasis.php            27-Sep-2020 11:03                7784
class.commonmark-node-text-strong.php              27-Sep-2020 11:03                7775
class.commonmark-node-text.php                     27-Sep-2020 11:03                9042
class.commonmark-node-thematicbreak.php            27-Sep-2020 11:03                7784
class.commonmark-node.php                          27-Sep-2020 11:03                8692
class.commonmark-parser.php                        27-Sep-2020 11:03                3539
class.compersisthelper.php                         27-Sep-2020 11:03                6446
class.compileerror.php                             27-Sep-2020 11:02                5631
class.componere-abstract-definition.php            27-Sep-2020 11:02                4501
class.componere-definition.php                     27-Sep-2020 11:02                9509
class.componere-method.php                         27-Sep-2020 11:02                4403
class.componere-patch.php                          27-Sep-2020 11:02                7939
class.componere-value.php                          27-Sep-2020 11:02                5432
class.cond.php                                     27-Sep-2020 11:03                4796
class.countable.php                                27-Sep-2020 11:03                2445
class.curlfile.php                                 27-Sep-2020 11:03                7047
class.dateinterval.php                             27-Sep-2020 11:03                8704
class.dateperiod.php                               27-Sep-2020 11:03               10768
class.datetime.php                                 27-Sep-2020 11:03               17888
class.datetimeimmutable.php                        27-Sep-2020 11:03               16576
class.datetimeinterface.php                        27-Sep-2020 11:03               13351
class.datetimezone.php                             27-Sep-2020 11:03               11517
class.directory.php                                27-Sep-2020 11:03                4704
class.directoryiterator.php                        27-Sep-2020 11:03               15525
class.divisionbyzeroerror.php                      27-Sep-2020 11:02                5683
class.domainexception.php                          27-Sep-2020 11:03                6473
class.domattr.php                                  27-Sep-2020 11:03               17008
class.domcdatasection.php                          27-Sep-2020 11:03               18204
class.domcharacterdata.php                         27-Sep-2020 11:03               18010
class.domcomment.php                               27-Sep-2020 11:03               17222
class.domdocument.php                              27-Sep-2020 11:03               43319
class.domdocumentfragment.php                      27-Sep-2020 11:03               13974
class.domdocumenttype.php                          27-Sep-2020 11:03               16668
class.domelement.php                               27-Sep-2020 11:03               26251
class.domentity.php                                27-Sep-2020 11:03               16661
class.domentityreference.php                       27-Sep-2020 11:03               13858
class.domexception.php                             27-Sep-2020 11:03                6407
class.domimplementation.php                        27-Sep-2020 11:03                5365
class.domnamednodemap.php                          27-Sep-2020 11:03                4843
class.domnode.php                                  27-Sep-2020 11:03               20964
class.domnodelist.php                              27-Sep-2020 11:03                4563
class.domnotation.php                              27-Sep-2020 11:03               13929
class.domprocessinginstruction.php                 27-Sep-2020 11:03               14920
class.domtext.php                                  27-Sep-2020 11:03               19228
class.domxpath.php                                 27-Sep-2020 11:03                5928
class.dotnet.php                                   27-Sep-2020 11:03                6181
class.ds-collection.php                            27-Sep-2020 11:03                4481
class.ds-deque.php                                 27-Sep-2020 11:03               20957
class.ds-hashable.php                              27-Sep-2020 11:03                3996
class.ds-map.php                                   27-Sep-2020 11:03               22324
class.ds-pair.php                                  27-Sep-2020 11:03                4452
class.ds-priorityqueue.php                         27-Sep-2020 11:03                8033
class.ds-queue.php                                 27-Sep-2020 11:03                6976
class.ds-sequence.php                              27-Sep-2020 11:03               18540
class.ds-set.php                                   27-Sep-2020 11:03               17557
class.ds-stack.php                                 27-Sep-2020 11:03                6474
class.ds-vector.php                                27-Sep-2020 11:03               20578
class.emptyiterator.php                            27-Sep-2020 11:03                4125
class.error.php                                    27-Sep-2020 11:02                8286
class.errorexception.php                           27-Sep-2020 11:02               11465
class.ev.php                                       27-Sep-2020 11:03               35376
class.evcheck.php                                  27-Sep-2020 11:03                9712
class.evchild.php                                  27-Sep-2020 11:03               11076
class.evembed.php                                  27-Sep-2020 11:03                9256
class.event.php                                    27-Sep-2020 11:03               17304
class.eventbase.php                                27-Sep-2020 11:03               13049
class.eventbuffer.php                              27-Sep-2020 11:03               19817
class.eventbufferevent.php                         27-Sep-2020 11:03               31477
class.eventconfig.php                              27-Sep-2020 11:03                6024
class.eventdnsbase.php                             27-Sep-2020 11:03                9816
class.eventhttp.php                                27-Sep-2020 11:03                8506
class.eventhttpconnection.php                      27-Sep-2020 11:03                9412
class.eventhttprequest.php                         27-Sep-2020 11:03               19600
class.eventlistener.php                            27-Sep-2020 11:03               10847
class.eventsslcontext.php                          27-Sep-2020 11:03               14384
class.eventutil.php                                27-Sep-2020 11:03               20011
class.evfork.php                                   27-Sep-2020 11:03                8273
class.evidle.php                                   27-Sep-2020 11:03                9057
class.evio.php                                     27-Sep-2020 11:03               11537
class.evloop.php                                   27-Sep-2020 11:03               27555
class.evperiodic.php                               27-Sep-2020 11:03               13554
class.evprepare.php                                27-Sep-2020 11:03                9932
class.evsignal.php                                 27-Sep-2020 11:03               10720
class.evstat.php                                   27-Sep-2020 11:03               13203
class.evtimer.php                                  27-Sep-2020 11:03               13062
class.evwatcher.php                                27-Sep-2020 11:03                8949
class.exception.php                                27-Sep-2020 11:02                8715
class.fannconnection.php                           27-Sep-2020 11:03                5846
class.ffi-cdata.php                                27-Sep-2020 11:02                5237
class.ffi-ctype.php                                27-Sep-2020 11:02                1499
class.ffi-exception.php                            27-Sep-2020 11:02                5634
class.ffi-parserexception.php                      27-Sep-2020 11:02                2644
class.ffi.php                                      27-Sep-2020 11:02               16668
class.filesystemiterator.php                       27-Sep-2020 11:03               21192
class.filteriterator.php                           27-Sep-2020 11:03                6123
class.finfo.php                                    27-Sep-2020 11:03                4277
class.gearmanclient.php                            27-Sep-2020 11:03               28981
class.gearmanexception.php                         27-Sep-2020 11:03                5659
class.gearmanjob.php                               27-Sep-2020 11:03               10369
class.gearmantask.php                              27-Sep-2020 11:03                8720
class.gearmanworker.php                            27-Sep-2020 11:03               11688
class.gender.php                                   27-Sep-2020 11:03               27937
class.generator.php                                27-Sep-2020 11:02                6537
class.globiterator.php                             27-Sep-2020 11:03                8941
class.gmagick.php                                  27-Sep-2020 11:03               78236
class.gmagickdraw.php                              27-Sep-2020 11:03               21556
class.gmagickpixel.php                             27-Sep-2020 11:03                5213
class.gmp.php                                      27-Sep-2020 11:03                2154
class.hashcontext.php                              27-Sep-2020 11:02                2247
class.hrtime-performancecounter.php                27-Sep-2020 11:03                3508
class.hrtime-stopwatch.php                         27-Sep-2020 11:03                6497
class.hrtime-unit.php                              27-Sep-2020 11:03                3368
class.imagick.php                                  27-Sep-2020 11:03              232313
class.imagickdraw.php                              27-Sep-2020 11:03               63385
class.imagickkernel.php                            27-Sep-2020 11:03                5626
class.imagickpixel.php                             27-Sep-2020 11:03               11125
class.imagickpixeliterator.php                     27-Sep-2020 11:03                8263
class.infiniteiterator.php                         27-Sep-2020 11:03                5943
class.intlbreakiterator.php                        27-Sep-2020 11:03               22265
class.intlcalendar.php                             27-Sep-2020 11:03               72405
class.intlchar.php                                 27-Sep-2020 11:03              283146
class.intlcodepointbreakiterator.php               27-Sep-2020 11:03               16078
class.intldateformatter.php                        27-Sep-2020 11:03               18575
class.intlexception.php                            27-Sep-2020 11:03                5836
class.intlgregoriancalendar.php                    27-Sep-2020 11:03               52198
class.intliterator.php                             27-Sep-2020 11:03                5064
class.intlpartsiterator.php                        27-Sep-2020 11:03                6580
class.intlrulebasedbreakiterator.php               27-Sep-2020 11:03               18360
class.intltimezone.php                             27-Sep-2020 11:03               16682
class.invalidargumentexception.php                 27-Sep-2020 11:03                6487
class.iterator.php                                 27-Sep-2020 11:02               12109
class.iteratoraggregate.php                        27-Sep-2020 11:02                6364
class.iteratoriterator.php                         27-Sep-2020 11:03                5968
class.jsonexception.php                            27-Sep-2020 11:03                6048
class.jsonserializable.php                         27-Sep-2020 11:03                2767
class.judy.php                                     27-Sep-2020 11:03               17358
class.lengthexception.php                          27-Sep-2020 11:03                6422
class.libxmlerror.php                              27-Sep-2020 11:03                4517
class.limititerator.php                            27-Sep-2020 11:03               10080
class.locale.php                                   27-Sep-2020 11:03               19528
class.logicexception.php                           27-Sep-2020 11:03                6483
class.lua.php                                      27-Sep-2020 11:03                6971
class.luaclosure.php                               27-Sep-2020 11:03                2499
class.luasandbox.php                               27-Sep-2020 11:03               12493
class.luasandboxerror.php                          27-Sep-2020 11:03                7329
class.luasandboxerrorerror.php                     27-Sep-2020 11:03                5730
class.luasandboxfatalerror.php                     27-Sep-2020 11:03                5852
class.luasandboxfunction.php                       27-Sep-2020 11:03                3546
class.luasandboxmemoryerror.php                    27-Sep-2020 11:03                6053
class.luasandboxruntimeerror.php                   27-Sep-2020 11:03                5870
class.luasandboxsyntaxerror.php                    27-Sep-2020 11:03                5733
class.luasandboxtimeouterror.php                   27-Sep-2020 11:03                6036
class.memcache.php                                 27-Sep-2020 11:03               13724
class.memcached.php                                27-Sep-2020 11:03               34015
class.memcachedexception.php                       27-Sep-2020 11:03                5616
class.messageformatter.php                         27-Sep-2020 11:03               10463
class.mongo.php                                    27-Sep-2020 11:03               12365
class.mongobindata.php                             27-Sep-2020 11:03               10415
class.mongoclient.php                              27-Sep-2020 11:03               19536
class.mongocode.php                                27-Sep-2020 11:03                3503
class.mongocollection.php                          27-Sep-2020 11:03               26497
class.mongocommandcursor.php                       27-Sep-2020 11:03               13303
class.mongoconnectionexception.php                 27-Sep-2020 11:03                5406
class.mongocursor.php                              27-Sep-2020 11:03               27500
class.mongocursorexception.php                     27-Sep-2020 11:03               19081
class.mongocursorinterface.php                     27-Sep-2020 11:03                7990
class.mongocursortimeoutexception.php              27-Sep-2020 11:03                2454
class.mongodate.php                                27-Sep-2020 11:03                7020
class.mongodb-bson-binary.php                      27-Sep-2020 11:03               11898
class.mongodb-bson-binaryinterface.php             27-Sep-2020 11:03                3695
class.mongodb-bson-dbpointer.php                   27-Sep-2020 11:03                5364
class.mongodb-bson-decimal128.php                  27-Sep-2020 11:03                7365
class.mongodb-bson-decimal128interface.php         27-Sep-2020 11:03                2833
class.mongodb-bson-int64.php                       27-Sep-2020 11:03                6094
class.mongodb-bson-javascript.php                  27-Sep-2020 11:03                7978
class.mongodb-bson-javascriptinterface.php         27-Sep-2020 11:03                3853
class.mongodb-bson-maxkey.php                      27-Sep-2020 11:03                5879
class.mongodb-bson-maxkeyinterface.php             27-Sep-2020 11:03                1973
class.mongodb-bson-minkey.php                      27-Sep-2020 11:03                5870
class.mongodb-bson-minkeyinterface.php             27-Sep-2020 11:03                1954
class.mongodb-bson-objectid.php                    27-Sep-2020 11:03                8570
class.mongodb-bson-objectidinterface.php           27-Sep-2020 11:03                3318
class.mongodb-bson-persistable.php                 27-Sep-2020 11:03                4567
class.mongodb-bson-regex.php                       27-Sep-2020 11:03                7699
class.mongodb-bson-regexinterface.php              27-Sep-2020 11:03                3713
class.mongodb-bson-serializable.php                27-Sep-2020 11:03                2997
class.mongodb-bson-symbol.php                      27-Sep-2020 11:03                5255
class.mongodb-bson-timestamp.php                   27-Sep-2020 11:03                7921
class.mongodb-bson-timestampinterface.php          27-Sep-2020 11:03                3871
class.mongodb-bson-type.php                        27-Sep-2020 11:03                1858
class.mongodb-bson-undefined.php                   27-Sep-2020 11:03                5340
class.mongodb-bson-unserializable.php              27-Sep-2020 11:03                2961
class.mongodb-bson-utcdatetime.php                 27-Sep-2020 11:03                7312
class.mongodb-bson-utcdatetimeinterface.php        27-Sep-2020 11:03                3446
class.mongodb-driver-bulkwrite.php                 27-Sep-2020 11:03               25451
class.mongodb-driver-clientencryption.php          27-Sep-2020 11:03                6355
class.mongodb-driver-command.php                   27-Sep-2020 11:03               15673
class.mongodb-driver-cursor.php                    27-Sep-2020 11:03               25190
class.mongodb-driver-cursorid.php                  27-Sep-2020 11:03                4972
class.mongodb-driver-cursorinterface.php           27-Sep-2020 11:03                5227
class.mongodb-driver-exception-authenticationex..> 27-Sep-2020 11:03                6931
class.mongodb-driver-exception-bulkwriteexcepti..> 27-Sep-2020 11:03                7702
class.mongodb-driver-exception-commandexception..> 27-Sep-2020 11:03                8483
class.mongodb-driver-exception-connectionexcept..> 27-Sep-2020 11:03                7004
class.mongodb-driver-exception-connectiontimeou..> 27-Sep-2020 11:03                7385
class.mongodb-driver-exception-encryptionexcept..> 27-Sep-2020 11:03                6938
class.mongodb-driver-exception-exception.php       27-Sep-2020 11:03                1998
class.mongodb-driver-exception-executiontimeout..> 27-Sep-2020 11:03                7957
class.mongodb-driver-exception-invalidargumente..> 27-Sep-2020 11:03                6302
class.mongodb-driver-exception-logicexception.php  27-Sep-2020 11:03                6196
class.mongodb-driver-exception-runtimeexception..> 27-Sep-2020 11:03                9433
class.mongodb-driver-exception-serverexception.php 27-Sep-2020 11:03                7019
class.mongodb-driver-exception-sslconnectionexc..> 27-Sep-2020 11:03                7279
class.mongodb-driver-exception-unexpectedvaluee..> 27-Sep-2020 11:03                6319
class.mongodb-driver-exception-writeexception.php  27-Sep-2020 11:03                9741
class.mongodb-driver-manager.php                   27-Sep-2020 11:03               16968
class.mongodb-driver-monitoring-commandfailedev..> 27-Sep-2020 11:03                6469
class.mongodb-driver-monitoring-commandstartede..> 27-Sep-2020 11:03                5905
class.mongodb-driver-monitoring-commandsubscrib..> 27-Sep-2020 11:03                5285
class.mongodb-driver-monitoring-commandsucceede..> 27-Sep-2020 11:03                5971
class.mongodb-driver-monitoring-subscriber.php     27-Sep-2020 11:03                2434
class.mongodb-driver-query.php                     27-Sep-2020 11:03                2871
class.mongodb-driver-readconcern.php               27-Sep-2020 11:03               13201
class.mongodb-driver-readpreference.php            27-Sep-2020 11:03               16666
class.mongodb-driver-server.php                    27-Sep-2020 11:03               20204
class.mongodb-driver-session.php                   27-Sep-2020 11:03               12837
class.mongodb-driver-writeconcern.php              27-Sep-2020 11:03                8923
class.mongodb-driver-writeconcernerror.php         27-Sep-2020 11:03                4035
class.mongodb-driver-writeerror.php                27-Sep-2020 11:03                4398
class.mongodb-driver-writeresult.php               27-Sep-2020 11:03                8045
class.mongodb.php                                  27-Sep-2020 11:03               23952
class.mongodbref.php                               27-Sep-2020 11:03               12563
class.mongodeletebatch.php                         27-Sep-2020 11:03                3712
class.mongoduplicatekeyexception.php               27-Sep-2020 11:03                5808
class.mongoexception.php                           27-Sep-2020 11:03                7736
class.mongoexecutiontimeoutexception.php           27-Sep-2020 11:03                2972
class.mongogridfs.php                              27-Sep-2020 11:03               27351
class.mongogridfscursor.php                        27-Sep-2020 11:03                4748
class.mongogridfsexception.php                     27-Sep-2020 11:03                5258
class.mongogridfsfile.php                          27-Sep-2020 11:03                5374
class.mongoid.php                                  27-Sep-2020 11:03                8675
class.mongoinsertbatch.php                         27-Sep-2020 11:03                3704
class.mongoint32.php                               27-Sep-2020 11:03                3832
class.mongoint64.php                               27-Sep-2020 11:03                3828
class.mongolog.php                                 27-Sep-2020 11:03               16991
class.mongomaxkey.php                              27-Sep-2020 11:03                5512
class.mongominkey.php                              27-Sep-2020 11:03                5507
class.mongopool.php                                27-Sep-2020 11:03                4145
class.mongoprotocolexception.php                   27-Sep-2020 11:03                5283
class.mongoregex.php                               27-Sep-2020 11:03                5130
class.mongoresultexception.php                     27-Sep-2020 11:03                4275
class.mongotimestamp.php                           27-Sep-2020 11:03                4557
class.mongoupdatebatch.php                         27-Sep-2020 11:03                3712
class.mongowritebatch.php                          27-Sep-2020 11:03               11823
class.mongowriteconcernexception.php               27-Sep-2020 11:03                4223
class.multipleiterator.php                         27-Sep-2020 11:03                9999
class.mutex.php                                    27-Sep-2020 11:03                4701
class.mysql-xdevapi-baseresult.php                 27-Sep-2020 11:03                2851
class.mysql-xdevapi-client.php                     27-Sep-2020 11:03                2990
class.mysql-xdevapi-collection.php                 27-Sep-2020 11:03               10073
class.mysql-xdevapi-collectionadd.php              27-Sep-2020 11:03                2824
class.mysql-xdevapi-collectionfind.php             27-Sep-2020 11:03                8424
class.mysql-xdevapi-collectionmodify.php           27-Sep-2020 11:03                9726
class.mysql-xdevapi-collectionremove.php           27-Sep-2020 11:03                5130
class.mysql-xdevapi-columnresult.php               27-Sep-2020 11:03                6516
class.mysql-xdevapi-crudoperationbindable.php      27-Sep-2020 11:03                2742
class.mysql-xdevapi-crudoperationlimitable.php     27-Sep-2020 11:03                2751
class.mysql-xdevapi-crudoperationskippable.php     27-Sep-2020 11:03                2762
class.mysql-xdevapi-crudoperationsortable.php      27-Sep-2020 11:03                2737
class.mysql-xdevapi-databaseobject.php             27-Sep-2020 11:03                3393
class.mysql-xdevapi-docresult.php                  27-Sep-2020 11:03                3912
class.mysql-xdevapi-exception.php                  27-Sep-2020 11:03                2033
class.mysql-xdevapi-executable.php                 27-Sep-2020 11:03                2490
class.mysql-xdevapi-executionstatus.php            27-Sep-2020 11:03                4128
class.mysql-xdevapi-expression.php                 27-Sep-2020 11:03                2920
class.mysql-xdevapi-result.php                     27-Sep-2020 11:03                4293
class.mysql-xdevapi-rowresult.php                  27-Sep-2020 11:03                4995
class.mysql-xdevapi-schema.php                     27-Sep-2020 11:03                7133
class.mysql-xdevapi-schemaobject.php               27-Sep-2020 11:03                2688
class.mysql-xdevapi-session.php                    27-Sep-2020 11:03                8912
class.mysql-xdevapi-sqlstatement.php               27-Sep-2020 11:03                5928
class.mysql-xdevapi-sqlstatementresult.php         27-Sep-2020 11:03                7197
class.mysql-xdevapi-statement.php                  27-Sep-2020 11:03                4415
class.mysql-xdevapi-table.php                      27-Sep-2020 11:03                7458
class.mysql-xdevapi-tabledelete.php                27-Sep-2020 11:03                4893
class.mysql-xdevapi-tableinsert.php                27-Sep-2020 11:03                3343
class.mysql-xdevapi-tableselect.php                27-Sep-2020 11:03                7943
class.mysql-xdevapi-tableupdate.php                27-Sep-2020 11:03                5824
class.mysql-xdevapi-warning.php                    27-Sep-2020 11:03                3331
class.mysqli-driver.php                            27-Sep-2020 11:03                6484
class.mysqli-result.php                            27-Sep-2020 11:03                9969
class.mysqli-sql-exception.php                     27-Sep-2020 11:03                3111
class.mysqli-stmt.php                              27-Sep-2020 11:03               13932
class.mysqli-warning.php                           27-Sep-2020 11:03                3721
class.mysqli.php                                   27-Sep-2020 11:03               30866
class.mysqlnduhconnection.php                      27-Sep-2020 11:03               35848
class.mysqlnduhpreparedstatement.php               27-Sep-2020 11:03                3710
class.norewinditerator.php                         27-Sep-2020 11:03                7880
class.normalizer.php                               27-Sep-2020 11:03                8301
class.numberformatter.php                          27-Sep-2020 11:03               43156
class.oauth.php                                    27-Sep-2020 11:03               16573
class.oauthexception.php                           27-Sep-2020 11:03                6498
class.oauthprovider.php                            27-Sep-2020 11:03               11633
class.outeriterator.php                            27-Sep-2020 11:03                4513
class.outofboundsexception.php                     27-Sep-2020 11:03                6526
class.outofrangeexception.php                      27-Sep-2020 11:03                6529
class.overflowexception.php                        27-Sep-2020 11:03                6450
class.parallel-channel.php                         27-Sep-2020 11:03                8025
class.parallel-events-event-type.php               27-Sep-2020 11:03                2989
class.parallel-events-event.php                    27-Sep-2020 11:03                3021
class.parallel-events-input.php                    27-Sep-2020 11:03                4358
class.parallel-events.php                          27-Sep-2020 11:03                6636
class.parallel-future.php                          27-Sep-2020 11:03                8273
class.parallel-runtime.php                         27-Sep-2020 11:03                6111
class.parallel-sync.php                            27-Sep-2020 11:03                5236
class.parentiterator.php                           27-Sep-2020 11:03                5838
class.parle-errorinfo.php                          27-Sep-2020 11:03                3259
class.parle-lexer.php                              27-Sep-2020 11:03               11002
class.parle-lexerexception.php                     27-Sep-2020 11:03                5886
class.parle-parser.php                             27-Sep-2020 11:03               14034
class.parle-parserexception.php                    27-Sep-2020 11:03                5867
class.parle-rlexer.php                             27-Sep-2020 11:03               12606
class.parle-rparser.php                            27-Sep-2020 11:03               14129
class.parle-stack.php                              27-Sep-2020 11:03                4303
class.parle-token.php                              27-Sep-2020 11:03                3882
class.parseerror.php                               27-Sep-2020 11:02                6057
class.pdo.php                                      27-Sep-2020 11:03                9239
class.pdoexception.php                             27-Sep-2020 11:03                7073
class.pdostatement.php                             27-Sep-2020 11:03               14719
class.phar.php                                     27-Sep-2020 11:02               36427
class.phardata.php                                 27-Sep-2020 11:02               42698
class.pharexception.php                            27-Sep-2020 11:02                5668
class.pharfileinfo.php                             27-Sep-2020 11:02               10775
class.php-user-filter.php                          27-Sep-2020 11:03                4634
class.pht-atomicinteger.php                        27-Sep-2020 11:03                6061
class.pht-hashtable.php                            27-Sep-2020 11:03                4187
class.pht-queue.php                                27-Sep-2020 11:03                4997
class.pht-runnable.php                             27-Sep-2020 11:03                2523
class.pht-thread.php                               27-Sep-2020 11:03                5941
class.pht-threaded.php                             27-Sep-2020 11:03                3555
class.pht-vector.php                               27-Sep-2020 11:03                9319
class.pool.php                                     27-Sep-2020 11:03                6806
class.quickhashinthash.php                         27-Sep-2020 11:03               11834
class.quickhashintset.php                          27-Sep-2020 11:03               10054
class.quickhashintstringhash.php                   27-Sep-2020 11:03               12694
class.quickhashstringinthash.php                   27-Sep-2020 11:03               11162
class.rangeexception.php                           27-Sep-2020 11:03                6631
class.rararchive.php                               27-Sep-2020 11:02                6948
class.rarentry.php                                 27-Sep-2020 11:02               38201
class.rarexception.php                             27-Sep-2020 11:02                8077
class.recursivearrayiterator.php                   27-Sep-2020 11:03               14874
class.recursivecachingiterator.php                 27-Sep-2020 11:03               12543
class.recursivecallbackfilteriterator.php          27-Sep-2020 11:03               10396
class.recursivedirectoryiterator.php               27-Sep-2020 11:03               13143
class.recursivefilteriterator.php                  27-Sep-2020 11:03                7375
class.recursiveiterator.php                        27-Sep-2020 11:03                5041
class.recursiveiteratoriterator.php                27-Sep-2020 11:03               13626
class.recursiveregexiterator.php                   27-Sep-2020 11:03                9282
class.recursivetreeiterator.php                    27-Sep-2020 11:03               22830
class.reflection.php                               27-Sep-2020 11:03                3080
class.reflectionclass.php                          27-Sep-2020 11:03               29414
class.reflectionclassconstant.php                  27-Sep-2020 11:03                8900
class.reflectionexception.php                      27-Sep-2020 11:03                5615
class.reflectionextension.php                      27-Sep-2020 11:03                9511
class.reflectionfunction.php                       27-Sep-2020 11:03               16736
class.reflectionfunctionabstract.php               27-Sep-2020 11:03               15383
class.reflectiongenerator.php                      27-Sep-2020 11:03                5538
class.reflectionmethod.php                         27-Sep-2020 11:03               24307
class.reflectionnamedtype.php                      27-Sep-2020 11:03                3527
class.reflectionobject.php                         27-Sep-2020 11:03               23580
class.reflectionparameter.php                      27-Sep-2020 11:03               13877
class.reflectionproperty.php                       27-Sep-2020 11:03               14835
class.reflectionreference.php                      27-Sep-2020 11:03                3454
class.reflectiontype.php                           27-Sep-2020 11:03                3206
class.reflectionzendextension.php                  27-Sep-2020 11:03                6784
class.reflector.php                                27-Sep-2020 11:03                2731
class.regexiterator.php                            27-Sep-2020 11:03               13151
class.resourcebundle.php                           27-Sep-2020 11:03                7511
class.rrdcreator.php                               27-Sep-2020 11:03                3970
class.rrdgraph.php                                 27-Sep-2020 11:03                3604
class.rrdupdater.php                               27-Sep-2020 11:03                2916
class.runtimeexception.php                         27-Sep-2020 11:03                6438
class.seaslog.php                                  27-Sep-2020 11:03               17334
class.seekableiterator.php                         27-Sep-2020 11:03               12981
class.serializable.php                             27-Sep-2020 11:02                7859
class.sessionhandler.php                           27-Sep-2020 11:03               26905
class.sessionhandlerinterface.php                  27-Sep-2020 11:03               15769
class.sessionidinterface.php                       27-Sep-2020 11:03                3040
class.sessionupdatetimestamphandlerinterface.php   27-Sep-2020 11:03                4054
class.simplexmlelement.php                         27-Sep-2020 11:03               10671
class.simplexmliterator.php                        27-Sep-2020 11:03               12715
class.snmp.php                                     27-Sep-2020 11:03               21653
class.snmpexception.php                            27-Sep-2020 11:03                6488
class.soapclient.php                               27-Sep-2020 11:03               10569
class.soapfault.php                                27-Sep-2020 11:03                8178
class.soapheader.php                               27-Sep-2020 11:03                3762
class.soapparam.php                                27-Sep-2020 11:03                2997
class.soapserver.php                               27-Sep-2020 11:03                7989
class.soapvar.php                                  27-Sep-2020 11:03                3929
class.solrclient.php                               27-Sep-2020 11:03               20489
class.solrclientexception.php                      27-Sep-2020 11:03                7374
class.solrcollapsefunction.php                     27-Sep-2020 11:03               10371
class.solrdismaxquery.php                          27-Sep-2020 11:03               98838
class.solrdocument.php                             27-Sep-2020 11:03               20732
class.solrdocumentfield.php                        27-Sep-2020 11:03                4165
class.solrexception.php                            27-Sep-2020 11:03                7783
class.solrgenericresponse.php                      27-Sep-2020 11:03               10160
class.solrillegalargumentexception.php             27-Sep-2020 11:03                7489
class.solrillegaloperationexception.php            27-Sep-2020 11:03                7526
class.solrinputdocument.php                        27-Sep-2020 11:03               16599
class.solrmissingmandatoryparameterexception.php   27-Sep-2020 11:03                6615
class.solrmodifiableparams.php                     27-Sep-2020 11:03                8185
class.solrobject.php                               27-Sep-2020 11:03                5486
class.solrparams.php                               27-Sep-2020 11:03                8226
class.solrpingresponse.php                         27-Sep-2020 11:03               10491
class.solrquery.php                                27-Sep-2020 11:03              107344
class.solrqueryresponse.php                        27-Sep-2020 11:03               10097
class.solrresponse.php                             27-Sep-2020 11:03               12080
class.solrserverexception.php                      27-Sep-2020 11:03                7380
class.solrupdateresponse.php                       27-Sep-2020 11:03               10136
class.solrutils.php                                27-Sep-2020 11:03                4323
class.sphinxclient.php                             27-Sep-2020 11:03               22076
class.splbool.php                                  27-Sep-2020 11:03                5201
class.spldoublylinkedlist.php                      27-Sep-2020 11:03               17428
class.splenum.php                                  27-Sep-2020 11:03                8578
class.splfileinfo.php                              27-Sep-2020 11:03               14529
class.splfileobject.php                            27-Sep-2020 11:03               30014
class.splfixedarray.php                            27-Sep-2020 11:03               16551
class.splfloat.php                                 27-Sep-2020 11:03                5178
class.splheap.php                                  27-Sep-2020 11:03                8552
class.splint.php                                   27-Sep-2020 11:03                4709
class.splmaxheap.php                               27-Sep-2020 11:03                7845
class.splminheap.php                               27-Sep-2020 11:03                7855
class.splobjectstorage.php                         27-Sep-2020 11:03               20556
class.splobserver.php                              27-Sep-2020 11:03                2676
class.splpriorityqueue.php                         27-Sep-2020 11:03               10396
class.splqueue.php                                 27-Sep-2020 11:03               13733
class.splstack.php                                 27-Sep-2020 11:03               12820
class.splstring.php                                27-Sep-2020 11:03                4862
class.splsubject.php                               27-Sep-2020 11:03                3645
class.spltempfileobject.php                        27-Sep-2020 11:03               15742
class.spltype.php                                  27-Sep-2020 11:03                3099
class.spoofchecker.php                             27-Sep-2020 11:03               11921
class.sqlite3.php                                  27-Sep-2020 11:03               14667
class.sqlite3result.php                            27-Sep-2020 11:03                4639
class.sqlite3stmt.php                              27-Sep-2020 11:03                6584
class.stomp.php                                    27-Sep-2020 11:03                9766
class.stompexception.php                           27-Sep-2020 11:03                5698
class.stompframe.php                               27-Sep-2020 11:03                3667
class.streamwrapper.php                            27-Sep-2020 11:03               17106
class.svm.php                                      27-Sep-2020 11:03               13911
class.svmmodel.php                                 27-Sep-2020 11:03                6210
class.swoole-async.php                             27-Sep-2020 11:03                6524
class.swoole-atomic.php                            27-Sep-2020 11:03                4357
class.swoole-buffer.php                            27-Sep-2020 11:03                6644
class.swoole-channel.php                           27-Sep-2020 11:03                3739
class.swoole-client.php                            27-Sep-2020 11:03               13632
class.swoole-connection-iterator.php               27-Sep-2020 11:03                7384
class.swoole-coroutine.php                         27-Sep-2020 11:03               21861
class.swoole-event.php                             27-Sep-2020 11:03                6270
class.swoole-exception.php                         27-Sep-2020 11:03                2647
class.swoole-http-client.php                       27-Sep-2020 11:03               12526
class.swoole-http-request.php                      27-Sep-2020 11:03                2827
class.swoole-http-response.php                     27-Sep-2020 11:03                8666
class.swoole-http-server.php                       27-Sep-2020 11:03               21756
class.swoole-lock.php                              27-Sep-2020 11:03                4623
class.swoole-mmap.php                              27-Sep-2020 11:03                2672
class.swoole-mysql-exception.php                   27-Sep-2020 11:03                2682
class.swoole-mysql.php                             27-Sep-2020 11:03                5208
class.swoole-process.php                           27-Sep-2020 11:03               11911
class.swoole-redis-server.php                      27-Sep-2020 11:03               25428
class.swoole-serialize.php                         27-Sep-2020 11:03                3193
class.swoole-server.php                            27-Sep-2020 11:03               24941
class.swoole-table.php                             27-Sep-2020 11:03               11095
class.swoole-timer.php                             27-Sep-2020 11:03                4407
class.swoole-websocket-frame.php                   27-Sep-2020 11:03                1724
class.swoole-websocket-server.php                  27-Sep-2020 11:03                6630
class.syncevent.php                                27-Sep-2020 11:03                4279
class.syncmutex.php                                27-Sep-2020 11:03                3671
class.syncreaderwriter.php                         27-Sep-2020 11:03                4673
class.syncsemaphore.php                            27-Sep-2020 11:03                3963
class.syncsharedmemory.php                         27-Sep-2020 11:03                4908
class.thread.php                                   27-Sep-2020 11:03               13852
class.threaded.php                                 27-Sep-2020 11:03               10661
class.throwable.php                                27-Sep-2020 11:02                6036
class.tidy.php                                     27-Sep-2020 11:03               12383
class.tidynode.php                                 27-Sep-2020 11:03                9684
class.tokyotyrant.php                              27-Sep-2020 11:03               35464
class.tokyotyrantexception.php                     27-Sep-2020 11:03                6299
class.tokyotyrantiterator.php                      27-Sep-2020 11:03               17414
class.tokyotyrantquery.php                         27-Sep-2020 11:03                8791
class.tokyotyranttable.php                         27-Sep-2020 11:03               21585
class.transliterator.php                           27-Sep-2020 11:03                7622
class.traversable.php                              27-Sep-2020 11:02                3658
class.typeerror.php                                27-Sep-2020 11:02                5942
class.uconverter.php                               27-Sep-2020 11:03               27405
class.ui-area.php                                  27-Sep-2020 11:03               11003
class.ui-control.php                               27-Sep-2020 11:03                5565
class.ui-controls-box.php                          27-Sep-2020 11:03                9340
class.ui-controls-button.php                       27-Sep-2020 11:03                6708
class.ui-controls-check.php                        27-Sep-2020 11:03                7501
class.ui-controls-colorbutton.php                  27-Sep-2020 11:03                6739
class.ui-controls-combo.php                        27-Sep-2020 11:03                6681
class.ui-controls-editablecombo.php                27-Sep-2020 11:03                6781
class.ui-controls-entry.php                        27-Sep-2020 11:03                8922
class.ui-controls-form.php                         27-Sep-2020 11:03                7675
class.ui-controls-grid.php                         27-Sep-2020 11:03               10588
class.ui-controls-group.php                        27-Sep-2020 11:03                8200
class.ui-controls-label.php                        27-Sep-2020 11:03                6409
class.ui-controls-multilineentry.php               27-Sep-2020 11:03                9245
class.ui-controls-picker.php                       27-Sep-2020 11:03                6903
class.ui-controls-progress.php                     27-Sep-2020 11:03                5957
class.ui-controls-radio.php                        27-Sep-2020 11:03                6660
class.ui-controls-separator.php                    27-Sep-2020 11:03                6604
class.ui-controls-slider.php                       27-Sep-2020 11:03                6995
class.ui-controls-spin.php                         27-Sep-2020 11:03                6867
class.ui-controls-tab.php                          27-Sep-2020 11:03                8638
class.ui-draw-brush-gradient.php                   27-Sep-2020 11:03                6371
class.ui-draw-brush-lineargradient.php             27-Sep-2020 11:03                5662
class.ui-draw-brush-radialgradient.php             27-Sep-2020 11:03                5794
class.ui-draw-brush.php                            27-Sep-2020 11:03                4165
class.ui-draw-color.php                            27-Sep-2020 11:03                6884
class.ui-draw-line-cap.php                         27-Sep-2020 11:03                2189
class.ui-draw-line-join.php                        27-Sep-2020 11:03                2148
class.ui-draw-matrix.php                           27-Sep-2020 11:03                5479
class.ui-draw-path.php                             27-Sep-2020 11:03                8834
class.ui-draw-pen.php                              27-Sep-2020 11:03                8072
class.ui-draw-stroke.php                           27-Sep-2020 11:03                6157
class.ui-draw-text-font-descriptor.php             27-Sep-2020 11:03                5388
class.ui-draw-text-font-italic.php                 27-Sep-2020 11:03                2389
class.ui-draw-text-font-stretch.php                27-Sep-2020 11:03                3661
class.ui-draw-text-font-weight.php                 27-Sep-2020 11:03                3533
class.ui-draw-text-font.php                        27-Sep-2020 11:03                4640
class.ui-draw-text-layout.php                      27-Sep-2020 11:03                4612
class.ui-exception-invalidargumentexception.php    27-Sep-2020 11:03                5889
class.ui-exception-runtimeexception.php            27-Sep-2020 11:03                5858
class.ui-executor.php                              27-Sep-2020 11:03                4929
class.ui-key.php                                   27-Sep-2020 11:03                7959
class.ui-menu.php                                  27-Sep-2020 11:03                5763
class.ui-menuitem.php                              27-Sep-2020 11:03                3652
class.ui-point.php                                 27-Sep-2020 11:03                5737
class.ui-size.php                                  27-Sep-2020 11:03                5830
class.ui-window.php                                27-Sep-2020 11:03               12632
class.underflowexception.php                       27-Sep-2020 11:03                6520
class.unexpectedvalueexception.php                 27-Sep-2020 11:03                6674
class.v8js.php                                     27-Sep-2020 11:03                7293
class.v8jsexception.php                            27-Sep-2020 11:03                9057
class.variant.php                                  27-Sep-2020 11:03                5320
class.varnishadmin.php                             27-Sep-2020 11:03               10334
class.varnishlog.php                               27-Sep-2020 11:03               23231
class.varnishstat.php                              27-Sep-2020 11:03                2710
class.volatile.php                                 27-Sep-2020 11:03               13469
class.vtiful-kernel-excel.php                      27-Sep-2020 11:03               10115
class.vtiful-kernel-format.php                     27-Sep-2020 11:03               11063
class.weakmap.php                                  27-Sep-2020 11:02                9678
class.weakref.php                                  27-Sep-2020 11:02                7612
class.weakreference.php                            27-Sep-2020 11:02                5715
class.wkhtmltox-image-converter.php                27-Sep-2020 11:03                3669
class.wkhtmltox-pdf-converter.php                  27-Sep-2020 11:03                4076
class.wkhtmltox-pdf-object.php                     27-Sep-2020 11:03                2638
class.worker.php                                   27-Sep-2020 11:03                9539
class.xmldiff-base.php                             27-Sep-2020 11:03                4020
class.xmldiff-dom.php                              27-Sep-2020 11:03                5393
class.xmldiff-file.php                             27-Sep-2020 11:03                5008
class.xmldiff-memory.php                           27-Sep-2020 11:03                5038
class.xmlreader.php                                27-Sep-2020 11:03               29272
class.xsltprocessor.php                            27-Sep-2020 11:03                8194
class.yac.php                                      27-Sep-2020 11:02                8266
class.yaconf.php                                   27-Sep-2020 11:03                3179
class.yaf-action-abstract.php                      27-Sep-2020 11:03               12404
class.yaf-application.php                          27-Sep-2020 11:03               12177
class.yaf-bootstrap-abstract.php                   27-Sep-2020 11:03                5990
class.yaf-config-abstract.php                      27-Sep-2020 11:03                4858
class.yaf-config-ini.php                           27-Sep-2020 11:03               17132
class.yaf-config-simple.php                        27-Sep-2020 11:03               12529
class.yaf-controller-abstract.php                  27-Sep-2020 11:03               18132
class.yaf-dispatcher.php                           27-Sep-2020 11:03               18718
class.yaf-exception-dispatchfailed.php             27-Sep-2020 11:03                2711
class.yaf-exception-loadfailed-action.php          27-Sep-2020 11:03                2779
class.yaf-exception-loadfailed-controller.php      27-Sep-2020 11:03                2800
class.yaf-exception-loadfailed-module.php          27-Sep-2020 11:03                2768
class.yaf-exception-loadfailed-view.php            27-Sep-2020 11:03                2710
class.yaf-exception-loadfailed.php                 27-Sep-2020 11:03                2689
class.yaf-exception-routerfailed.php               27-Sep-2020 11:03                2698
class.yaf-exception-startuperror.php               27-Sep-2020 11:03                2696
class.yaf-exception-typeerror.php                  27-Sep-2020 11:03                2670
class.yaf-exception.php                            27-Sep-2020 11:03                6667
class.yaf-loader.php                               27-Sep-2020 11:03               17774
class.yaf-plugin-abstract.php                      27-Sep-2020 11:03               18332
class.yaf-registry.php                             27-Sep-2020 11:03                5315
class.yaf-request-abstract.php                     27-Sep-2020 11:03               20823
class.yaf-request-http.php                         27-Sep-2020 11:03               21342
class.yaf-request-simple.php                       27-Sep-2020 11:03               20445
class.yaf-response-abstract.php                    27-Sep-2020 11:03               10311
class.yaf-route-interface.php                      27-Sep-2020 11:03                3258
class.yaf-route-map.php                            27-Sep-2020 11:03                5717
class.yaf-route-regex.php                          27-Sep-2020 11:03                6736
class.yaf-route-rewrite.php                        27-Sep-2020 11:03                6368
class.yaf-route-simple.php                         27-Sep-2020 11:03                5571
class.yaf-route-static.php                         27-Sep-2020 11:03                4371
class.yaf-route-supervar.php                       27-Sep-2020 11:03                4160
class.yaf-router.php                               27-Sep-2020 11:03               11395
class.yaf-session.php                              27-Sep-2020 11:03               11773
class.yaf-view-interface.php                       27-Sep-2020 11:03                5199
class.yaf-view-simple.php                          27-Sep-2020 11:03                9494
class.yar-client-exception.php                     27-Sep-2020 11:03                6460
class.yar-client.php                               27-Sep-2020 11:03                4937
class.yar-concurrent-client.php                    27-Sep-2020 11:03                5431
class.yar-server-exception.php                     27-Sep-2020 11:03                6819
class.yar-server.php                               27-Sep-2020 11:03                3148
class.ziparchive.php                               27-Sep-2020 11:02               34223
class.zmq.php                                      27-Sep-2020 11:03               29855
class.zmqcontext.php                               27-Sep-2020 11:03                5043
class.zmqdevice.php                                27-Sep-2020 11:03                6793
class.zmqpoll.php                                  27-Sep-2020 11:03                4766
class.zmqsocket.php                                27-Sep-2020 11:03               10140
class.zookeeper.php                                27-Sep-2020 11:03               41821
class.zookeeperauthenticationexception.php         27-Sep-2020 11:03                5802
class.zookeeperconfig.php                          27-Sep-2020 11:03                5360
class.zookeeperconnectionexception.php             27-Sep-2020 11:03                5801
class.zookeeperexception.php                       27-Sep-2020 11:03                5677
class.zookeepermarshallingexception.php            27-Sep-2020 11:03                5821
class.zookeepernonodeexception.php                 27-Sep-2020 11:03                5793
class.zookeeperoperationtimeoutexception.php       27-Sep-2020 11:03                5826
class.zookeepersessionexception.php                27-Sep-2020 11:03                5752
classkit.configuration.php                         27-Sep-2020 11:03                1145
classkit.constants.php                             27-Sep-2020 11:03                2235
classkit.installation.php                          27-Sep-2020 11:03                1405
classkit.requirements.php                          27-Sep-2020 11:03                1095
classkit.resources.php                             27-Sep-2020 11:03                1093
classkit.setup.php                                 27-Sep-2020 11:03                1490
classobj.configuration.php                         27-Sep-2020 11:03                1148
classobj.constants.php                             27-Sep-2020 11:03                1053
classobj.examples.php                              27-Sep-2020 11:03               14451
classobj.installation.php                          27-Sep-2020 11:03                1131
classobj.requirements.php                          27-Sep-2020 11:03                1095
classobj.resources.php                             27-Sep-2020 11:03                1093
classobj.setup.php                                 27-Sep-2020 11:03                1486
closure.bind.php                                   27-Sep-2020 11:02                8061
closure.bindto.php                                 27-Sep-2020 11:02                9341
closure.call.php                                   27-Sep-2020 11:02                6493
closure.construct.php                              27-Sep-2020 11:02                2606
closure.fromcallable.php                           27-Sep-2020 11:02                2944
cmark.installation.php                             27-Sep-2020 11:03                1857
cmark.requirements.php                             27-Sep-2020 11:03                1187
cmark.setup.php                                    27-Sep-2020 11:03                1317
collator.asort.php                                 27-Sep-2020 11:03                8698
collator.compare.php                               27-Sep-2020 11:03                8264
collator.construct.php                             27-Sep-2020 11:03                5401
collator.create.php                                27-Sep-2020 11:03                5117
collator.getattribute.php                          27-Sep-2020 11:03                5615
collator.geterrorcode.php                          27-Sep-2020 11:03                4836
collator.geterrormessage.php                       27-Sep-2020 11:03                4895
collator.getlocale.php                             27-Sep-2020 11:03                6351
collator.getsortkey.php                            27-Sep-2020 11:03                6725
collator.getstrength.php                           27-Sep-2020 11:03                4779
collator.setattribute.php                          27-Sep-2020 11:03                6340
collator.setstrength.php                           27-Sep-2020 11:03               12484
collator.sort.php                                  27-Sep-2020 11:03                7461
collator.sortwithsortkeys.php                      27-Sep-2020 11:03                6110
collectable.isgarbage.php                          27-Sep-2020 11:03                2237
collectable.setgarbage.php                         27-Sep-2020 11:03                2423
com.configuration.php                              27-Sep-2020 11:03                6744
com.constants.php                                  27-Sep-2020 11:03               21995
com.construct.php                                  27-Sep-2020 11:03                7650
com.error-handling.php                             27-Sep-2020 11:03                1438
com.examples.arrays.php                            27-Sep-2020 11:03                1976
com.examples.foreach.php                           27-Sep-2020 11:03                2881
com.examples.php                                   27-Sep-2020 11:03                1323
com.installation.php                               27-Sep-2020 11:03                1486
com.requirements.php                               27-Sep-2020 11:03                1149
com.resources.php                                  27-Sep-2020 11:03                1063
com.setup.php                                      27-Sep-2020 11:03                1441
commonmark-cql.construct.php                       27-Sep-2020 11:03                2037
commonmark-cql.invoke.php                          27-Sep-2020 11:03                3622
commonmark-interfaces-ivisitable.accept.php        27-Sep-2020 11:03                2971
commonmark-interfaces-ivisitor.enter.php           27-Sep-2020 11:03                3772
commonmark-interfaces-ivisitor.leave.php           27-Sep-2020 11:03                3774
commonmark-node-bulletlist.construct.php           27-Sep-2020 11:03                2943
commonmark-node-codeblock.construct.php            27-Sep-2020 11:03                2598
commonmark-node-heading.construct.php              27-Sep-2020 11:03                2485
commonmark-node-image.construct.php                27-Sep-2020 11:03                3050
commonmark-node-link.construct.php                 27-Sep-2020 11:03                3048
commonmark-node-orderedlist.construct.php          27-Sep-2020 11:03                3787
commonmark-node-text.construct.php                 27-Sep-2020 11:03                2534
commonmark-node.accept.php                         27-Sep-2020 11:03                2728
commonmark-node.appendchild.php                    27-Sep-2020 11:03                2587
commonmark-node.insertafter.php                    27-Sep-2020 11:03                2612
commonmark-node.insertbefore.php                   27-Sep-2020 11:03                2609
commonmark-node.prependchild.php                   27-Sep-2020 11:03                2613
commonmark-node.replace.php                        27-Sep-2020 11:03                2562
commonmark-node.unlink.php                         27-Sep-2020 11:03                2266
commonmark-parser.construct.php                    27-Sep-2020 11:03                3368
commonmark-parser.finish.php                       27-Sep-2020 11:03                2319
commonmark-parser.parse.php                        27-Sep-2020 11:03                2436
compersisthelper.construct.php                     27-Sep-2020 11:03                3275
compersisthelper.getcurfilename.php                27-Sep-2020 11:03                2837
compersisthelper.getmaxstreamsize.php              27-Sep-2020 11:03                2963
compersisthelper.initnew.php                       27-Sep-2020 11:03                2804
compersisthelper.loadfromfile.php                  27-Sep-2020 11:03                3869
compersisthelper.loadfromstream.php                27-Sep-2020 11:03                3136
compersisthelper.savetofile.php                    27-Sep-2020 11:03                5744
compersisthelper.savetostream.php                  27-Sep-2020 11:03                3161
componere-abstract-definition.addinterface.php     27-Sep-2020 11:02                3139
componere-abstract-definition.addmethod.php        27-Sep-2020 11:02                3862
componere-abstract-definition.addtrait.php         27-Sep-2020 11:02                3095
componere-abstract-definition.getreflector.php     27-Sep-2020 11:02                2264
componere-definition.addconstant.php               27-Sep-2020 11:02                4184
componere-definition.addproperty.php               27-Sep-2020 11:02                3591
componere-definition.construct.php                 27-Sep-2020 11:02                5421
componere-definition.getclosure.php                27-Sep-2020 11:02                3265
componere-definition.getclosures.php               27-Sep-2020 11:02                2561
componere-definition.isregistered.php              27-Sep-2020 11:02                2121
componere-definition.register.php                  27-Sep-2020 11:02                2346
componere-method.construct.php                     27-Sep-2020 11:02                2070
componere-method.getreflector.php                  27-Sep-2020 11:02                2083
componere-method.setprivate.php                    27-Sep-2020 11:02                2369
componere-method.setprotected.php                  27-Sep-2020 11:02                2382
componere-method.setstatic.php                     27-Sep-2020 11:02                1966
componere-patch.apply.php                          27-Sep-2020 11:02                1774
componere-patch.construct.php                      27-Sep-2020 11:02                3346
componere-patch.derive.php                         27-Sep-2020 11:02                3074
componere-patch.getclosure.php                     27-Sep-2020 11:02                2858
componere-patch.getclosures.php                    27-Sep-2020 11:02                2049
componere-patch.isapplied.php                      27-Sep-2020 11:02                1694
componere-patch.revert.php                         27-Sep-2020 11:02                1774
componere-value.construct.php                      27-Sep-2020 11:02                2487
componere-value.hasdefault.php                     27-Sep-2020 11:02                1740
componere-value.isprivate.php                      27-Sep-2020 11:02                1759
componere-value.isprotected.php                    27-Sep-2020 11:02                1767
componere-value.isstatic.php                       27-Sep-2020 11:02                1754
componere-value.setprivate.php                     27-Sep-2020 11:02                2392
componere-value.setprotected.php                   27-Sep-2020 11:02                2404
componere-value.setstatic.php                      27-Sep-2020 11:02                1983
componere.cast.php                                 27-Sep-2020 11:02                4859
componere.cast_by_ref.php                          27-Sep-2020 11:02                5020
componere.installation.php                         27-Sep-2020 11:02                1224
componere.requirements.php                         27-Sep-2020 11:02                1073
componere.setup.php                                27-Sep-2020 11:02                1352
cond.broadcast.php                                 27-Sep-2020 11:03                4672
cond.create.php                                    27-Sep-2020 11:03                4064
cond.destroy.php                                   27-Sep-2020 11:03                4707
cond.signal.php                                    27-Sep-2020 11:03                4484
cond.wait.php                                      27-Sep-2020 11:03                6313
configuration.changes.modes.php                    27-Sep-2020 11:02                3583
configuration.changes.php                          27-Sep-2020 11:02                8350
configuration.file.per-user.php                    27-Sep-2020 11:02                2912
configuration.file.php                             27-Sep-2020 11:02               10950
configuration.php                                  27-Sep-2020 11:02                1567
configure.about.php                                27-Sep-2020 11:03               17190
configure.php                                      27-Sep-2020 11:03                1284
constants.dbx.php                                  27-Sep-2020 11:03                7253
context.curl.php                                   27-Sep-2020 11:02                9018
context.ftp.php                                    27-Sep-2020 11:02                4545
context.http.php                                   27-Sep-2020 11:02               17838
context.mongodb.php                                27-Sep-2020 11:02                5618
context.params.php                                 27-Sep-2020 11:02                2349
context.phar.php                                   27-Sep-2020 11:02                2699
context.php                                        27-Sep-2020 11:02                2793
context.socket.php                                 27-Sep-2020 11:02               10405
context.ssl.php                                    27-Sep-2020 11:02               14028
context.zip.php                                    27-Sep-2020 11:02                4279
control-structures.alternative-syntax.php          27-Sep-2020 11:02                7029
control-structures.break.php                       27-Sep-2020 11:02                6479
control-structures.continue.php                    27-Sep-2020 11:02                9112
control-structures.declare.php                     27-Sep-2020 11:02               12741
control-structures.do.while.php                    27-Sep-2020 11:02                5423
control-structures.else.php                        27-Sep-2020 11:02                3005
control-structures.elseif.php                      27-Sep-2020 11:02                7763
control-structures.for.php                         27-Sep-2020 11:02               12327
control-structures.foreach.php                     27-Sep-2020 11:02               24507
control-structures.goto.php                        27-Sep-2020 11:02                7061
control-structures.if.php                          27-Sep-2020 11:02                4672
control-structures.intro.php                       27-Sep-2020 11:02                2310
control-structures.switch.php                      27-Sep-2020 11:02               16669
control-structures.while.php                       27-Sep-2020 11:02                4748
copyright.php                                      27-Sep-2020 11:02                1918
countable.count.php                                27-Sep-2020 11:03                5556
csprng.configuration.php                           27-Sep-2020 11:02                1136
csprng.constants.php                               27-Sep-2020 11:02                1035
csprng.installation.php                            27-Sep-2020 11:02                1119
csprng.requirements.php                            27-Sep-2020 11:02                1083
csprng.resources.php                               27-Sep-2020 11:02                1081
csprng.setup.php                                   27-Sep-2020 11:02                1455
ctype.configuration.php                            27-Sep-2020 11:03                1130
ctype.constants.php                                27-Sep-2020 11:03                1027
ctype.installation.php                             27-Sep-2020 11:03                1297
ctype.requirements.php                             27-Sep-2020 11:03                1108
ctype.resources.php                                27-Sep-2020 11:03                1075
ctype.setup.php                                    27-Sep-2020 11:03                1448
cubrid.configuration.php                           27-Sep-2020 11:03                1088
cubrid.constants.php                               27-Sep-2020 11:03               13664
cubrid.examples.php                                27-Sep-2020 11:03               21050
cubrid.installation.php                            27-Sep-2020 11:03                1982
cubrid.requirements.php                            27-Sep-2020 11:03                1152
cubrid.resources.php                               27-Sep-2020 11:03                2975
cubrid.setup.php                                   27-Sep-2020 11:03                1461
cubridmysql.cubrid.php                             27-Sep-2020 11:03                4823
curl.configuration.php                             27-Sep-2020 11:03                2337
curl.constants.php                                 27-Sep-2020 11:03              126989
curl.examples-basic.php                            27-Sep-2020 11:03                4543
curl.examples.php                                  27-Sep-2020 11:03                1250
curl.installation.php                              27-Sep-2020 11:03                2492
curl.requirements.php                              27-Sep-2020 11:03                1222
curl.resources.php                                 27-Sep-2020 11:03                1115
curl.setup.php                                     27-Sep-2020 11:03                1457
curlfile.construct.php                             27-Sep-2020 11:03               20245
curlfile.getfilename.php                           27-Sep-2020 11:03                1988
curlfile.getmimetype.php                           27-Sep-2020 11:03                1998
curlfile.getpostfilename.php                       27-Sep-2020 11:03                2044
curlfile.setmimetype.php                           27-Sep-2020 11:03                2218
curlfile.setpostfilename.php                       27-Sep-2020 11:03                2246
curlfile.wakeup.php                                27-Sep-2020 11:03                2199
dateinterval.construct.php                         27-Sep-2020 11:03                7954
dateinterval.createfromdatestring.php              27-Sep-2020 11:03                8153
dateinterval.format.php                            27-Sep-2020 11:03               14207
dateperiod.construct.php                           27-Sep-2020 11:03               13417
dateperiod.getdateinterval.php                     27-Sep-2020 11:03                4609
dateperiod.getenddate.php                          27-Sep-2020 11:03                7437
dateperiod.getrecurrences.php                      27-Sep-2020 11:03                2483
dateperiod.getstartdate.php                        27-Sep-2020 11:03                5039
datetime.add.php                                   27-Sep-2020 11:03               12361
datetime.configuration.php                         27-Sep-2020 11:03                5312
datetime.constants.php                             27-Sep-2020 11:03                2634
datetime.construct.php                             27-Sep-2020 11:03               15957
datetime.createfromformat.php                      27-Sep-2020 11:03               27842
datetime.createfromimmutable.php                   27-Sep-2020 11:03                4057
datetime.diff.php                                  27-Sep-2020 11:03               12058
datetime.examples-arithmetic.php                   27-Sep-2020 11:03               15899
datetime.examples.php                              27-Sep-2020 11:03                1302
datetime.format.php                                27-Sep-2020 11:03               19962
datetime.formats.compound.php                      27-Sep-2020 11:03                9201
datetime.formats.date.php                          27-Sep-2020 11:03               13389
datetime.formats.php                               27-Sep-2020 11:03                2735
datetime.formats.relative.php                      27-Sep-2020 11:03               14942
datetime.formats.time.php                          27-Sep-2020 11:03                7221
datetime.getlasterrors.php                         27-Sep-2020 11:03                5702
datetime.getoffset.php                             27-Sep-2020 11:03                7738
datetime.gettimestamp.php                          27-Sep-2020 11:03                6106
datetime.gettimezone.php                           27-Sep-2020 11:03                7230
datetime.installation.php                          27-Sep-2020 11:03                1997
datetime.modify.php                                27-Sep-2020 11:03                9772
datetime.requirements.php                          27-Sep-2020 11:03                1095
datetime.resources.php                             27-Sep-2020 11:03                1093
datetime.set-state.php                             27-Sep-2020 11:03                2397
datetime.setdate.php                               27-Sep-2020 11:03               10281
datetime.setisodate.php                            27-Sep-2020 11:03               13298
datetime.settime.php                               27-Sep-2020 11:03               14029
datetime.settimestamp.php                          27-Sep-2020 11:03                9183
datetime.settimezone.php                           27-Sep-2020 11:03                8522
datetime.setup.php                                 27-Sep-2020 11:03                1508
datetime.sub.php                                   27-Sep-2020 11:03               12342
datetime.wakeup.php                                27-Sep-2020 11:03                2752
datetimeimmutable.add.php                          27-Sep-2020 11:03                2198
datetimeimmutable.construct.php                    27-Sep-2020 11:03                3284
datetimeimmutable.createfromformat.php             27-Sep-2020 11:03                3542
datetimeimmutable.createfrommutable.php            27-Sep-2020 11:03                4215
datetimeimmutable.getlasterrors.php                27-Sep-2020 11:03                2084
datetimeimmutable.modify.php                       27-Sep-2020 11:03                3101
datetimeimmutable.set-state.php                    27-Sep-2020 11:03                2180
datetimeimmutable.setdate.php                      27-Sep-2020 11:03                2326
datetimeimmutable.setisodate.php                   27-Sep-2020 11:03                2383
datetimeimmutable.settime.php                      27-Sep-2020 11:03                2524
datetimeimmutable.settimestamp.php                 27-Sep-2020 11:03                2197
datetimeimmutable.settimezone.php                  27-Sep-2020 11:03                2223
datetimeimmutable.sub.php                          27-Sep-2020 11:03                2205
datetimezone.construct.php                         27-Sep-2020 11:03                6410
datetimezone.getlocation.php                       27-Sep-2020 11:03                4895
datetimezone.getname.php                           27-Sep-2020 11:03                2946
datetimezone.getoffset.php                         27-Sep-2020 11:03                7926
datetimezone.gettransitions.php                    27-Sep-2020 11:03                6574
datetimezone.listabbreviations.php                 27-Sep-2020 11:03                5228
datetimezone.listidentifiers.php                   27-Sep-2020 11:03                6350
dba.configuration.php                              27-Sep-2020 11:03                2140
dba.constants.php                                  27-Sep-2020 11:03                1011
dba.example.php                                    27-Sep-2020 11:03                6619
dba.examples.php                                   27-Sep-2020 11:03                1212
dba.installation.php                               27-Sep-2020 11:03                9321
dba.requirements.php                               27-Sep-2020 11:03                7136
dba.resources.php                                  27-Sep-2020 11:03                1342
dba.setup.php                                      27-Sep-2020 11:03                1445
dbase.configuration.php                            27-Sep-2020 11:03                1130
dbase.constants.php                                27-Sep-2020 11:03                3239
dbase.installation.php                             27-Sep-2020 11:03                1453
dbase.requirements.php                             27-Sep-2020 11:03                1077
dbase.resources.php                                27-Sep-2020 11:03                1352
dbase.setup.php                                    27-Sep-2020 11:03                1464
dbplus.configuration.php                           27-Sep-2020 11:03                1136
dbplus.constants.php                               27-Sep-2020 11:03                1469
dbplus.errorcodes.php                              27-Sep-2020 11:03               12987
dbplus.installation.php                            27-Sep-2020 11:03                2545
dbplus.requirements.php                            27-Sep-2020 11:03                1695
dbplus.resources.php                               27-Sep-2020 11:03                1394
dbplus.setup.php                                   27-Sep-2020 11:03                1474
dbx.configuration.php                              27-Sep-2020 11:03                2499
dbx.installation.php                               27-Sep-2020 11:03                2080
dbx.requirements.php                               27-Sep-2020 11:03                2326
dbx.resources.php                                  27-Sep-2020 11:03                1377
dbx.setup.php                                      27-Sep-2020 11:03                1446
debugger-about.php                                 27-Sep-2020 11:03                1804
debugger.php                                       27-Sep-2020 11:03                1263
dio.configuration.php                              27-Sep-2020 11:03                1118
dio.constants.php                                  27-Sep-2020 11:03                9499
dio.installation.php                               27-Sep-2020 11:03                1907
dio.requirements.php                               27-Sep-2020 11:03                1065
dio.resources.php                                  27-Sep-2020 11:03                1200
dio.setup.php                                      27-Sep-2020 11:03                1446
dir.configuration.php                              27-Sep-2020 11:03                1118
dir.constants.php                                  27-Sep-2020 11:03                2476
dir.installation.php                               27-Sep-2020 11:03                1101
dir.requirements.php                               27-Sep-2020 11:03                1065
dir.resources.php                                  27-Sep-2020 11:03                1063
dir.setup.php                                      27-Sep-2020 11:03                1441
directory.close.php                                27-Sep-2020 11:03                1923
directory.read.php                                 27-Sep-2020 11:03                1906
directory.rewind.php                               27-Sep-2020 11:03                1935
directoryiterator.construct.php                    27-Sep-2020 11:03                4865
directoryiterator.current.php                      27-Sep-2020 11:03                6148
directoryiterator.getatime.php                     27-Sep-2020 11:03                5562
directoryiterator.getbasename.php                  27-Sep-2020 11:03                6525
directoryiterator.getctime.php                     27-Sep-2020 11:03                5664
directoryiterator.getextension.php                 27-Sep-2020 11:03                6235
directoryiterator.getfilename.php                  27-Sep-2020 11:03                5237
directoryiterator.getgroup.php                     27-Sep-2020 11:03                5672
directoryiterator.getinode.php                     27-Sep-2020 11:03                4526
directoryiterator.getmtime.php                     27-Sep-2020 11:03                5558
directoryiterator.getowner.php                     27-Sep-2020 11:03                5091
directoryiterator.getpath.php                      27-Sep-2020 11:03                4672
directoryiterator.getpathname.php                  27-Sep-2020 11:03                5118
directoryiterator.getperms.php                     27-Sep-2020 11:03                6081
directoryiterator.getsize.php                      27-Sep-2020 11:03                4805
directoryiterator.gettype.php                      27-Sep-2020 11:03                5681
directoryiterator.isdir.php                        27-Sep-2020 11:03                5467
directoryiterator.isdot.php                        27-Sep-2020 11:03                5701
directoryiterator.isexecutable.php                 27-Sep-2020 11:03                5345
directoryiterator.isfile.php                       27-Sep-2020 11:03                5621
directoryiterator.islink.php                       27-Sep-2020 11:03                7263
directoryiterator.isreadable.php                   27-Sep-2020 11:03                5199
directoryiterator.iswritable.php                   27-Sep-2020 11:03                5375
directoryiterator.key.php                          27-Sep-2020 11:03                5743
directoryiterator.next.php                         27-Sep-2020 11:03                5397
directoryiterator.rewind.php                       27-Sep-2020 11:03                5322
directoryiterator.seek.php                         27-Sep-2020 11:03                5216
directoryiterator.tostring.php                     27-Sep-2020 11:03                4474
directoryiterator.valid.php                        27-Sep-2020 11:03                5625
doc.changelog.php                                  27-Sep-2020 11:03               68881
dom.configuration.php                              27-Sep-2020 11:03                1118
dom.constants.php                                  27-Sep-2020 11:03               16664
dom.examples.php                                   27-Sep-2020 11:03                2840
dom.installation.php                               27-Sep-2020 11:03                1185
dom.requirements.php                               27-Sep-2020 11:03                1369
dom.resources.php                                  27-Sep-2020 11:03                1063
dom.setup.php                                      27-Sep-2020 11:03                1435
domattr.construct.php                              27-Sep-2020 11:03                5282
domattr.isid.php                                   27-Sep-2020 11:03                4735
domcdatasection.construct.php                      27-Sep-2020 11:03                5001
domcharacterdata.appenddata.php                    27-Sep-2020 11:03                3595
domcharacterdata.deletedata.php                    27-Sep-2020 11:03                4607
domcharacterdata.insertdata.php                    27-Sep-2020 11:03                4327
domcharacterdata.replacedata.php                   27-Sep-2020 11:03                4950
domcharacterdata.substringdata.php                 27-Sep-2020 11:03                4486
domcomment.construct.php                           27-Sep-2020 11:03                4844
domdocument.construct.php                          27-Sep-2020 11:03                4096
domdocument.createattribute.php                    27-Sep-2020 11:03                5496
domdocument.createattributens.php                  27-Sep-2020 11:03                6288
domdocument.createcdatasection.php                 27-Sep-2020 11:03                5180
domdocument.createcomment.php                      27-Sep-2020 11:03                5127
domdocument.createdocumentfragment.php             27-Sep-2020 11:03                4830
domdocument.createelement.php                      27-Sep-2020 11:03               11002
domdocument.createelementns.php                    27-Sep-2020 11:03               13685
domdocument.createentityreference.php              27-Sep-2020 11:03                5822
domdocument.createprocessinginstruction.php        27-Sep-2020 11:03                6038
domdocument.createtextnode.php                     27-Sep-2020 11:03                5119
domdocument.getelementbyid.php                     27-Sep-2020 11:03                7411
domdocument.getelementsbytagname.php               27-Sep-2020 11:03                5911
domdocument.getelementsbytagnamens.php             27-Sep-2020 11:03                6896
domdocument.importnode.php                         27-Sep-2020 11:03                8753
domdocument.load.php                               27-Sep-2020 11:03                5757
domdocument.loadhtml.php                           27-Sep-2020 11:03                6215
domdocument.loadhtmlfile.php                       27-Sep-2020 11:03                6020
domdocument.loadxml.php                            27-Sep-2020 11:03                6528
domdocument.normalizedocument.php                  27-Sep-2020 11:03                2675
domdocument.registernodeclass.php                  27-Sep-2020 11:03               15254
domdocument.relaxngvalidate.php                    27-Sep-2020 11:03                3671
domdocument.relaxngvalidatesource.php              27-Sep-2020 11:03                3698
domdocument.save.php                               27-Sep-2020 11:03                7375
domdocument.savehtml.php                           27-Sep-2020 11:03                7147
domdocument.savehtmlfile.php                       27-Sep-2020 11:03                7798
domdocument.savexml.php                            27-Sep-2020 11:03                8539
domdocument.schemavalidate.php                     27-Sep-2020 11:03                4524
domdocument.schemavalidatesource.php               27-Sep-2020 11:03                4549
domdocument.validate.php                           27-Sep-2020 11:03                5663
domdocument.xinclude.php                           27-Sep-2020 11:03                6928
domdocumentfragment.appendxml.php                  27-Sep-2020 11:03                5162
domelement.construct.php                           27-Sep-2020 11:03                6173
domelement.getattribute.php                        27-Sep-2020 11:03                3265
domelement.getattributenode.php                    27-Sep-2020 11:03                3576
domelement.getattributenodens.php                  27-Sep-2020 11:03                3952
domelement.getattributens.php                      27-Sep-2020 11:03                3715
domelement.getelementsbytagname.php                27-Sep-2020 11:03                3364
domelement.getelementsbytagnamens.php              27-Sep-2020 11:03                3603
domelement.hasattribute.php                        27-Sep-2020 11:03                3466
domelement.hasattributens.php                      27-Sep-2020 11:03                3820
domelement.removeattribute.php                     27-Sep-2020 11:03                3613
domelement.removeattributenode.php                 27-Sep-2020 11:03                3958
domelement.removeattributens.php                   27-Sep-2020 11:03                3967
domelement.setattribute.php                        27-Sep-2020 11:03                5729
domelement.setattributenode.php                    27-Sep-2020 11:03                3736
domelement.setattributenodens.php                  27-Sep-2020 11:03                3732
domelement.setattributens.php                      27-Sep-2020 11:03                4690
domelement.setidattribute.php                      27-Sep-2020 11:03                4336
domelement.setidattributenode.php                  27-Sep-2020 11:03                4431
domelement.setidattributens.php                    27-Sep-2020 11:03                4747
domentityreference.construct.php                   27-Sep-2020 11:03                4700
domimplementation.construct.php                    27-Sep-2020 11:03                1821
domimplementation.createdocument.php               27-Sep-2020 11:03                5524
domimplementation.createdocumenttype.php           27-Sep-2020 11:03                8934
domimplementation.hasfeature.php                   27-Sep-2020 11:03                9349
domnamednodemap.count.php                          27-Sep-2020 11:03                2266
domnamednodemap.getnameditem.php                   27-Sep-2020 11:03                3050
domnamednodemap.getnameditemns.php                 27-Sep-2020 11:03                3378
domnamednodemap.item.php                           27-Sep-2020 11:03                2631
domnode.appendchild.php                            27-Sep-2020 11:03                8085
domnode.c14n.php                                   27-Sep-2020 11:03                3548
domnode.c14nfile.php                               27-Sep-2020 11:03                3943
domnode.clonenode.php                              27-Sep-2020 11:03                2365
domnode.getlineno.php                              27-Sep-2020 11:03                4800
domnode.getnodepath.php                            27-Sep-2020 11:03                5054
domnode.hasattributes.php                          27-Sep-2020 11:03                2448
domnode.haschildnodes.php                          27-Sep-2020 11:03                2370
domnode.insertbefore.php                           27-Sep-2020 11:03                4618
domnode.isdefaultnamespace.php                     27-Sep-2020 11:03                2578
domnode.issamenode.php                             27-Sep-2020 11:03                2501
domnode.issupported.php                            27-Sep-2020 11:03                3405
domnode.lookupnamespaceuri.php                     27-Sep-2020 11:03                2844
domnode.lookupprefix.php                           27-Sep-2020 11:03                2779
domnode.normalize.php                              27-Sep-2020 11:03                2523
domnode.removechild.php                            27-Sep-2020 11:03                6509
domnode.replacechild.php                           27-Sep-2020 11:03                5038
domnodelist.count.php                              27-Sep-2020 11:03                2183
domnodelist.item.php                               27-Sep-2020 11:03                6407
domprocessinginstruction.construct.php             27-Sep-2020 11:03                6367
domtext.construct.php                              27-Sep-2020 11:03                4607
domtext.iselementcontentwhitespace.php             27-Sep-2020 11:03                2353
domtext.iswhitespaceinelementcontent.php           27-Sep-2020 11:03                2360
domtext.splittext.php                              27-Sep-2020 11:03                2933
domxpath.construct.php                             27-Sep-2020 11:03                2327
domxpath.evaluate.php                              27-Sep-2020 11:03                7121
domxpath.query.php                                 27-Sep-2020 11:03               11893
domxpath.registernamespace.php                     27-Sep-2020 11:03                2862
domxpath.registerphpfunctions.php                  27-Sep-2020 11:03               13929
dotnet.construct.php                               27-Sep-2020 11:03                2710
ds-collection.clear.php                            27-Sep-2020 11:03                3903
ds-collection.copy.php                             27-Sep-2020 11:03                4353
ds-collection.isempty.php                          27-Sep-2020 11:03                4193
ds-collection.toarray.php                          27-Sep-2020 11:03                4199
ds-deque.allocate.php                              27-Sep-2020 11:03                4522
ds-deque.apply.php                                 27-Sep-2020 11:03                5023
ds-deque.capacity.php                              27-Sep-2020 11:03                3869
ds-deque.clear.php                                 27-Sep-2020 11:03                3790
ds-deque.construct.php                             27-Sep-2020 11:03                4316
ds-deque.contains.php                              27-Sep-2020 11:03                7424
ds-deque.copy.php                                  27-Sep-2020 11:03                4185
ds-deque.count.php                                 27-Sep-2020 11:03                1447
ds-deque.filter.php                                27-Sep-2020 11:03                7469
ds-deque.find.php                                  27-Sep-2020 11:03                5373
ds-deque.first.php                                 27-Sep-2020 11:03                3735
ds-deque.get.php                                   27-Sep-2020 11:03                6566
ds-deque.insert.php                                27-Sep-2020 11:03                6901
ds-deque.isempty.php                               27-Sep-2020 11:03                4045
ds-deque.join.php                                  27-Sep-2020 11:03                5657
ds-deque.jsonserialize.php                         27-Sep-2020 11:03                1719
ds-deque.last.php                                  27-Sep-2020 11:03                3724
ds-deque.map.php                                   27-Sep-2020 11:03                5423
ds-deque.merge.php                                 27-Sep-2020 11:03                4829
ds-deque.pop.php                                   27-Sep-2020 11:03                4222
ds-deque.push.php                                  27-Sep-2020 11:03                4626
ds-deque.reduce.php                                27-Sep-2020 11:03                8528
ds-deque.remove.php                                27-Sep-2020 11:03                4758
ds-deque.reverse.php                               27-Sep-2020 11:03                3624
ds-deque.reversed.php                              27-Sep-2020 11:03                3996
ds-deque.rotate.php                                27-Sep-2020 11:03                5018
ds-deque.set.php                                   27-Sep-2020 11:03                6034
ds-deque.shift.php                                 27-Sep-2020 11:03                4321
ds-deque.slice.php                                 27-Sep-2020 11:03                7139
ds-deque.sort.php                                  27-Sep-2020 11:03                7544
ds-deque.sorted.php                                27-Sep-2020 11:03                7601
ds-deque.sum.php                                   27-Sep-2020 11:03                5243
ds-deque.toarray.php                               27-Sep-2020 11:03                4055
ds-deque.unshift.php                               27-Sep-2020 11:03                4666
ds-hashable.equals.php                             27-Sep-2020 11:03                3252
ds-hashable.hash.php                               27-Sep-2020 11:03                8412
ds-map.allocate.php                                27-Sep-2020 11:03                4390
ds-map.apply.php                                   27-Sep-2020 11:03                5795
ds-map.capacity.php                                27-Sep-2020 11:03                3156
ds-map.clear.php                                   27-Sep-2020 11:03                4348
ds-map.construct.php                               27-Sep-2020 11:03                4887
ds-map.copy.php                                    27-Sep-2020 11:03                4117
ds-map.count.php                                   27-Sep-2020 11:03                1410
ds-map.diff.php                                    27-Sep-2020 11:03                5579
ds-map.filter.php                                  27-Sep-2020 11:03                8334
ds-map.first.php                                   27-Sep-2020 11:03                4044
ds-map.get.php                                     27-Sep-2020 11:03                8510
ds-map.haskey.php                                  27-Sep-2020 11:03                4552
ds-map.hasvalue.php                                27-Sep-2020 11:03                4594
ds-map.intersect.php                               27-Sep-2020 11:03                6095
ds-map.isempty.php                                 27-Sep-2020 11:03                4299
ds-map.jsonserialize.php                           27-Sep-2020 11:03                1699
ds-map.keys.php                                    27-Sep-2020 11:03                3923
ds-map.ksort.php                                   27-Sep-2020 11:03                8277
ds-map.ksorted.php                                 27-Sep-2020 11:03                8396
ds-map.last.php                                    27-Sep-2020 11:03                4030
ds-map.map.php                                     27-Sep-2020 11:03                6463
ds-map.merge.php                                   27-Sep-2020 11:03                5794
ds-map.pairs.php                                   27-Sep-2020 11:03                4282
ds-map.put.php                                     27-Sep-2020 11:03               14763
ds-map.putall.php                                  27-Sep-2020 11:03                5407
ds-map.reduce.php                                  27-Sep-2020 11:03                9569
ds-map.remove.php                                  27-Sep-2020 11:03                6931
ds-map.reverse.php                                 27-Sep-2020 11:03                4108
ds-map.reversed.php                                27-Sep-2020 11:03                4238
ds-map.skip.php                                    27-Sep-2020 11:03                4474
ds-map.slice.php                                   27-Sep-2020 11:03                8042
ds-map.sort.php                                    27-Sep-2020 11:03                8196
ds-map.sorted.php                                  27-Sep-2020 11:03                8376
ds-map.sum.php                                     27-Sep-2020 11:03                5772
ds-map.toarray.php                                 27-Sep-2020 11:03                5134
ds-map.union.php                                   27-Sep-2020 11:03                6083
ds-map.values.php                                  27-Sep-2020 11:03                3915
ds-map.xor.php                                     27-Sep-2020 11:03                5642
ds-pair.clear.php                                  27-Sep-2020 11:03                3687
ds-pair.construct.php                              27-Sep-2020 11:03                2452
ds-pair.copy.php                                   27-Sep-2020 11:03                4105
ds-pair.isempty.php                                27-Sep-2020 11:03                3991
ds-pair.jsonserialize.php                          27-Sep-2020 11:03                1718
ds-pair.toarray.php                                27-Sep-2020 11:03                3981
ds-priorityqueue.allocate.php                      27-Sep-2020 11:03                4680
ds-priorityqueue.capacity.php                      27-Sep-2020 11:03                3355
ds-priorityqueue.clear.php                         27-Sep-2020 11:03                4449
ds-priorityqueue.construct.php                     27-Sep-2020 11:03                2894
ds-priorityqueue.copy.php                          27-Sep-2020 11:03                4480
ds-priorityqueue.count.php                         27-Sep-2020 11:03                1548
ds-priorityqueue.isempty.php                       27-Sep-2020 11:03                4957
ds-priorityqueue.jsonserialize.php                 27-Sep-2020 11:03                1829
ds-priorityqueue.peek.php                          27-Sep-2020 11:03                4716
ds-priorityqueue.pop.php                           27-Sep-2020 11:03                5487
ds-priorityqueue.push.php                          27-Sep-2020 11:03                5502
ds-priorityqueue.toarray.php                       27-Sep-2020 11:03                5146
ds-queue.allocate.php                              27-Sep-2020 11:03                4715
ds-queue.capacity.php                              27-Sep-2020 11:03                3875
ds-queue.clear.php                                 27-Sep-2020 11:03                3775
ds-queue.construct.php                             27-Sep-2020 11:03                4314
ds-queue.copy.php                                  27-Sep-2020 11:03                4322
ds-queue.count.php                                 27-Sep-2020 11:03                1444
ds-queue.isempty.php                               27-Sep-2020 11:03                4061
ds-queue.jsonserialize.php                         27-Sep-2020 11:03                1725
ds-queue.peek.php                                  27-Sep-2020 11:03                4308
ds-queue.pop.php                                   27-Sep-2020 11:03                4843
ds-queue.push.php                                  27-Sep-2020 11:03                4661
ds-queue.toarray.php                               27-Sep-2020 11:03                4215
ds-sequence.allocate.php                           27-Sep-2020 11:03                4423
ds-sequence.apply.php                              27-Sep-2020 11:03                5135
ds-sequence.capacity.php                           27-Sep-2020 11:03                4431
ds-sequence.contains.php                           27-Sep-2020 11:03                7548
ds-sequence.filter.php                             27-Sep-2020 11:03                7605
ds-sequence.find.php                               27-Sep-2020 11:03                5482
ds-sequence.first.php                              27-Sep-2020 11:03                3847
ds-sequence.get.php                                27-Sep-2020 11:03                6691
ds-sequence.insert.php                             27-Sep-2020 11:03                7017
ds-sequence.join.php                               27-Sep-2020 11:03                5750
ds-sequence.last.php                               27-Sep-2020 11:03                3815
ds-sequence.map.php                                27-Sep-2020 11:03                5549
ds-sequence.merge.php                              27-Sep-2020 11:03                4952
ds-sequence.pop.php                                27-Sep-2020 11:03                4331
ds-sequence.push.php                               27-Sep-2020 11:03                4745
ds-sequence.reduce.php                             27-Sep-2020 11:03                8644
ds-sequence.remove.php                             27-Sep-2020 11:03                4867
ds-sequence.reverse.php                            27-Sep-2020 11:03                3734
ds-sequence.reversed.php                           27-Sep-2020 11:03                4116
ds-sequence.rotate.php                             27-Sep-2020 11:03                5152
ds-sequence.set.php                                27-Sep-2020 11:03                6155
ds-sequence.shift.php                              27-Sep-2020 11:03                4430
ds-sequence.slice.php                              27-Sep-2020 11:03                7301
ds-sequence.sort.php                               27-Sep-2020 11:03                7668
ds-sequence.sorted.php                             27-Sep-2020 11:03                7725
ds-sequence.sum.php                                27-Sep-2020 11:03                5365
ds-sequence.unshift.php                            27-Sep-2020 11:03                4774
ds-set.add.php                                     27-Sep-2020 11:03               12964
ds-set.allocate.php                                27-Sep-2020 11:03                4403
ds-set.capacity.php                                27-Sep-2020 11:03                3830
ds-set.clear.php                                   27-Sep-2020 11:03                3723
ds-set.construct.php                               27-Sep-2020 11:03                4272
ds-set.contains.php                                27-Sep-2020 11:03                7379
ds-set.copy.php                                    27-Sep-2020 11:03                4263
ds-set.count.php                                   27-Sep-2020 11:03                1410
ds-set.diff.php                                    27-Sep-2020 11:03                4809
ds-set.filter.php                                  27-Sep-2020 11:03                7402
ds-set.first.php                                   27-Sep-2020 11:03                3690
ds-set.get.php                                     27-Sep-2020 11:03                6512
ds-set.intersect.php                               27-Sep-2020 11:03                5035
ds-set.isempty.php                                 27-Sep-2020 11:03                4005
ds-set.join.php                                    27-Sep-2020 11:03                5605
ds-set.jsonserialize.php                           27-Sep-2020 11:03                1693
ds-set.last.php                                    27-Sep-2020 11:03                3692
ds-set.merge.php                                   27-Sep-2020 11:03                4757
ds-set.reduce.php                                  27-Sep-2020 11:03                8476
ds-set.remove.php                                  27-Sep-2020 11:03                5137
ds-set.reverse.php                                 27-Sep-2020 11:03                3574
ds-set.reversed.php                                27-Sep-2020 11:03                3936
ds-set.slice.php                                   27-Sep-2020 11:03                7055
ds-set.sort.php                                    27-Sep-2020 11:03                7482
ds-set.sorted.php                                  27-Sep-2020 11:03                7539
ds-set.sum.php                                     27-Sep-2020 11:03                5185
ds-set.toarray.php                                 27-Sep-2020 11:03                4003
ds-set.union.php                                   27-Sep-2020 11:03                5002
ds-set.xor.php                                     27-Sep-2020 11:03                4976
ds-stack.allocate.php                              27-Sep-2020 11:03                2635
ds-stack.capacity.php                              27-Sep-2020 11:03                2030
ds-stack.clear.php                                 27-Sep-2020 11:03                3775
ds-stack.construct.php                             27-Sep-2020 11:03                4280
ds-stack.copy.php                                  27-Sep-2020 11:03                4322
ds-stack.count.php                                 27-Sep-2020 11:03                1444
ds-stack.isempty.php                               27-Sep-2020 11:03                4061
ds-stack.jsonserialize.php                         27-Sep-2020 11:03                1725
ds-stack.peek.php                                  27-Sep-2020 11:03                4302
ds-stack.pop.php                                   27-Sep-2020 11:03                4837
ds-stack.push.php                                  27-Sep-2020 11:03                4661
ds-stack.toarray.php                               27-Sep-2020 11:03                4042
ds-vector.allocate.php                             27-Sep-2020 11:03                4342
ds-vector.apply.php                                27-Sep-2020 11:03                5048
ds-vector.capacity.php                             27-Sep-2020 11:03                4338
ds-vector.clear.php                                27-Sep-2020 11:03                3801
ds-vector.construct.php                            27-Sep-2020 11:03                4347
ds-vector.contains.php                             27-Sep-2020 11:03                7453
ds-vector.copy.php                                 27-Sep-2020 11:03                4345
ds-vector.count.php                                27-Sep-2020 11:03                1460
ds-vector.filter.php                               27-Sep-2020 11:03                7502
ds-vector.find.php                                 27-Sep-2020 11:03                5397
ds-vector.first.php                                27-Sep-2020 11:03                3760
ds-vector.get.php                                  27-Sep-2020 11:03                6596
ds-vector.insert.php                               27-Sep-2020 11:03                6930
ds-vector.isempty.php                              27-Sep-2020 11:03                4068
ds-vector.join.php                                 27-Sep-2020 11:03                5683
ds-vector.jsonserialize.php                        27-Sep-2020 11:03                1732
ds-vector.last.php                                 27-Sep-2020 11:03                3748
ds-vector.map.php                                  27-Sep-2020 11:03                5454
ds-vector.merge.php                                27-Sep-2020 11:03                4859
ds-vector.pop.php                                  27-Sep-2020 11:03                4246
ds-vector.push.php                                 27-Sep-2020 11:03                4654
ds-vector.reduce.php                               27-Sep-2020 11:03                8555
ds-vector.remove.php                               27-Sep-2020 11:03                4782
ds-vector.reverse.php                              27-Sep-2020 11:03                3649
ds-vector.reversed.php                             27-Sep-2020 11:03                4025
ds-vector.rotate.php                               27-Sep-2020 11:03                5051
ds-vector.set.php                                  27-Sep-2020 11:03                6064
ds-vector.shift.php                                27-Sep-2020 11:03                4345
ds-vector.slice.php                                27-Sep-2020 11:03                7184
ds-vector.sort.php                                 27-Sep-2020 11:03                7575
ds-vector.sorted.php                               27-Sep-2020 11:03                7632
ds-vector.sum.php                                  27-Sep-2020 11:03                5272
ds-vector.toarray.php                              27-Sep-2020 11:03                4079
ds-vector.unshift.php                              27-Sep-2020 11:03                4695
ds.constants.php                                   27-Sep-2020 11:03                1018
ds.examples.php                                    27-Sep-2020 11:03                4811
ds.installation.php                                27-Sep-2020 11:03                2388
ds.requirements.php                                27-Sep-2020 11:03                1081
ds.setup.php                                       27-Sep-2020 11:03                1296
eio.configuration.php                              27-Sep-2020 11:03                1118
eio.constants.php                                  27-Sep-2020 11:03               19482
eio.examples.php                                   27-Sep-2020 11:03               29382
eio.installation.php                               27-Sep-2020 11:03                1589
eio.requirements.php                               27-Sep-2020 11:03                1200
eio.resources.php                                  27-Sep-2020 11:03                1108
eio.setup.php                                      27-Sep-2020 11:03                1447
emptyiterator.current.php                          27-Sep-2020 11:03                2614
emptyiterator.key.php                              27-Sep-2020 11:03                2537
emptyiterator.next.php                             27-Sep-2020 11:03                2263
emptyiterator.rewind.php                           27-Sep-2020 11:03                2283
emptyiterator.valid.php                            27-Sep-2020 11:03                2268
enchant.configuration.php                          27-Sep-2020 11:03                1142
enchant.constants.php                              27-Sep-2020 11:03                2223
enchant.examples.php                               27-Sep-2020 11:03                5763
enchant.installation.php                           27-Sep-2020 11:03                1575
enchant.requirements.php                           27-Sep-2020 11:03                1666
enchant.resources.php                              27-Sep-2020 11:03                1191
enchant.setup.php                                  27-Sep-2020 11:03                1488
error.clone.php                                    27-Sep-2020 11:02                2305
error.construct.php                                27-Sep-2020 11:02                3107
error.getcode.php                                  27-Sep-2020 11:02                4141
error.getfile.php                                  27-Sep-2020 11:02                3723
error.getline.php                                  27-Sep-2020 11:02                3986
error.getmessage.php                               27-Sep-2020 11:02                3807
error.getprevious.php                              27-Sep-2020 11:02                6787
error.gettrace.php                                 27-Sep-2020 11:02                4241
error.gettraceasstring.php                         27-Sep-2020 11:02                4064
error.tostring.php                                 27-Sep-2020 11:02                3964
errorexception.construct.php                       27-Sep-2020 11:02                4780
errorexception.getseverity.php                     27-Sep-2020 11:02                4292
errorfunc.configuration.php                        27-Sep-2020 11:02               23907
errorfunc.constants.php                            27-Sep-2020 11:02               10524
errorfunc.examples.php                             27-Sep-2020 11:02               23830
errorfunc.installation.php                         27-Sep-2020 11:02                1137
errorfunc.requirements.php                         27-Sep-2020 11:02                1101
errorfunc.resources.php                            27-Sep-2020 11:02                1099
errorfunc.setup.php                                27-Sep-2020 11:02                1501
ev.backend.php                                     27-Sep-2020 11:03                3328
ev.configuration.php                               27-Sep-2020 11:03                1112
ev.depth.php                                       27-Sep-2020 11:03                3139
ev.embeddablebackends.php                          27-Sep-2020 11:03                6854
ev.examples.php                                    27-Sep-2020 11:03               47696
ev.feedsignal.php                                  27-Sep-2020 11:03                3199
ev.feedsignalevent.php                             27-Sep-2020 11:03                2981
ev.global.constants.php                            27-Sep-2020 11:03                1141
ev.installation.php                                27-Sep-2020 11:03                1580
ev.iteration.php                                   27-Sep-2020 11:03                2509
ev.now.php                                         27-Sep-2020 11:03                2924
ev.nowupdate.php                                   27-Sep-2020 11:03                3107
ev.periodic-modes.php                              27-Sep-2020 11:03                7691
ev.recommendedbackends.php                         27-Sep-2020 11:03                7595
ev.requirements.php                                27-Sep-2020 11:03                1136
ev.resources.php                                   27-Sep-2020 11:03                1064
ev.resume.php                                      27-Sep-2020 11:03                3700
ev.run.php                                         27-Sep-2020 11:03                4665
ev.setup.php                                       27-Sep-2020 11:03                1403
ev.sleep.php                                       27-Sep-2020 11:03                2252
ev.stop.php                                        27-Sep-2020 11:03                2686
ev.supportedbackends.php                           27-Sep-2020 11:03                6837
ev.suspend.php                                     27-Sep-2020 11:03                3432
ev.time.php                                        27-Sep-2020 11:03                2559
ev.verify.php                                      27-Sep-2020 11:03                2179
ev.watcher-callbacks.php                           27-Sep-2020 11:03                3900
ev.watchers.php                                    27-Sep-2020 11:03                3382
evcheck.construct.php                              27-Sep-2020 11:03                3605
evcheck.createstopped.php                          27-Sep-2020 11:03                3336
evchild.construct.php                              27-Sep-2020 11:03                6300
evchild.createstopped.php                          27-Sep-2020 11:03                4656
evchild.set.php                                    27-Sep-2020 11:03                2986
evembed.construct.php                              27-Sep-2020 11:03                8331
evembed.createstopped.php                          27-Sep-2020 11:03                4374
evembed.set.php                                    27-Sep-2020 11:03                2371
evembed.sweep.php                                  27-Sep-2020 11:03                2977
event.add.php                                      27-Sep-2020 11:03                3497
event.addsignal.php                                27-Sep-2020 11:03                7918
event.addtimer.php                                 27-Sep-2020 11:03                5154
event.callbacks.php                                27-Sep-2020 11:03                5235
event.configuration.php                            27-Sep-2020 11:03                1130
event.construct.php                                27-Sep-2020 11:03                4509
event.constructing.signal.events.php               27-Sep-2020 11:03                6750
event.del.php                                      27-Sep-2020 11:03                2393
event.delsignal.php                                27-Sep-2020 11:03                2114
event.deltimer.php                                 27-Sep-2020 11:03                2113
event.examples.php                                 27-Sep-2020 11:03              198858
event.flags.php                                    27-Sep-2020 11:03                2237
event.free.php                                     27-Sep-2020 11:03                2886
event.getsupportedmethods.php                      27-Sep-2020 11:03                2504
event.installation.php                             27-Sep-2020 11:03                1604
event.pending.php                                  27-Sep-2020 11:03                2587
event.persistence.php                              27-Sep-2020 11:03                2664
event.requirements.php                             27-Sep-2020 11:03                1351
event.resources.php                                27-Sep-2020 11:03                1062
event.set.php                                      27-Sep-2020 11:03                4142
event.setpriority.php                              27-Sep-2020 11:03                2269
event.settimer.php                                 27-Sep-2020 11:03                3872
event.setup.php                                    27-Sep-2020 11:03                1439
event.signal.php                                   27-Sep-2020 11:03                4008
event.timer.php                                    27-Sep-2020 11:03                3451
eventbase.construct.php                            27-Sep-2020 11:03                2613
eventbase.dispatch.php                             27-Sep-2020 11:03                3099
eventbase.exit.php                                 27-Sep-2020 11:03                2747
eventbase.free.php                                 27-Sep-2020 11:03                3171
eventbase.getfeatures.php                          27-Sep-2020 11:03                5900
eventbase.getmethod.php                            27-Sep-2020 11:03                4552
eventbase.gettimeofdaycached.php                   27-Sep-2020 11:03                2575
eventbase.gotexit.php                              27-Sep-2020 11:03                3160
eventbase.gotstop.php                              27-Sep-2020 11:03                3132
eventbase.loop.php                                 27-Sep-2020 11:03                3276
eventbase.priorityinit.php                         27-Sep-2020 11:03                2751
eventbase.reinit.php                               27-Sep-2020 11:03                2160
eventbase.stop.php                                 27-Sep-2020 11:03                2657
eventbuffer.add.php                                27-Sep-2020 11:03                2757
eventbuffer.addbuffer.php                          27-Sep-2020 11:03                3132
eventbuffer.appendfrom.php                         27-Sep-2020 11:03                4774
eventbuffer.construct.php                          27-Sep-2020 11:03                2082
eventbuffer.copyout.php                            27-Sep-2020 11:03                3738
eventbuffer.drain.php                              27-Sep-2020 11:03                3247
eventbuffer.enablelocking.php                      27-Sep-2020 11:03                2769
eventbuffer.expand.php                             27-Sep-2020 11:03                2541
eventbuffer.freeze.php                             27-Sep-2020 11:03                2803
eventbuffer.lock.php                               27-Sep-2020 11:03                2951
eventbuffer.prepend.php                            27-Sep-2020 11:03                3258
eventbuffer.prependbuffer.php                      27-Sep-2020 11:03                3474
eventbuffer.pullup.php                             27-Sep-2020 11:03                4487
eventbuffer.read.php                               27-Sep-2020 11:03                4743
eventbuffer.readfrom.php                           27-Sep-2020 11:03                4221
eventbuffer.readline.php                           27-Sep-2020 11:03                4060
eventbuffer.search.php                             27-Sep-2020 11:03                8534
eventbuffer.searcheol.php                          27-Sep-2020 11:03                4467
eventbuffer.substr.php                             27-Sep-2020 11:03                3253
eventbuffer.unfreeze.php                           27-Sep-2020 11:03                2815
eventbuffer.unlock.php                             27-Sep-2020 11:03                2613
eventbuffer.write.php                              27-Sep-2020 11:03                3242
eventbufferevent.about.callbacks.php               27-Sep-2020 11:03                5423
eventbufferevent.close.php                         27-Sep-2020 11:03                2395
eventbufferevent.connect.php                       27-Sep-2020 11:03               26914
eventbufferevent.connecthost.php                   27-Sep-2020 11:03               18220
eventbufferevent.construct.php                     27-Sep-2020 11:03                6325
eventbufferevent.createpair.php                    27-Sep-2020 11:03                3880
eventbufferevent.disable.php                       27-Sep-2020 11:03                3047
eventbufferevent.enable.php                        27-Sep-2020 11:03                3312
eventbufferevent.free.php                          27-Sep-2020 11:03                2703
eventbufferevent.getdnserrorstring.php             27-Sep-2020 11:03                2994
eventbufferevent.getenabled.php                    27-Sep-2020 11:03                2967
eventbufferevent.getinput.php                      27-Sep-2020 11:03                5077
eventbufferevent.getoutput.php                     27-Sep-2020 11:03                8232
eventbufferevent.read.php                          27-Sep-2020 11:03                2889
eventbufferevent.readbuffer.php                    27-Sep-2020 11:03                2994
eventbufferevent.setcallbacks.php                  27-Sep-2020 11:03                4280
eventbufferevent.setpriority.php                   27-Sep-2020 11:03                2641
eventbufferevent.settimeouts.php                   27-Sep-2020 11:03                2815
eventbufferevent.setwatermark.php                  27-Sep-2020 11:03                3739
eventbufferevent.sslerror.php                      27-Sep-2020 11:03                6278
eventbufferevent.sslfilter.php                     27-Sep-2020 11:03               40754
eventbufferevent.sslgetcipherinfo.php              27-Sep-2020 11:03                2760
eventbufferevent.sslgetciphername.php              27-Sep-2020 11:03                2646
eventbufferevent.sslgetcipherversion.php           27-Sep-2020 11:03                2672
eventbufferevent.sslgetprotocol.php                27-Sep-2020 11:03                2606
eventbufferevent.sslrenegotiate.php                27-Sep-2020 11:03                2729
eventbufferevent.sslsocket.php                     27-Sep-2020 11:03                5182
eventbufferevent.write.php                         27-Sep-2020 11:03                2935
eventbufferevent.writebuffer.php                   27-Sep-2020 11:03                3080
eventconfig.avoidmethod.php                        27-Sep-2020 11:03                4171
eventconfig.construct.php                          27-Sep-2020 11:03                4433
eventconfig.requirefeatures.php                    27-Sep-2020 11:03                5882
eventconfig.setmaxdispatchinterval.php             27-Sep-2020 11:03                4205
eventdnsbase.addnameserverip.php                   27-Sep-2020 11:03                2665
eventdnsbase.addsearch.php                         27-Sep-2020 11:03                2387
eventdnsbase.clearsearch.php                       27-Sep-2020 11:03                2732
eventdnsbase.construct.php                         27-Sep-2020 11:03                3140
eventdnsbase.countnameservers.php                  27-Sep-2020 11:03                2417
eventdnsbase.loadhosts.php                         27-Sep-2020 11:03                2548
eventdnsbase.parseresolvconf.php                   27-Sep-2020 11:03                3960
eventdnsbase.setoption.php                         27-Sep-2020 11:03                3066
eventdnsbase.setsearchndots.php                    27-Sep-2020 11:03                2603
eventhttp.accept.php                               27-Sep-2020 11:03               13141
eventhttp.addserveralias.php                       27-Sep-2020 11:03                6367
eventhttp.bind.php                                 27-Sep-2020 11:03                7768
eventhttp.construct.php                            27-Sep-2020 11:03               19780
eventhttp.removeserveralias.php                    27-Sep-2020 11:03                2940
eventhttp.setallowedmethods.php                    27-Sep-2020 11:03                3223
eventhttp.setcallback.php                          27-Sep-2020 11:03               19622
eventhttp.setdefaultcallback.php                   27-Sep-2020 11:03                7691
eventhttp.setmaxbodysize.php                       27-Sep-2020 11:03                2752
eventhttp.setmaxheaderssize.php                    27-Sep-2020 11:03                2661
eventhttp.settimeout.php                           27-Sep-2020 11:03                2344
eventhttpconnection.construct.php                  27-Sep-2020 11:03                4921
eventhttpconnection.getbase.php                    27-Sep-2020 11:03                2469
eventhttpconnection.getpeer.php                    27-Sep-2020 11:03                2801
eventhttpconnection.makerequest.php                27-Sep-2020 11:03               12457
eventhttpconnection.setclosecallback.php           27-Sep-2020 11:03               11675
eventhttpconnection.setlocaladdress.php            27-Sep-2020 11:03                3038
eventhttpconnection.setlocalport.php               27-Sep-2020 11:03                2934
eventhttpconnection.setmaxbodysize.php             27-Sep-2020 11:03                2964
eventhttpconnection.setmaxheaderssize.php          27-Sep-2020 11:03                2982
eventhttpconnection.setretries.php                 27-Sep-2020 11:03                2564
eventhttpconnection.settimeout.php                 27-Sep-2020 11:03                2461
eventhttprequest.addheader.php                     27-Sep-2020 11:03                3561
eventhttprequest.cancel.php                        27-Sep-2020 11:03                2724
eventhttprequest.clearheaders.php                  27-Sep-2020 11:03                2712
eventhttprequest.closeconnection.php               27-Sep-2020 11:03                2301
eventhttprequest.construct.php                     27-Sep-2020 11:03               12627
eventhttprequest.findheader.php                    27-Sep-2020 11:03                3276
eventhttprequest.free.php                          27-Sep-2020 11:03                2220
eventhttprequest.getbufferevent.php                27-Sep-2020 11:03                3530
eventhttprequest.getcommand.php                    27-Sep-2020 11:03                2591
eventhttprequest.getconnection.php                 27-Sep-2020 11:03                4234
eventhttprequest.gethost.php                       27-Sep-2020 11:03                2762
eventhttprequest.getinputbuffer.php                27-Sep-2020 11:03                2702
eventhttprequest.getinputheaders.php               27-Sep-2020 11:03                2734
eventhttprequest.getoutputbuffer.php               27-Sep-2020 11:03                2760
eventhttprequest.getoutputheaders.php              27-Sep-2020 11:03                2717
eventhttprequest.getresponsecode.php               27-Sep-2020 11:03                3051
eventhttprequest.geturi.php                        27-Sep-2020 11:03                2971
eventhttprequest.removeheader.php                  27-Sep-2020 11:03                3285
eventhttprequest.senderror.php                     27-Sep-2020 11:03                5610
eventhttprequest.sendreply.php                     27-Sep-2020 11:03                3821
eventhttprequest.sendreplychunk.php                27-Sep-2020 11:03                3325
eventhttprequest.sendreplyend.php                  27-Sep-2020 11:03                2960
eventhttprequest.sendreplystart.php                27-Sep-2020 11:03                4102
eventlistener.construct.php                        27-Sep-2020 11:03               27339
eventlistener.disable.php                          27-Sep-2020 11:03                2586
eventlistener.enable.php                           27-Sep-2020 11:03                2573
eventlistener.getbase.php                          27-Sep-2020 11:03                2236
eventlistener.getsocketname.php                    27-Sep-2020 11:03                3033
eventlistener.setcallback.php                      27-Sep-2020 11:03                5485
eventlistener.seterrorcallback.php                 27-Sep-2020 11:03                4134
eventsslcontext.construct.php                      27-Sep-2020 11:03                5704
eventutil.construct.php                            27-Sep-2020 11:03                2239
eventutil.getlastsocketerrno.php                   27-Sep-2020 11:03                3127
eventutil.getlastsocketerror.php                   27-Sep-2020 11:03                2955
eventutil.getsocketfd.php                          27-Sep-2020 11:03                3038
eventutil.getsocketname.php                        27-Sep-2020 11:03                3466
eventutil.setsocketoption.php                      27-Sep-2020 11:03                5229
eventutil.sslrandpoll.php                          27-Sep-2020 11:03                2262
evfork.construct.php                               27-Sep-2020 11:03                3684
evfork.createstopped.php                           27-Sep-2020 11:03                3570
evidle.construct.php                               27-Sep-2020 11:03                3696
evidle.createstopped.php                           27-Sep-2020 11:03                3867
evio.construct.php                                 27-Sep-2020 11:03                4591
evio.createstopped.php                             27-Sep-2020 11:03                4858
evio.set.php                                       27-Sep-2020 11:03                2701
evloop.backend.php                                 27-Sep-2020 11:03                2608
evloop.check.php                                   27-Sep-2020 11:03                2979
evloop.child.php                                   27-Sep-2020 11:03                3209
evloop.construct.php                               27-Sep-2020 11:03                3861
evloop.defaultloop.php                             27-Sep-2020 11:03                4317
evloop.embed.php                                   27-Sep-2020 11:03                3238
evloop.fork.php                                    27-Sep-2020 11:03                3229
evloop.idle.php                                    27-Sep-2020 11:03                3249
evloop.invokepending.php                           27-Sep-2020 11:03                2131
evloop.io.php                                      27-Sep-2020 11:03                3523
evloop.loopfork.php                                27-Sep-2020 11:03                2436
evloop.now.php                                     27-Sep-2020 11:03                2726
evloop.nowupdate.php                               27-Sep-2020 11:03                3080
evloop.periodic.php                                27-Sep-2020 11:03                3571
evloop.prepare.php                                 27-Sep-2020 11:03                3244
evloop.resume.php                                  27-Sep-2020 11:03                2743
evloop.run.php                                     27-Sep-2020 11:03                4664
evloop.signal.php                                  27-Sep-2020 11:03                3383
evloop.stat.php                                    27-Sep-2020 11:03                3483
evloop.stop.php                                    27-Sep-2020 11:03                2809
evloop.suspend.php                                 27-Sep-2020 11:03                2734
evloop.timer.php                                   27-Sep-2020 11:03                3501
evloop.verify.php                                  27-Sep-2020 11:03                2510
evperiodic.again.php                               27-Sep-2020 11:03                2480
evperiodic.at.php                                  27-Sep-2020 11:03                2515
evperiodic.construct.php                           27-Sep-2020 11:03               10087
evperiodic.createstopped.php                       27-Sep-2020 11:03                5404
evperiodic.set.php                                 27-Sep-2020 11:03                2972
evprepare.construct.php                            27-Sep-2020 11:03                3412
evprepare.createstopped.php                        27-Sep-2020 11:03                4170
evsignal.construct.php                             27-Sep-2020 11:03                5480
evsignal.createstopped.php                         27-Sep-2020 11:03                4550
evsignal.set.php                                   27-Sep-2020 11:03                2324
evstat.attr.php                                    27-Sep-2020 11:03                8624
evstat.construct.php                               27-Sep-2020 11:03                7388
evstat.createstopped.php                           27-Sep-2020 11:03                4825
evstat.prev.php                                    27-Sep-2020 11:03                2871
evstat.set.php                                     27-Sep-2020 11:03                2651
evstat.stat.php                                    27-Sep-2020 11:03                2791
evtimer.again.php                                  27-Sep-2020 11:03                2978
evtimer.construct.php                              27-Sep-2020 11:03               13446
evtimer.createstopped.php                          27-Sep-2020 11:03                8253
evtimer.set.php                                    27-Sep-2020 11:03                2792
evwatcher.clear.php                                27-Sep-2020 11:03                2702
evwatcher.construct.php                            27-Sep-2020 11:03                1843
evwatcher.feed.php                                 27-Sep-2020 11:03                2439
evwatcher.getloop.php                              27-Sep-2020 11:03                2211
evwatcher.invoke.php                               27-Sep-2020 11:03                2440
evwatcher.keepalive.php                            27-Sep-2020 11:03                5009
evwatcher.setcallback.php                          27-Sep-2020 11:03                2448
evwatcher.start.php                                27-Sep-2020 11:03                2423
evwatcher.stop.php                                 27-Sep-2020 11:03                2393
example.xml-external-entity.php                    27-Sep-2020 11:03               25945
example.xml-map-tags.php                           27-Sep-2020 11:03                9004
example.xml-structure.php                          27-Sep-2020 11:03                7590
example.xmlwriter-namespace.php                    27-Sep-2020 11:03                5370
example.xmlwriter-oop.php                          27-Sep-2020 11:03                3306
example.xmlwriter-simple.php                       27-Sep-2020 11:03                8820
exception.clone.php                                27-Sep-2020 11:02                2319
exception.construct.php                            27-Sep-2020 11:02                4169
exception.getcode.php                              27-Sep-2020 11:02                4541
exception.getfile.php                              27-Sep-2020 11:02                3787
exception.getline.php                              27-Sep-2020 11:02                4049
exception.getmessage.php                           27-Sep-2020 11:02                3851
exception.getprevious.php                          27-Sep-2020 11:02                7405
exception.gettrace.php                             27-Sep-2020 11:02                4314
exception.gettraceasstring.php                     27-Sep-2020 11:02                4136
exception.tostring.php                             27-Sep-2020 11:02                4075
exec.configuration.php                             27-Sep-2020 11:03                1124
exec.constants.php                                 27-Sep-2020 11:03                1045
exec.installation.php                              27-Sep-2020 11:03                1107
exec.requirements.php                              27-Sep-2020 11:03                1071
exec.resources.php                                 27-Sep-2020 11:03                1214
exec.setup.php                                     27-Sep-2020 11:03                1460
exif.configuration.php                             27-Sep-2020 11:03                7001
exif.constants.php                                 27-Sep-2020 11:03                1858
exif.installation.php                              27-Sep-2020 11:03                1549
exif.requirements.php                              27-Sep-2020 11:03                1653
exif.resources.php                                 27-Sep-2020 11:03                1069
exif.setup.php                                     27-Sep-2020 11:03                1458
expect.configuration.php                           27-Sep-2020 11:03                5212
expect.constants.php                               27-Sep-2020 11:03                3527
expect.examples-usage.php                          27-Sep-2020 11:03               17087
expect.examples.php                                27-Sep-2020 11:03                1273
expect.installation.php                            27-Sep-2020 11:03                2256
expect.requirements.php                            27-Sep-2020 11:03                1203
expect.resources.php                               27-Sep-2020 11:03                1289
expect.setup.php                                   27-Sep-2020 11:03                1482
extensions.alphabetical.php                        27-Sep-2020 11:03               23215
extensions.membership.php                          27-Sep-2020 11:03               21010
extensions.php                                     27-Sep-2020 11:03                1536
extensions.state.php                               27-Sep-2020 11:03                3164
fann.configuration.php                             27-Sep-2020 11:03                1124
fann.constants.php                                 27-Sep-2020 11:03               20676
fann.examples-1.php                                27-Sep-2020 11:03                8971
fann.examples.php                                  27-Sep-2020 11:03                1229
fann.installation.php                              27-Sep-2020 11:03                4925
fann.requirements.php                              27-Sep-2020 11:03                1060
fann.resources.php                                 27-Sep-2020 11:03                1028
fann.setup.php                                     27-Sep-2020 11:03                1431
fannconnection.construct.php                       27-Sep-2020 11:03                2728
fannconnection.getfromneuron.php                   27-Sep-2020 11:03                2220
fannconnection.gettoneuron.php                     27-Sep-2020 11:03                2213
fannconnection.getweight.php                       27-Sep-2020 11:03                2184
fannconnection.setweight.php                       27-Sep-2020 11:03                2734
faq.build.php                                      27-Sep-2020 11:03               25471
faq.com.php                                        27-Sep-2020 11:03               11336
faq.databases.php                                  27-Sep-2020 11:03               11473
faq.general.php                                    27-Sep-2020 11:03                4588
faq.html.php                                       27-Sep-2020 11:03               20360
faq.installation.php                               27-Sep-2020 11:03               27680
faq.mailinglist.php                                27-Sep-2020 11:03               10752
faq.misc.php                                       27-Sep-2020 11:03               15642
faq.obtaining.php                                  27-Sep-2020 11:03               10313
faq.passwords.php                                  27-Sep-2020 11:03                9635
faq.php                                            27-Sep-2020 11:03                1846
faq.using.php                                      27-Sep-2020 11:03               32083
fbsql.configuration.php                            27-Sep-2020 11:03                3534
fbsql.constants.php                                27-Sep-2020 11:03                6396
fbsql.installation.php                             27-Sep-2020 11:03                2167
fbsql.requirements.php                             27-Sep-2020 11:03                1270
fbsql.resources.php                                27-Sep-2020 11:03                1075
fbsql.setup.php                                    27-Sep-2020 11:03                1474
fdf.configuration.php                              27-Sep-2020 11:03                1118
fdf.constants.php                                  27-Sep-2020 11:03                8030
fdf.examples.php                                   27-Sep-2020 11:03                6514
fdf.installation.php                               27-Sep-2020 11:03                3336
fdf.requirements.php                               27-Sep-2020 11:03                1398
fdf.resources.php                                  27-Sep-2020 11:03                1589
fdf.setup.php                                      27-Sep-2020 11:03                1440
features.commandline.differences.php               27-Sep-2020 11:02               11929
features.commandline.ini.php                       27-Sep-2020 11:02                2174
features.commandline.interactive.php               27-Sep-2020 11:02                7772
features.commandline.introduction.php              27-Sep-2020 11:02                6428
features.commandline.io-streams.php                27-Sep-2020 11:02                5791
features.commandline.options.php                   27-Sep-2020 11:02               26014
features.commandline.php                           27-Sep-2020 11:02                1914
features.commandline.usage.php                     27-Sep-2020 11:02               14181
features.commandline.webserver.php                 27-Sep-2020 11:02               12904
features.connection-handling.php                   27-Sep-2020 11:02                5262
features.cookies.php                               27-Sep-2020 11:02                3105
features.dtrace.dtrace.php                         27-Sep-2020 11:02               13853
features.dtrace.introduction.php                   27-Sep-2020 11:02                3243
features.dtrace.php                                27-Sep-2020 11:02                1532
features.dtrace.systemtap.php                      27-Sep-2020 11:02                7935
features.file-upload.common-pitfalls.php           27-Sep-2020 11:02                5111
features.file-upload.errors.php                    27-Sep-2020 11:02                3714
features.file-upload.errors.seealso.php            27-Sep-2020 11:02                1224
features.file-upload.multiple.php                  27-Sep-2020 11:02                4728
features.file-upload.php                           27-Sep-2020 11:02                1740
features.file-upload.post-method.php               27-Sep-2020 11:02               15739
features.file-upload.put-method.php                27-Sep-2020 11:02                5845
features.gc.collecting-cycles.php                  27-Sep-2020 11:02                7863
features.gc.performance-considerations.php         27-Sep-2020 11:02               14034
features.gc.php                                    27-Sep-2020 11:02                1631
features.gc.refcounting-basics.php                 27-Sep-2020 11:02               21479
features.http-auth.php                             27-Sep-2020 11:02               25641
features.persistent-connections.php                27-Sep-2020 11:02                8956
features.php                                       27-Sep-2020 11:02                4160
features.remote-files.php                          27-Sep-2020 11:02                8264
features.safe-mode.functions.php                   27-Sep-2020 11:02               16613
features.safe-mode.php                             27-Sep-2020 11:02                2654
features.session.security.management.php           27-Sep-2020 11:03               23127
features.sessions.php                              27-Sep-2020 11:02                1277
features.xforms.php                                27-Sep-2020 11:02                5273
ffi.addr.php                                       27-Sep-2020 11:02                2614
ffi.alignof.php                                    27-Sep-2020 11:02                2521
ffi.arraytype.php                                  27-Sep-2020 11:02                4438
ffi.cast.php                                       27-Sep-2020 11:02                4346
ffi.cdef.php                                       27-Sep-2020 11:02                3439
ffi.configuration.php                              27-Sep-2020 11:02                3985
ffi.constants.php                                  27-Sep-2020 11:02                1011
ffi.examples-basic.php                             27-Sep-2020 11:02               14797
ffi.examples-callback.php                          27-Sep-2020 11:02                4964
ffi.examples-complete.php                          27-Sep-2020 11:02                5744
ffi.examples.php                                   27-Sep-2020 11:02                1388
ffi.free.php                                       27-Sep-2020 11:02                2288
ffi.installation.php                               27-Sep-2020 11:02                1302
ffi.isnull.php                                     27-Sep-2020 11:02                2275
ffi.load.php                                       27-Sep-2020 11:02                3933
ffi.memcmp.php                                     27-Sep-2020 11:02                3622
ffi.memcpy.php                                     27-Sep-2020 11:02                3235
ffi.memset.php                                     27-Sep-2020 11:02                2869
ffi.new.php                                        27-Sep-2020 11:02                4966
ffi.requirements.php                               27-Sep-2020 11:02                1157
ffi.resources.php                                  27-Sep-2020 11:02                1063
ffi.scope.php                                      27-Sep-2020 11:02                2959
ffi.setup.php                                      27-Sep-2020 11:02                1430
ffi.sizeof.php                                     27-Sep-2020 11:02                2425
ffi.string.php                                     27-Sep-2020 11:02                3149
ffi.type.php                                       27-Sep-2020 11:02                3482
ffi.typeof.php                                     27-Sep-2020 11:02                2614
fileinfo.configuration.php                         27-Sep-2020 11:03                1148
fileinfo.constants.php                             27-Sep-2020 11:03                5511
fileinfo.installation.php                          27-Sep-2020 11:03                2375
fileinfo.requirements.php                          27-Sep-2020 11:03                1152
fileinfo.resources.php                             27-Sep-2020 11:03                1246
fileinfo.setup.php                                 27-Sep-2020 11:03                1500
filepro.configuration.php                          27-Sep-2020 11:03                1142
filepro.constants.php                              27-Sep-2020 11:03                1043
filepro.installation.php                           27-Sep-2020 11:03                1665
filepro.requirements.php                           27-Sep-2020 11:03                1089
filepro.resources.php                              27-Sep-2020 11:03                1087
filepro.setup.php                                  27-Sep-2020 11:03                1488
filesystem.configuration.php                       27-Sep-2020 11:03                7128
filesystem.constants.php                           27-Sep-2020 11:03               10793
filesystem.installation.php                        27-Sep-2020 11:03                1143
filesystem.requirements.php                        27-Sep-2020 11:03                1107
filesystem.resources.php                           27-Sep-2020 11:03                1257
filesystem.setup.php                               27-Sep-2020 11:03                1524
filesystemiterator.construct.php                   27-Sep-2020 11:03                5776
filesystemiterator.current.php                     27-Sep-2020 11:03                5120
filesystemiterator.getflags.php                    27-Sep-2020 11:03                3067
filesystemiterator.key.php                         27-Sep-2020 11:03                5182
filesystemiterator.next.php                        27-Sep-2020 11:03                4454
filesystemiterator.rewind.php                      27-Sep-2020 11:03                5071
filesystemiterator.setflags.php                    27-Sep-2020 11:03                6595
filter.configuration.php                           27-Sep-2020 11:03                4932
filter.constants.php                               27-Sep-2020 11:03               20746
filter.examples.php                                27-Sep-2020 11:03                1334
filter.examples.sanitization.php                   27-Sep-2020 11:03                5972
filter.examples.validation.php                     27-Sep-2020 11:03               11019
filter.filters.flags.php                           27-Sep-2020 11:03               11450
filter.filters.misc.php                            27-Sep-2020 11:03                1748
filter.filters.php                                 27-Sep-2020 11:03                1487
filter.filters.sanitize.php                        27-Sep-2020 11:03                8507
filter.filters.validate.php                        27-Sep-2020 11:03                9295
filter.installation.php                            27-Sep-2020 11:03                1342
filter.requirements.php                            27-Sep-2020 11:03                1083
filter.resources.php                               27-Sep-2020 11:03                1075
filter.setup.php                                   27-Sep-2020 11:03                1466
filteriterator.accept.php                          27-Sep-2020 11:03                5442
filteriterator.construct.php                       27-Sep-2020 11:03                3170
filteriterator.current.php                         27-Sep-2020 11:03                2938
filteriterator.getinneriterator.php                27-Sep-2020 11:03                2403
filteriterator.key.php                             27-Sep-2020 11:03                2874
filteriterator.next.php                            27-Sep-2020 11:03                2821
filteriterator.rewind.php                          27-Sep-2020 11:03                3012
filteriterator.valid.php                           27-Sep-2020 11:03                2371
filters.compression.php                            27-Sep-2020 11:03               16969
filters.convert.php                                27-Sep-2020 11:03               11903
filters.encryption.php                             27-Sep-2020 11:03               45968
filters.php                                        27-Sep-2020 11:03                3209
filters.string.php                                 27-Sep-2020 11:03               10468
finfo.buffer.php                                   27-Sep-2020 11:03                2099
finfo.construct.php                                27-Sep-2020 11:03                2085
finfo.file.php                                     27-Sep-2020 11:03                2086
finfo.set-flags.php                                27-Sep-2020 11:03                1842
fpm.setup.php                                      27-Sep-2020 11:03                1157
ftp.configuration.php                              27-Sep-2020 11:03                1118
ftp.constants.php                                  27-Sep-2020 11:03                4649
ftp.examples-basic.php                             27-Sep-2020 11:03                5207
ftp.examples.php                                   27-Sep-2020 11:03                1226
ftp.installation.php                               27-Sep-2020 11:03                1538
ftp.requirements.php                               27-Sep-2020 11:03                1065
ftp.resources.php                                  27-Sep-2020 11:03                1345
ftp.setup.php                                      27-Sep-2020 11:03                1440
funchand.configuration.php                         27-Sep-2020 11:03                1148
funchand.constants.php                             27-Sep-2020 11:03                1069
funchand.installation.php                          27-Sep-2020 11:03                1131
funchand.requirements.php                          27-Sep-2020 11:03                1095
funchand.resources.php                             27-Sep-2020 11:03                1093
funchand.setup.php                                 27-Sep-2020 11:03                1488
funcref.php                                        27-Sep-2020 11:03               14673
function.abs.php                                   27-Sep-2020 11:03                4787
function.acos.php                                  27-Sep-2020 11:03                3260
function.acosh.php                                 27-Sep-2020 11:03                3072
function.addcslashes.php                           27-Sep-2020 11:03                7696
function.addslashes.php                            27-Sep-2020 11:03                7040
function.apache-child-terminate.php                27-Sep-2020 11:03                3541
function.apache-get-modules.php                    27-Sep-2020 11:03                3034
function.apache-get-version.php                    27-Sep-2020 11:03                3402
function.apache-getenv.php                         27-Sep-2020 11:03                4805
function.apache-lookup-uri.php                     27-Sep-2020 11:03                5823
function.apache-note.php                           27-Sep-2020 11:03                6325
function.apache-request-headers.php                27-Sep-2020 11:03                5459
function.apache-reset-timeout.php                  27-Sep-2020 11:03                3326
function.apache-response-headers.php               27-Sep-2020 11:03                3926
function.apache-setenv.php                         27-Sep-2020 11:03                5242
function.apcu-add.php                              27-Sep-2020 11:02                8128
function.apcu-cache-info.php                       27-Sep-2020 11:02                6212
function.apcu-cas.php                              27-Sep-2020 11:02                8764
function.apcu-clear-cache.php                      27-Sep-2020 11:02                2415
function.apcu-dec.php                              27-Sep-2020 11:02                8134
function.apcu-delete.php                           27-Sep-2020 11:02                6034
function.apcu-enabled.php                          27-Sep-2020 11:02                2145
function.apcu-entry.php                            27-Sep-2020 11:02                8681
function.apcu-exists.php                           27-Sep-2020 11:02                7061
function.apcu-fetch.php                            27-Sep-2020 11:02                5461
function.apcu-inc.php                              27-Sep-2020 11:02                8118
function.apcu-sma-info.php                         27-Sep-2020 11:02                4100
function.apcu-store.php                            27-Sep-2020 11:02                6900
function.array-change-key-case.php                 27-Sep-2020 11:03                5219
function.array-chunk.php                           27-Sep-2020 11:03                6335
function.array-column.php                          27-Sep-2020 11:03               18096
function.array-combine.php                         27-Sep-2020 11:03                6240
function.array-count-values.php                    27-Sep-2020 11:03                5472
function.array-diff-assoc.php                      27-Sep-2020 11:03               10630
function.array-diff-key.php                        27-Sep-2020 11:03               12649
function.array-diff-uassoc.php                     27-Sep-2020 11:03               11967
function.array-diff-ukey.php                       27-Sep-2020 11:03               12288
function.array-diff.php                            27-Sep-2020 11:03               12228
function.array-fill-keys.php                       27-Sep-2020 11:03                5189
function.array-fill.php                            27-Sep-2020 11:03                7319
function.array-filter.php                          27-Sep-2020 11:03               16411
function.array-flip.php                            27-Sep-2020 11:03                7164
function.array-intersect-assoc.php                 27-Sep-2020 11:03                8433
function.array-intersect-key.php                   27-Sep-2020 11:03                9841
function.array-intersect-uassoc.php                27-Sep-2020 11:03                8700
function.array-intersect-ukey.php                  27-Sep-2020 11:03               11996
function.array-intersect.php                       27-Sep-2020 11:03                6511
function.array-key-exists.php                      27-Sep-2020 11:03                8552
function.array-key-first.php                       27-Sep-2020 11:03                7039
function.array-key-last.php                        27-Sep-2020 11:03                2975
function.array-keys.php                            27-Sep-2020 11:03                8240
function.array-map.php                             27-Sep-2020 11:03               22757
function.array-merge-recursive.php                 27-Sep-2020 11:03                6775
function.array-merge.php                           27-Sep-2020 11:03               12601
function.array-multisort.php                       27-Sep-2020 11:03               23071
function.array-pad.php                             27-Sep-2020 11:03                6883
function.array-pop.php                             27-Sep-2020 11:03                5882
function.array-product.php                         27-Sep-2020 11:03                4199
function.array-push.php                            27-Sep-2020 11:03                6880
function.array-rand.php                            27-Sep-2020 11:03                6335
function.array-reduce.php                          27-Sep-2020 11:03                9599
function.array-replace-recursive.php               27-Sep-2020 11:03               11269
function.array-replace.php                         27-Sep-2020 11:03                6734
function.array-reverse.php                         27-Sep-2020 11:03                5833
function.array-search.php                          27-Sep-2020 11:03                7990
function.array-shift.php                           27-Sep-2020 11:03                5615
function.array-slice.php                           27-Sep-2020 11:03               13523
function.array-splice.php                          27-Sep-2020 11:03               17038
function.array-sum.php                             27-Sep-2020 11:03                4909
function.array-udiff-assoc.php                     27-Sep-2020 11:03               14630
function.array-udiff-uassoc.php                    27-Sep-2020 11:03               16164
function.array-udiff.php                           27-Sep-2020 11:03               29338
function.array-uintersect-assoc.php                27-Sep-2020 11:03                8023
function.array-uintersect-uassoc.php               27-Sep-2020 11:03                8278
function.array-uintersect.php                      27-Sep-2020 11:03                7630
function.array-unique.php                          27-Sep-2020 11:03                9149
function.array-unshift.php                         27-Sep-2020 11:03                5832
function.array-values.php                          27-Sep-2020 11:03                4376
function.array-walk-recursive.php                  27-Sep-2020 11:03                7438
function.array-walk.php                            27-Sep-2020 11:03               11466
function.array.php                                 27-Sep-2020 11:03               11757
function.arsort.php                                27-Sep-2020 11:03                6088
function.asin.php                                  27-Sep-2020 11:03                3256
function.asinh.php                                 27-Sep-2020 11:03                3068
function.asort.php                                 27-Sep-2020 11:03                6050
function.assert-options.php                        27-Sep-2020 11:02               11616
function.assert.php                                27-Sep-2020 11:02               24995
function.atan.php                                  27-Sep-2020 11:03                3269
function.atan2.php                                 27-Sep-2020 11:03                3166
function.atanh.php                                 27-Sep-2020 11:03                3093
function.autoload.php                              27-Sep-2020 11:03                2952
function.base-convert.php                          27-Sep-2020 11:03                6231
function.base64-decode.php                         27-Sep-2020 11:03                4565
function.base64-encode.php                         27-Sep-2020 11:03                4472
function.basename.php                              27-Sep-2020 11:03                7037
function.bcadd.php                                 27-Sep-2020 11:03                5003
function.bccomp.php                                27-Sep-2020 11:03                4946
function.bcdiv.php                                 27-Sep-2020 11:03                4457
function.bcmod.php                                 27-Sep-2020 11:03                6975
function.bcmul.php                                 27-Sep-2020 11:03                6709
function.bcpow.php                                 27-Sep-2020 11:03                6786
function.bcpowmod.php                              27-Sep-2020 11:03                6283
function.bcscale.php                               27-Sep-2020 11:03                4930
function.bcsqrt.php                                27-Sep-2020 11:03                4062
function.bcsub.php                                 27-Sep-2020 11:03                5009
function.bin2hex.php                               27-Sep-2020 11:03                2850
function.bind-textdomain-codeset.php               27-Sep-2020 11:03                2982
function.bindec.php                                27-Sep-2020 11:03               15668
function.bindtextdomain.php                        27-Sep-2020 11:03                3794
function.blenc-encrypt.php                         27-Sep-2020 11:02                5464
function.boolval.php                               27-Sep-2020 11:03               10717
function.bson-decode.php                           27-Sep-2020 11:03                2369
function.bson-encode.php                           27-Sep-2020 11:03                2455
function.bzclose.php                               27-Sep-2020 11:02                2722
function.bzcompress.php                            27-Sep-2020 11:02                4858
function.bzdecompress.php                          27-Sep-2020 11:02                5340
function.bzerrno.php                               27-Sep-2020 11:02                2919
function.bzerror.php                               27-Sep-2020 11:02                4169
function.bzerrstr.php                              27-Sep-2020 11:02                2924
function.bzflush.php                               27-Sep-2020 11:02                2963
function.bzopen.php                                27-Sep-2020 11:02                4653
function.bzread.php                                27-Sep-2020 11:02                6187
function.bzwrite.php                               27-Sep-2020 11:02                5224
function.cal-days-in-month.php                     27-Sep-2020 11:03                4365
function.cal-from-jd.php                           27-Sep-2020 11:03                6580
function.cal-info.php                              27-Sep-2020 11:03                5581
function.cal-to-jd.php                             27-Sep-2020 11:03                5184
function.call-user-func-array.php                  27-Sep-2020 11:03               15092
function.call-user-func.php                        27-Sep-2020 11:03               14451
function.call-user-method-array.php                27-Sep-2020 11:03                4875
function.call-user-method.php                      27-Sep-2020 11:03                4928
function.ceil.php                                  27-Sep-2020 11:03                4433
function.chdir.php                                 27-Sep-2020 11:03                5485
function.checkdate.php                             27-Sep-2020 11:03                5131
function.checkdnsrr.php                            27-Sep-2020 11:03                4750
function.chgrp.php                                 27-Sep-2020 11:03                6683
function.chmod.php                                 27-Sep-2020 11:03                8784
function.chop.php                                  27-Sep-2020 11:03                1904
function.chown.php                                 27-Sep-2020 11:03                6749
function.chr.php                                   27-Sep-2020 11:03                8100
function.chroot.php                                27-Sep-2020 11:03                4133
function.chunk-split.php                           27-Sep-2020 11:03                5123
function.class-alias.php                           27-Sep-2020 11:03                7192
function.class-exists.php                          27-Sep-2020 11:03                6989
function.class-implements.php                      27-Sep-2020 11:03                6460
function.class-parents.php                         27-Sep-2020 11:03                6134
function.class-uses.php                            27-Sep-2020 11:03                6214
function.classkit-import.php                       27-Sep-2020 11:03                6412
function.classkit-method-add.php                   27-Sep-2020 11:03                8250
function.classkit-method-copy.php                  27-Sep-2020 11:03                6997
function.classkit-method-redefine.php              27-Sep-2020 11:03                8691
function.classkit-method-remove.php                27-Sep-2020 11:03                6533
function.classkit-method-rename.php                27-Sep-2020 11:03                6497
function.clearstatcache.php                        27-Sep-2020 11:03               10517
function.cli-get-process-title.php                 27-Sep-2020 11:02                4161
function.cli-set-process-title.php                 27-Sep-2020 11:02                5623
function.closedir.php                              27-Sep-2020 11:03                4488
function.closelog.php                              27-Sep-2020 11:03                2583
function.com-create-guid.php                       27-Sep-2020 11:03                2308
function.com-event-sink.php                        27-Sep-2020 11:03                9290
function.com-get-active-object.php                 27-Sep-2020 11:03                4698
function.com-load-typelib.php                      27-Sep-2020 11:03                4717
function.com-message-pump.php                      27-Sep-2020 11:03                3637
function.com-print-typeinfo.php                    27-Sep-2020 11:03                4336
function.commonmark-parse.php                      27-Sep-2020 11:03                3662
function.commonmark-render-html.php                27-Sep-2020 11:03                4138
function.commonmark-render-latex.php               27-Sep-2020 11:03                4382
function.commonmark-render-man.php                 27-Sep-2020 11:03                4366
function.commonmark-render-xml.php                 27-Sep-2020 11:03                4096
function.commonmark-render.php                     27-Sep-2020 11:03                4316
function.compact.php                               27-Sep-2020 11:03                7417
function.connection-aborted.php                    27-Sep-2020 11:03                2678
function.connection-status.php                     27-Sep-2020 11:03                2793
function.constant.php                              27-Sep-2020 11:03                6470
function.convert-cyr-string.php                    27-Sep-2020 11:03                4397
function.convert-uudecode.php                      27-Sep-2020 11:03                4051
function.convert-uuencode.php                      27-Sep-2020 11:03                4617
function.copy.php                                  27-Sep-2020 11:03                5481
function.cos.php                                   27-Sep-2020 11:03                3811
function.cosh.php                                  27-Sep-2020 11:03                3012
function.count-chars.php                           27-Sep-2020 11:03                6703
function.count.php                                 27-Sep-2020 11:03               11614
function.crc32.php                                 27-Sep-2020 11:03                6815
function.create-function.php                       27-Sep-2020 11:03               18297
function.crypt.php                                 27-Sep-2020 11:03               19784
function.ctype-alnum.php                           27-Sep-2020 11:03                6054
function.ctype-alpha.php                           27-Sep-2020 11:03                6391
function.ctype-cntrl.php                           27-Sep-2020 11:03                6051
function.ctype-digit.php                           27-Sep-2020 11:03                9041
function.ctype-graph.php                           27-Sep-2020 11:03                6790
function.ctype-lower.php                           27-Sep-2020 11:03                6162
function.ctype-print.php                           27-Sep-2020 11:03                6836
function.ctype-punct.php                           27-Sep-2020 11:03                6083
function.ctype-space.php                           27-Sep-2020 11:03                6940
function.ctype-upper.php                           27-Sep-2020 11:03                6172
function.ctype-xdigit.php                          27-Sep-2020 11:03                5952
function.cubrid-affected-rows.php                  27-Sep-2020 11:03                9149
function.cubrid-bind.php                           27-Sep-2020 11:03               21128
function.cubrid-client-encoding.php                27-Sep-2020 11:03                5015
function.cubrid-close-prepare.php                  27-Sep-2020 11:03                6578
function.cubrid-close-request.php                  27-Sep-2020 11:03                6589
function.cubrid-close.php                          27-Sep-2020 11:03                6382
function.cubrid-col-get.php                        27-Sep-2020 11:03                8387
function.cubrid-col-size.php                       27-Sep-2020 11:03                8538
function.cubrid-column-names.php                   27-Sep-2020 11:03                8567
function.cubrid-column-types.php                   27-Sep-2020 11:03                8548
function.cubrid-commit.php                         27-Sep-2020 11:03               16119
function.cubrid-connect-with-url.php               27-Sep-2020 11:03               15259
function.cubrid-connect.php                        27-Sep-2020 11:03               11859
function.cubrid-current-oid.php                    27-Sep-2020 11:03                5778
function.cubrid-data-seek.php                      27-Sep-2020 11:03                7147
function.cubrid-db-name.php                        27-Sep-2020 11:03                6297
function.cubrid-disconnect.php                     27-Sep-2020 11:03                7369
function.cubrid-drop.php                           27-Sep-2020 11:03               11499
function.cubrid-errno.php                          27-Sep-2020 11:03                6806
function.cubrid-error-code-facility.php            27-Sep-2020 11:03                5766
function.cubrid-error-code.php                     27-Sep-2020 11:03                5819
function.cubrid-error-msg.php                      27-Sep-2020 11:03                5218
function.cubrid-error.php                          27-Sep-2020 11:03                6364
function.cubrid-execute.php                        27-Sep-2020 11:03               13980
function.cubrid-fetch-array.php                    27-Sep-2020 11:03                9837
function.cubrid-fetch-assoc.php                    27-Sep-2020 11:03                9008
function.cubrid-fetch-field.php                    27-Sep-2020 11:03               14093
function.cubrid-fetch-lengths.php                  27-Sep-2020 11:03                5914
function.cubrid-fetch-object.php                   27-Sep-2020 11:03               11978
function.cubrid-fetch-row.php                      27-Sep-2020 11:03                8894
function.cubrid-fetch.php                          27-Sep-2020 11:03               10099
function.cubrid-field-flags.php                    27-Sep-2020 11:03                7585
function.cubrid-field-len.php                      27-Sep-2020 11:03                8168
function.cubrid-field-name.php                     27-Sep-2020 11:03                7001
function.cubrid-field-seek.php                     27-Sep-2020 11:03               10743
function.cubrid-field-table.php                    27-Sep-2020 11:03                7223
function.cubrid-field-type.php                     27-Sep-2020 11:03                7287
function.cubrid-free-result.php                    27-Sep-2020 11:03                5508
function.cubrid-get-autocommit.php                 27-Sep-2020 11:03                3437
function.cubrid-get-charset.php                    27-Sep-2020 11:03                4794
function.cubrid-get-class-name.php                 27-Sep-2020 11:03                6113
function.cubrid-get-client-info.php                27-Sep-2020 11:03                8196
function.cubrid-get-db-parameter.php               27-Sep-2020 11:03               14255
function.cubrid-get-query-timeout.php              27-Sep-2020 11:03                6472
function.cubrid-get-server-info.php                27-Sep-2020 11:03                8394
function.cubrid-get.php                            27-Sep-2020 11:03                9870
function.cubrid-insert-id.php                      27-Sep-2020 11:03                6954
function.cubrid-is-instance.php                    27-Sep-2020 11:03                7246
function.cubrid-list-dbs.php                       27-Sep-2020 11:03                4234
function.cubrid-load-from-glo.php                  27-Sep-2020 11:03                6702
function.cubrid-lob-close.php                      27-Sep-2020 11:03                7104
function.cubrid-lob-export.php                     27-Sep-2020 11:03                7665
function.cubrid-lob-get.php                        27-Sep-2020 11:03                7568
function.cubrid-lob-send.php                       27-Sep-2020 11:03                6867
function.cubrid-lob-size.php                       27-Sep-2020 11:03                5697
function.cubrid-lob2-bind.php                      27-Sep-2020 11:03                9448
function.cubrid-lob2-close.php                     27-Sep-2020 11:03                3091
function.cubrid-lob2-export.php                    27-Sep-2020 11:03                8576
function.cubrid-lob2-import.php                    27-Sep-2020 11:03                8440
function.cubrid-lob2-new.php                       27-Sep-2020 11:03                3584
function.cubrid-lob2-read.php                      27-Sep-2020 11:03               14365
function.cubrid-lob2-seek.php                      27-Sep-2020 11:03               11048
function.cubrid-lob2-seek64.php                    27-Sep-2020 11:03               12584
function.cubrid-lob2-size.php                      27-Sep-2020 11:03                4142
function.cubrid-lob2-size64.php                    27-Sep-2020 11:03                4318
function.cubrid-lob2-tell.php                      27-Sep-2020 11:03                4162
function.cubrid-lob2-tell64.php                    27-Sep-2020 11:03                4356
function.cubrid-lob2-write.php                     27-Sep-2020 11:03               14228
function.cubrid-lock-read.php                      27-Sep-2020 11:03                9078
function.cubrid-lock-write.php                     27-Sep-2020 11:03                9495
function.cubrid-move-cursor.php                    27-Sep-2020 11:03                8986
function.cubrid-new-glo.php                        27-Sep-2020 11:03                6863
function.cubrid-next-result.php                    27-Sep-2020 11:03               17105
function.cubrid-num-cols.php                       27-Sep-2020 11:03                5770
function.cubrid-num-fields.php                     27-Sep-2020 11:03                5482
function.cubrid-num-rows.php                       27-Sep-2020 11:03                6960
function.cubrid-pconnect-with-url.php              27-Sep-2020 11:03               14767
function.cubrid-pconnect.php                       27-Sep-2020 11:03               11766
function.cubrid-ping.php                           27-Sep-2020 11:03                6122
function.cubrid-prepare.php                        27-Sep-2020 11:03               10229
function.cubrid-put.php                            27-Sep-2020 11:03               11238
function.cubrid-query.php                          27-Sep-2020 11:03               15240
function.cubrid-real-escape-string.php             27-Sep-2020 11:03                7968
function.cubrid-result.php                         27-Sep-2020 11:03                7202
function.cubrid-rollback.php                       27-Sep-2020 11:03               15400
function.cubrid-save-to-glo.php                    27-Sep-2020 11:03                6617
function.cubrid-schema.php                         27-Sep-2020 11:03               19939
function.cubrid-send-glo.php                       27-Sep-2020 11:03                6047
function.cubrid-seq-drop.php                       27-Sep-2020 11:03                9497
function.cubrid-seq-insert.php                     27-Sep-2020 11:03                9929
function.cubrid-seq-put.php                        27-Sep-2020 11:03                9859
function.cubrid-set-add.php                        27-Sep-2020 11:03                9252
function.cubrid-set-autocommit.php                 27-Sep-2020 11:03                3880
function.cubrid-set-db-parameter.php               27-Sep-2020 11:03                7838
function.cubrid-set-drop.php                       27-Sep-2020 11:03                9228
function.cubrid-set-query-timeout.php              27-Sep-2020 11:03                3219
function.cubrid-unbuffered-query.php               27-Sep-2020 11:03                6977
function.cubrid-version.php                        27-Sep-2020 11:03                8812
function.curl-close.php                            27-Sep-2020 11:03                5085
function.curl-copy-handle.php                      27-Sep-2020 11:03                5032
function.curl-errno.php                            27-Sep-2020 11:03                5246
function.curl-error.php                            27-Sep-2020 11:03                5200
function.curl-escape.php                           27-Sep-2020 11:03                6566
function.curl-exec.php                             27-Sep-2020 11:03                6215
function.curl-file-create.php                      27-Sep-2020 11:03                1533
function.curl-getinfo.php                          27-Sep-2020 11:03               28510
function.curl-init.php                             27-Sep-2020 11:03                5952
function.curl-multi-add-handle.php                 27-Sep-2020 11:03                9126
function.curl-multi-close.php                      27-Sep-2020 11:03                8745
function.curl-multi-errno.php                      27-Sep-2020 11:03                2751
function.curl-multi-exec.php                       27-Sep-2020 11:03                9591
function.curl-multi-getcontent.php                 27-Sep-2020 11:03                3039
function.curl-multi-info-read.php                  27-Sep-2020 11:03               11235
function.curl-multi-init.php                       27-Sep-2020 11:03                8220
function.curl-multi-remove-handle.php              27-Sep-2020 11:03                4002
function.curl-multi-select.php                     27-Sep-2020 11:03                3327
function.curl-multi-setopt.php                     27-Sep-2020 11:03                9891
function.curl-multi-strerror.php                   27-Sep-2020 11:03                7062
function.curl-pause.php                            27-Sep-2020 11:03                2697
function.curl-reset.php                            27-Sep-2020 11:03                5648
function.curl-setopt-array.php                     27-Sep-2020 11:03                9119
function.curl-setopt.php                           27-Sep-2020 11:03              126595
function.curl-share-close.php                      27-Sep-2020 11:03                7154
function.curl-share-errno.php                      27-Sep-2020 11:03                2788
function.curl-share-init.php                       27-Sep-2020 11:03                7024
function.curl-share-setopt.php                     27-Sep-2020 11:03                9393
function.curl-share-strerror.php                   27-Sep-2020 11:03                3018
function.curl-strerror.php                         27-Sep-2020 11:03                6013
function.curl-unescape.php                         27-Sep-2020 11:03                6958
function.curl-version.php                          27-Sep-2020 11:03                6657
function.current.php                               27-Sep-2020 11:03               10157
function.date-add.php                              27-Sep-2020 11:03                1588
function.date-create-from-format.php               27-Sep-2020 11:03                1748
function.date-create-immutable-from-format.php     27-Sep-2020 11:03                1850
function.date-create-immutable.php                 27-Sep-2020 11:03                1754
function.date-create.php                           27-Sep-2020 11:03                1638
function.date-date-set.php                         27-Sep-2020 11:03                1642
function.date-default-timezone-get.php             27-Sep-2020 11:03                7538
function.date-default-timezone-set.php             27-Sep-2020 11:03                5877
function.date-diff.php                             27-Sep-2020 11:03                1606
function.date-format.php                           27-Sep-2020 11:03                1612
function.date-get-last-errors.php                  27-Sep-2020 11:03                1732
function.date-interval-create-from-date-string.php 27-Sep-2020 11:03                1862
function.date-interval-format.php                  27-Sep-2020 11:03                1730
function.date-isodate-set.php                      27-Sep-2020 11:03                1662
function.date-modify.php                           27-Sep-2020 11:03                1616
function.date-offset-get.php                       27-Sep-2020 11:03                1656
function.date-parse-from-format.php                27-Sep-2020 11:03                5682
function.date-parse.php                            27-Sep-2020 11:03                6745
function.date-sub.php                              27-Sep-2020 11:03                1570
function.date-sun-info.php                         27-Sep-2020 11:03               11176
function.date-sunrise.php                          27-Sep-2020 11:03               11652
function.date-sunset.php                           27-Sep-2020 11:03               11638
function.date-time-set.php                         27-Sep-2020 11:03                1628
function.date-timestamp-get.php                    27-Sep-2020 11:03                1682
function.date-timestamp-set.php                    27-Sep-2020 11:03                1690
function.date-timezone-get.php                     27-Sep-2020 11:03                1680
function.date-timezone-set.php                     27-Sep-2020 11:03                1652
function.date.php                                  27-Sep-2020 11:03               21562
function.db2-autocommit.php                        27-Sep-2020 11:03               10768
function.db2-bind-param.php                        27-Sep-2020 11:03               22375
function.db2-client-info.php                       27-Sep-2020 11:03               12048
function.db2-close.php                             27-Sep-2020 11:03                5394
function.db2-column-privileges.php                 27-Sep-2020 11:03                7562
function.db2-columns.php                           27-Sep-2020 11:03                9468
function.db2-commit.php                            27-Sep-2020 11:03                3394
function.db2-conn-error.php                        27-Sep-2020 11:03                6516
function.db2-conn-errormsg.php                     27-Sep-2020 11:03                6285
function.db2-connect.php                           27-Sep-2020 11:03               40308
function.db2-cursor-type.php                       27-Sep-2020 11:03                2964
function.db2-escape-string.php                     27-Sep-2020 11:03                7869
function.db2-exec.php                              27-Sep-2020 11:03               28628
function.db2-execute.php                           27-Sep-2020 11:03               27519
function.db2-fetch-array.php                       27-Sep-2020 11:03               11293
function.db2-fetch-assoc.php                       27-Sep-2020 11:03               11309
function.db2-fetch-both.php                        27-Sep-2020 11:03               11843
function.db2-fetch-object.php                      27-Sep-2020 11:03                8926
function.db2-fetch-row.php                         27-Sep-2020 11:03               16554
function.db2-field-display-size.php                27-Sep-2020 11:03                4695
function.db2-field-name.php                        27-Sep-2020 11:03                4589
function.db2-field-num.php                         27-Sep-2020 11:03                4600
function.db2-field-precision.php                   27-Sep-2020 11:03                4626
function.db2-field-scale.php                       27-Sep-2020 11:03                4592
function.db2-field-type.php                        27-Sep-2020 11:03                4594
function.db2-field-width.php                       27-Sep-2020 11:03                4800
function.db2-foreign-keys.php                      27-Sep-2020 11:03                8347
function.db2-free-result.php                       27-Sep-2020 11:03                3032
function.db2-free-stmt.php                         27-Sep-2020 11:03                3022
function.db2-get-option.php                        27-Sep-2020 11:03               24740
function.db2-last-insert-id.php                    27-Sep-2020 11:03                8455
function.db2-lob-read.php                          27-Sep-2020 11:03               17654
function.db2-next-result.php                       27-Sep-2020 11:03                8878
function.db2-num-fields.php                        27-Sep-2020 11:03                6971
function.db2-num-rows.php                          27-Sep-2020 11:03                4221
function.db2-pclose.php                            27-Sep-2020 11:03                5575
function.db2-pconnect.php                          27-Sep-2020 11:03               32271
function.db2-prepare.php                           27-Sep-2020 11:03               10464
function.db2-primary-keys.php                      27-Sep-2020 11:03                6981
function.db2-procedure-columns.php                 27-Sep-2020 11:03               11008
function.db2-procedures.php                        27-Sep-2020 11:03                7421
function.db2-result.php                            27-Sep-2020 11:03                7759
function.db2-rollback.php                          27-Sep-2020 11:03                9693
function.db2-server-info.php                       27-Sep-2020 11:03               24179
function.db2-set-option.php                        27-Sep-2020 11:03               70463
function.db2-special-columns.php                   27-Sep-2020 11:03                9540
function.db2-statistics.php                        27-Sep-2020 11:03               11682
function.db2-stmt-error.php                        27-Sep-2020 11:03                4188
function.db2-stmt-errormsg.php                     27-Sep-2020 11:03                3816
function.db2-table-privileges.php                  27-Sep-2020 11:03                7401
function.db2-tables.php                            27-Sep-2020 11:03                7381
function.dba-close.php                             27-Sep-2020 11:03                3006
function.dba-delete.php                            27-Sep-2020 11:03                3663
function.dba-exists.php                            27-Sep-2020 11:03                3708
function.dba-fetch.php                             27-Sep-2020 11:03                5159
function.dba-firstkey.php                          27-Sep-2020 11:03                3272
function.dba-handlers.php                          27-Sep-2020 11:03                5288
function.dba-insert.php                            27-Sep-2020 11:03                4249
function.dba-key-split.php                         27-Sep-2020 11:03                3434
function.dba-list.php                              27-Sep-2020 11:03                1901
function.dba-nextkey.php                           27-Sep-2020 11:03                3195
function.dba-open.php                              27-Sep-2020 11:03               11029
function.dba-optimize.php                          27-Sep-2020 11:03                2868
function.dba-popen.php                             27-Sep-2020 11:03                4262
function.dba-replace.php                           27-Sep-2020 11:03                4079
function.dba-sync.php                              27-Sep-2020 11:03                2889
function.dbase-add-record.php                      27-Sep-2020 11:03                6819
function.dbase-close.php                           27-Sep-2020 11:03                5056
function.dbase-create.php                          27-Sep-2020 11:03                8342
function.dbase-delete-record.php                   27-Sep-2020 11:03                4646
function.dbase-get-header-info.php                 27-Sep-2020 11:03                6911
function.dbase-get-record-with-names.php           27-Sep-2020 11:03                8718
function.dbase-get-record.php                      27-Sep-2020 11:03                5339
function.dbase-numfields.php                       27-Sep-2020 11:03                5804
function.dbase-numrecords.php                      27-Sep-2020 11:03                7109
function.dbase-open.php                            27-Sep-2020 11:03                6484
function.dbase-pack.php                            27-Sep-2020 11:03                6227
function.dbase-replace-record.php                  27-Sep-2020 11:03                9441
function.dbplus-add.php                            27-Sep-2020 11:03                3665
function.dbplus-aql.php                            27-Sep-2020 11:03                3678
function.dbplus-chdir.php                          27-Sep-2020 11:03                2943
function.dbplus-close.php                          27-Sep-2020 11:03                3034
function.dbplus-curr.php                           27-Sep-2020 11:03                4360
function.dbplus-errcode.php                        27-Sep-2020 11:03                2794
function.dbplus-errno.php                          27-Sep-2020 11:03                2703
function.dbplus-find.php                           27-Sep-2020 11:03                4734
function.dbplus-first.php                          27-Sep-2020 11:03                4358
function.dbplus-flush.php                          27-Sep-2020 11:03                3321
function.dbplus-freealllocks.php                   27-Sep-2020 11:03                3081
function.dbplus-freelock.php                       27-Sep-2020 11:03                3957
function.dbplus-freerlocks.php                     27-Sep-2020 11:03                3608
function.dbplus-getlock.php                        27-Sep-2020 11:03                3944
function.dbplus-getunique.php                      27-Sep-2020 11:03                3280
function.dbplus-info.php                           27-Sep-2020 11:03                3139
function.dbplus-last.php                           27-Sep-2020 11:03                4146
function.dbplus-lockrel.php                        27-Sep-2020 11:03                2916
function.dbplus-next.php                           27-Sep-2020 11:03                4151
function.dbplus-open.php                           27-Sep-2020 11:03                3096
function.dbplus-prev.php                           27-Sep-2020 11:03                4155
function.dbplus-rchperm.php                        27-Sep-2020 11:03                3619
function.dbplus-rcreate.php                        27-Sep-2020 11:03                4218
function.dbplus-rcrtexact.php                      27-Sep-2020 11:03                3883
function.dbplus-rcrtlike.php                       27-Sep-2020 11:03                3928
function.dbplus-resolve.php                        27-Sep-2020 11:03                3471
function.dbplus-restorepos.php                     27-Sep-2020 11:03                3103
function.dbplus-rkeys.php                          27-Sep-2020 11:03                3567
function.dbplus-ropen.php                          27-Sep-2020 11:03                3037
function.dbplus-rquery.php                         27-Sep-2020 11:03                3197
function.dbplus-rrename.php                        27-Sep-2020 11:03                3119
function.dbplus-rsecindex.php                      27-Sep-2020 11:03                3883
function.dbplus-runlink.php                        27-Sep-2020 11:03                2865
function.dbplus-rzap.php                           27-Sep-2020 11:03                2836
function.dbplus-savepos.php                        27-Sep-2020 11:03                2842
function.dbplus-setindex.php                       27-Sep-2020 11:03                3105
function.dbplus-setindexbynumber.php               27-Sep-2020 11:03                3172
function.dbplus-sql.php                            27-Sep-2020 11:03                3154
function.dbplus-tcl.php                            27-Sep-2020 11:03                3914
function.dbplus-tremove.php                        27-Sep-2020 11:03                3600
function.dbplus-undo.php                           27-Sep-2020 11:03                2815
function.dbplus-undoprepare.php                    27-Sep-2020 11:03                2883
function.dbplus-unlockrel.php                      27-Sep-2020 11:03                2916
function.dbplus-unselect.php                       27-Sep-2020 11:03                3013
function.dbplus-update.php                         27-Sep-2020 11:03                3533
function.dbplus-xlockrel.php                       27-Sep-2020 11:03                3248
function.dbplus-xunlockrel.php                     27-Sep-2020 11:03                2905
function.dbx-close.php                             27-Sep-2020 11:03                4327
function.dbx-compare.php                           27-Sep-2020 11:03                9389
function.dbx-connect.php                           27-Sep-2020 11:03               10451
function.dbx-error.php                             27-Sep-2020 11:03                5615
function.dbx-escape-string.php                     27-Sep-2020 11:03                6038
function.dbx-fetch-row.php                         27-Sep-2020 11:03                6307
function.dbx-query.php                             27-Sep-2020 11:03               22749
function.dbx-sort.php                              27-Sep-2020 11:03                8008
function.dcgettext.php                             27-Sep-2020 11:03                3184
function.dcngettext.php                            27-Sep-2020 11:03                3581
function.debug-backtrace.php                       27-Sep-2020 11:02                9742
function.debug-print-backtrace.php                 27-Sep-2020 11:02                6351
function.debug-zval-dump.php                       27-Sep-2020 11:03                9625
function.decbin.php                                27-Sep-2020 11:03                8549
function.dechex.php                                27-Sep-2020 11:03                7060
function.decoct.php                                27-Sep-2020 11:03                4631
function.define-syslog-variables.php               27-Sep-2020 11:03               12059
function.define.php                                27-Sep-2020 11:03               11006
function.defined.php                               27-Sep-2020 11:03                5069
function.deflate-add.php                           27-Sep-2020 11:02                4142
function.deflate-init.php                          27-Sep-2020 11:02                5924
function.deg2rad.php                               27-Sep-2020 11:03                3845
function.delete.php                                27-Sep-2020 11:03                2287
function.dgettext.php                              27-Sep-2020 11:03                2987
function.die.php                                   27-Sep-2020 11:03                1440
function.dio-close.php                             27-Sep-2020 11:03                3814
function.dio-fcntl.php                             27-Sep-2020 11:03                8725
function.dio-open.php                              27-Sep-2020 11:03                7407
function.dio-read.php                              27-Sep-2020 11:03                3241
function.dio-seek.php                              27-Sep-2020 11:03                7308
function.dio-stat.php                              27-Sep-2020 11:03                3997
function.dio-tcsetattr.php                         27-Sep-2020 11:03                6842
function.dio-truncate.php                          27-Sep-2020 11:03                3337
function.dio-write.php                             27-Sep-2020 11:03                3514
function.dir.php                                   27-Sep-2020 11:03                6316
function.dirname.php                               27-Sep-2020 11:03                7386
function.disk-free-space.php                       27-Sep-2020 11:03                5146
function.disk-total-space.php                      27-Sep-2020 11:03                4865
function.diskfreespace.php                         27-Sep-2020 11:03                1625
function.dl.php                                    27-Sep-2020 11:02               10135
function.dngettext.php                             27-Sep-2020 11:03                3423
function.dns-check-record.php                      27-Sep-2020 11:03                1627
function.dns-get-mx.php                            27-Sep-2020 11:03                1573
function.dns-get-record.php                        27-Sep-2020 11:03               22177
function.dom-import-simplexml.php                  27-Sep-2020 11:03                6482
function.doubleval.php                             27-Sep-2020 11:03                1561
function.each.php                                  27-Sep-2020 11:03               11228
function.easter-date.php                           27-Sep-2020 11:03               10852
function.easter-days.php                           27-Sep-2020 11:03                6222
function.echo.php                                  27-Sep-2020 11:03               11690
function.eio-busy.php                              27-Sep-2020 11:03                4187
function.eio-cancel.php                            27-Sep-2020 11:03                7190
function.eio-chmod.php                             27-Sep-2020 11:03                5380
function.eio-chown.php                             27-Sep-2020 11:03                5506
function.eio-close.php                             27-Sep-2020 11:03                4970
function.eio-custom.php                            27-Sep-2020 11:03               10045
function.eio-dup2.php                              27-Sep-2020 11:03                5014
function.eio-event-loop.php                        27-Sep-2020 11:03                5743
function.eio-fallocate.php                         27-Sep-2020 11:03                6423
function.eio-fchmod.php                            27-Sep-2020 11:03                5419
function.eio-fchown.php                            27-Sep-2020 11:03                5302
function.eio-fdatasync.php                         27-Sep-2020 11:03                4869
function.eio-fstat.php                             27-Sep-2020 11:03               11268
function.eio-fstatvfs.php                          27-Sep-2020 11:03                4968
function.eio-fsync.php                             27-Sep-2020 11:03                4986
function.eio-ftruncate.php                         27-Sep-2020 11:03                5436
function.eio-futime.php                            27-Sep-2020 11:03                5667
function.eio-get-event-stream.php                  27-Sep-2020 11:03                8409
function.eio-get-last-error.php                    27-Sep-2020 11:03                2889
function.eio-grp-add.php                           27-Sep-2020 11:03               12077
function.eio-grp-cancel.php                        27-Sep-2020 11:03                2939
function.eio-grp-limit.php                         27-Sep-2020 11:03                2789
function.eio-grp.php                               27-Sep-2020 11:03               12036
function.eio-init.php                              27-Sep-2020 11:03                3068
function.eio-link.php                              27-Sep-2020 11:03               12279
function.eio-lstat.php                             27-Sep-2020 11:03                9364
function.eio-mkdir.php                             27-Sep-2020 11:03                8661
function.eio-mknod.php                             27-Sep-2020 11:03               10532
function.eio-nop.php                               27-Sep-2020 11:03                4728
function.eio-npending.php                          27-Sep-2020 11:03                2893
function.eio-nready.php                            27-Sep-2020 11:03                2643
function.eio-nreqs.php                             27-Sep-2020 11:03                5514
function.eio-nthreads.php                          27-Sep-2020 11:03                3360
function.eio-open.php                              27-Sep-2020 11:03               11231
function.eio-poll.php                              27-Sep-2020 11:03                5674
function.eio-read.php                              27-Sep-2020 11:03               12527
function.eio-readahead.php                         27-Sep-2020 11:03                5384
function.eio-readdir.php                           27-Sep-2020 11:03               16696
function.eio-readlink.php                          27-Sep-2020 11:03               11893
function.eio-realpath.php                          27-Sep-2020 11:03                4922
function.eio-rename.php                            27-Sep-2020 11:03                8772
function.eio-rmdir.php                             27-Sep-2020 11:03                7724
function.eio-seek.php                              27-Sep-2020 11:03                6082
function.eio-sendfile.php                          27-Sep-2020 11:03                5520
function.eio-set-max-idle.php                      27-Sep-2020 11:03                2961
function.eio-set-max-parallel.php                  27-Sep-2020 11:03                3006
function.eio-set-max-poll-reqs.php                 27-Sep-2020 11:03                2282
function.eio-set-max-poll-time.php                 27-Sep-2020 11:03                2352
function.eio-set-min-parallel.php                  27-Sep-2020 11:03                2995
function.eio-stat.php                              27-Sep-2020 11:03                9337
function.eio-statvfs.php                           27-Sep-2020 11:03                7646
function.eio-symlink.php                           27-Sep-2020 11:03               10388
function.eio-sync-file-range.php                   27-Sep-2020 11:03                6211
function.eio-sync.php                              27-Sep-2020 11:03                2614
function.eio-syncfs.php                            27-Sep-2020 11:03                4555
function.eio-truncate.php                          27-Sep-2020 11:03                5332
function.eio-unlink.php                            27-Sep-2020 11:03                4579
function.eio-utime.php                             27-Sep-2020 11:03                5294
function.eio-write.php                             27-Sep-2020 11:03                6019
function.empty.php                                 27-Sep-2020 11:03               10623
function.enchant-broker-describe.php               27-Sep-2020 11:03                4890
function.enchant-broker-dict-exists.php            27-Sep-2020 11:03                4635
function.enchant-broker-free-dict.php              27-Sep-2020 11:03                3095
function.enchant-broker-free.php                   27-Sep-2020 11:03                2867
function.enchant-broker-get-dict-path.php          27-Sep-2020 11:03                3330
function.enchant-broker-get-error.php              27-Sep-2020 11:03                2475
function.enchant-broker-init.php                   27-Sep-2020 11:03                2512
function.enchant-broker-list-dicts.php             27-Sep-2020 11:03                5825
function.enchant-broker-request-dict.php           27-Sep-2020 11:03                5545
function.enchant-broker-request-pwl-dict.php       27-Sep-2020 11:03                3780
function.enchant-broker-set-dict-path.php          27-Sep-2020 11:03                3629
function.enchant-broker-set-ordering.php           27-Sep-2020 11:03                3547
function.enchant-dict-add-to-personal.php          27-Sep-2020 11:03                5305
function.enchant-dict-add-to-session.php           27-Sep-2020 11:03                3191
function.enchant-dict-check.php                    27-Sep-2020 11:03                2797
function.enchant-dict-describe.php                 27-Sep-2020 11:03                5155
function.enchant-dict-get-error.php                27-Sep-2020 11:03                2489
function.enchant-dict-is-in-session.php            27-Sep-2020 11:03                3214
function.enchant-dict-quick-check.php              27-Sep-2020 11:03                6765
function.enchant-dict-store-replacement.php        27-Sep-2020 11:03                3261
function.enchant-dict-suggest.php                  27-Sep-2020 11:03                6516
function.end.php                                   27-Sep-2020 11:03                5009
function.ereg-replace.php                          27-Sep-2020 11:03               11252
function.ereg.php                                  27-Sep-2020 11:03                8788
function.eregi-replace.php                         27-Sep-2020 11:03                6898
function.eregi.php                                 27-Sep-2020 11:03                7160
function.error-clear-last.php                      27-Sep-2020 11:02                4296
function.error-get-last.php                        27-Sep-2020 11:02                4413
function.error-log.php                             27-Sep-2020 11:02                9235
function.error-reporting.php                       27-Sep-2020 11:02                8447
function.escapeshellarg.php                        27-Sep-2020 11:03                4989
function.escapeshellcmd.php                        27-Sep-2020 11:03                6364
function.eval.php                                  27-Sep-2020 11:03                8255
function.exec.php                                  27-Sep-2020 11:03                8327
function.exif-imagetype.php                        27-Sep-2020 11:03                8386
function.exif-read-data.php                        27-Sep-2020 11:03               21363
function.exif-tagname.php                          27-Sep-2020 11:03                4377
function.exif-thumbnail.php                        27-Sep-2020 11:03                8103
function.exit.php                                  27-Sep-2020 11:03                9161
function.exp.php                                   27-Sep-2020 11:03                4111
function.expect-expectl.php                        27-Sep-2020 11:03               11335
function.expect-popen.php                          27-Sep-2020 11:03                4429
function.explode.php                               27-Sep-2020 11:03               14185
function.expm1.php                                 27-Sep-2020 11:03                3195
function.extension-loaded.php                      27-Sep-2020 11:02                5340
function.extract.php                               27-Sep-2020 11:03               17318
function.ezmlm-hash.php                            27-Sep-2020 11:03                4343
function.fann-cascadetrain-on-data.php             27-Sep-2020 11:03                5985
function.fann-cascadetrain-on-file.php             27-Sep-2020 11:03                4992
function.fann-clear-scaling-params.php             27-Sep-2020 11:03                2439
function.fann-copy.php                             27-Sep-2020 11:03                2725
function.fann-create-from-file.php                 27-Sep-2020 11:03                3041
function.fann-create-shortcut-array.php            27-Sep-2020 11:03                3845
function.fann-create-shortcut.php                  27-Sep-2020 11:03                4639
function.fann-create-sparse-array.php              27-Sep-2020 11:03                4436
function.fann-create-sparse.php                    27-Sep-2020 11:03                4941
function.fann-create-standard-array.php            27-Sep-2020 11:03                4158
function.fann-create-standard.php                  27-Sep-2020 11:03                4707
function.fann-create-train-from-callback.php       27-Sep-2020 11:03                8671
function.fann-create-train.php                     27-Sep-2020 11:03                3981
function.fann-descale-input.php                    27-Sep-2020 11:03                3482
function.fann-descale-output.php                   27-Sep-2020 11:03                3497
function.fann-descale-train.php                    27-Sep-2020 11:03                3505
function.fann-destroy-train.php                    27-Sep-2020 11:03                2399
function.fann-destroy.php                          27-Sep-2020 11:03                2439
function.fann-duplicate-train-data.php             27-Sep-2020 11:03                2681
function.fann-get-activation-function.php          27-Sep-2020 11:03                4989
function.fann-get-activation-steepness.php         27-Sep-2020 11:03                5400
function.fann-get-bias-array.php                   27-Sep-2020 11:03                2419
function.fann-get-bit-fail-limit.php               27-Sep-2020 11:03                3534
function.fann-get-bit-fail.php                     27-Sep-2020 11:03                4763
function.fann-get-cascade-activation-functions-..> 27-Sep-2020 11:03                3626
function.fann-get-cascade-activation-functions.php 27-Sep-2020 11:03                4088
function.fann-get-cascade-activation-steepnesse..> 27-Sep-2020 11:03                3680
function.fann-get-cascade-activation-steepnesse..> 27-Sep-2020 11:03                3837
function.fann-get-cascade-candidate-change-frac..> 27-Sep-2020 11:03                4955
function.fann-get-cascade-candidate-limit.php      27-Sep-2020 11:03                3325
function.fann-get-cascade-candidate-stagnation-..> 27-Sep-2020 11:03                4064
function.fann-get-cascade-max-cand-epochs.php      27-Sep-2020 11:03                3207
function.fann-get-cascade-max-out-epochs.php       27-Sep-2020 11:03                3129
function.fann-get-cascade-min-cand-epochs.php      27-Sep-2020 11:03                3180
function.fann-get-cascade-min-out-epochs.php       27-Sep-2020 11:03                3139
function.fann-get-cascade-num-candidate-groups.php 27-Sep-2020 11:03                3600
function.fann-get-cascade-num-candidates.php       27-Sep-2020 11:03                5800
function.fann-get-cascade-output-change-fractio..> 27-Sep-2020 11:03                4886
function.fann-get-cascade-output-stagnation-epo..> 27-Sep-2020 11:03                4010
function.fann-get-cascade-weight-multiplier.php    27-Sep-2020 11:03                3281
function.fann-get-connection-array.php             27-Sep-2020 11:03                2440
function.fann-get-connection-rate.php              27-Sep-2020 11:03                2512
function.fann-get-errno.php                        27-Sep-2020 11:03                3026
function.fann-get-errstr.php                       27-Sep-2020 11:03                3028
function.fann-get-layer-array.php                  27-Sep-2020 11:03                2519
function.fann-get-learning-momentum.php            27-Sep-2020 11:03                3521
function.fann-get-learning-rate.php                27-Sep-2020 11:03                3381
function.fann-get-mse.php                          27-Sep-2020 11:03                3008
function.fann-get-network-type.php                 27-Sep-2020 11:03                2485
function.fann-get-num-input.php                    27-Sep-2020 11:03                2375
function.fann-get-num-layers.php                   27-Sep-2020 11:03                2429
function.fann-get-num-output.php                   27-Sep-2020 11:03                2393
function.fann-get-quickprop-decay.php              27-Sep-2020 11:03                3148
function.fann-get-quickprop-mu.php                 27-Sep-2020 11:03                3044
function.fann-get-rprop-decrease-factor.php        27-Sep-2020 11:03                3096
function.fann-get-rprop-delta-max.php              27-Sep-2020 11:03                3179
function.fann-get-rprop-delta-min.php              27-Sep-2020 11:03                2975
function.fann-get-rprop-delta-zero.php             27-Sep-2020 11:03                3377
function.fann-get-rprop-increase-factor.php        27-Sep-2020 11:03                3121
function.fann-get-sarprop-step-error-shift.php     27-Sep-2020 11:03                3095
function.fann-get-sarprop-step-error-threshold-..> 27-Sep-2020 11:03                3225
function.fann-get-sarprop-temperature.php          27-Sep-2020 11:03                3019
function.fann-get-sarprop-weight-decay-shift.php   27-Sep-2020 11:03                3072
function.fann-get-total-connections.php            27-Sep-2020 11:03                2559
function.fann-get-total-neurons.php                27-Sep-2020 11:03                2610
function.fann-get-train-error-function.php         27-Sep-2020 11:03                3313
function.fann-get-train-stop-function.php          27-Sep-2020 11:03                3302
function.fann-get-training-algorithm.php           27-Sep-2020 11:03                3475
function.fann-init-weights.php                     27-Sep-2020 11:03                4157
function.fann-length-train-data.php                27-Sep-2020 11:03                2686
function.fann-merge-train-data.php                 27-Sep-2020 11:03                2998
function.fann-num-input-train-data.php             27-Sep-2020 11:03                3346
function.fann-num-output-train-data.php            27-Sep-2020 11:03                3343
function.fann-print-error.php                      27-Sep-2020 11:03                2845
function.fann-randomize-weights.php                27-Sep-2020 11:03                3603
function.fann-read-train-from-file.php             27-Sep-2020 11:03                4868
function.fann-reset-errno.php                      27-Sep-2020 11:03                3036
function.fann-reset-errstr.php                     27-Sep-2020 11:03                3016
function.fann-reset-mse.php                        27-Sep-2020 11:03                3232
function.fann-run.php                              27-Sep-2020 11:03                2644
function.fann-save-train.php                       27-Sep-2020 11:03                3208
function.fann-save.php                             27-Sep-2020 11:03                4027
function.fann-scale-input-train-data.php           27-Sep-2020 11:03                3790
function.fann-scale-input.php                      27-Sep-2020 11:03                3498
function.fann-scale-output-train-data.php          27-Sep-2020 11:03                3817
function.fann-scale-output.php                     27-Sep-2020 11:03                3501
function.fann-scale-train-data.php                 27-Sep-2020 11:03                3794
function.fann-scale-train.php                      27-Sep-2020 11:03                3525
function.fann-set-activation-function-hidden.php   27-Sep-2020 11:03                4204
function.fann-set-activation-function-layer.php    27-Sep-2020 11:03                4669
function.fann-set-activation-function-output.php   27-Sep-2020 11:03                4220
function.fann-set-activation-function.php          27-Sep-2020 11:03                5830
function.fann-set-activation-steepness-hidden.php  27-Sep-2020 11:03                4504
function.fann-set-activation-steepness-layer.php   27-Sep-2020 11:03                4920
function.fann-set-activation-steepness-output.php  27-Sep-2020 11:03                4485
function.fann-set-activation-steepness.php         27-Sep-2020 11:03                5658
function.fann-set-bit-fail-limit.php               27-Sep-2020 11:03                3160
function.fann-set-callback.php                     27-Sep-2020 11:03                5348
function.fann-set-cascade-activation-functions.php 27-Sep-2020 11:03                3817
function.fann-set-cascade-activation-steepnesse..> 27-Sep-2020 11:03                4028
function.fann-set-cascade-candidate-change-frac..> 27-Sep-2020 11:03                3492
function.fann-set-cascade-candidate-limit.php      27-Sep-2020 11:03                3309
function.fann-set-cascade-candidate-stagnation-..> 27-Sep-2020 11:03                3552
function.fann-set-cascade-max-cand-epochs.php      27-Sep-2020 11:03                3310
function.fann-set-cascade-max-out-epochs.php       27-Sep-2020 11:03                3262
function.fann-set-cascade-min-cand-epochs.php      27-Sep-2020 11:03                3288
function.fann-set-cascade-min-out-epochs.php       27-Sep-2020 11:03                3272
function.fann-set-cascade-num-candidate-groups.php 27-Sep-2020 11:03                3390
function.fann-set-cascade-output-change-fractio..> 27-Sep-2020 11:03                3452
function.fann-set-cascade-output-stagnation-epo..> 27-Sep-2020 11:03                3516
function.fann-set-cascade-weight-multiplier.php    27-Sep-2020 11:03                3292
function.fann-set-error-log.php                    27-Sep-2020 11:03                2801
function.fann-set-input-scaling-params.php         27-Sep-2020 11:03                4044
function.fann-set-learning-momentum.php            27-Sep-2020 11:03                3556
function.fann-set-learning-rate.php                27-Sep-2020 11:03                3486
function.fann-set-output-scaling-params.php        27-Sep-2020 11:03                4063
function.fann-set-quickprop-decay.php              27-Sep-2020 11:03                3230
function.fann-set-quickprop-mu.php                 27-Sep-2020 11:03                3088
function.fann-set-rprop-decrease-factor.php        27-Sep-2020 11:03                3281
function.fann-set-rprop-delta-max.php              27-Sep-2020 11:03                3414
function.fann-set-rprop-delta-min.php              27-Sep-2020 11:03                3205
function.fann-set-rprop-delta-zero.php             27-Sep-2020 11:03                3616
function.fann-set-rprop-increase-factor.php        27-Sep-2020 11:03                3307
function.fann-set-sarprop-step-error-shift.php     27-Sep-2020 11:03                3336
function.fann-set-sarprop-step-error-threshold-..> 27-Sep-2020 11:03                3508
function.fann-set-sarprop-temperature.php          27-Sep-2020 11:03                3257
function.fann-set-sarprop-weight-decay-shift.php   27-Sep-2020 11:03                3326
function.fann-set-scaling-params.php               27-Sep-2020 11:03                4948
function.fann-set-train-error-function.php         27-Sep-2020 11:03                3494
function.fann-set-train-stop-function.php          27-Sep-2020 11:03                3483
function.fann-set-training-algorithm.php           27-Sep-2020 11:03                3432
function.fann-set-weight-array.php                 27-Sep-2020 11:03                2904
function.fann-set-weight.php                       27-Sep-2020 11:03                3176
function.fann-shuffle-train-data.php               27-Sep-2020 11:03                2594
function.fann-subset-train-data.php                27-Sep-2020 11:03                3962
function.fann-test-data.php                        27-Sep-2020 11:03                4015
function.fann-test.php                             27-Sep-2020 11:03                4254
function.fann-train-epoch.php                      27-Sep-2020 11:03                4372
function.fann-train-on-data.php                    27-Sep-2020 11:03                6015
function.fann-train-on-file.php                    27-Sep-2020 11:03                5947
function.fann-train.php                            27-Sep-2020 11:03                4279
function.fastcgi-finish-request.php                27-Sep-2020 11:03                2104
function.fbird-add-user.php                        27-Sep-2020 11:03                2213
function.fbird-affected-rows.php                   27-Sep-2020 11:03                2223
function.fbird-backup.php                          27-Sep-2020 11:03                1631
function.fbird-blob-add.php                        27-Sep-2020 11:03                2571
function.fbird-blob-cancel.php                     27-Sep-2020 11:03                3371
function.fbird-blob-close.php                      27-Sep-2020 11:03                2600
function.fbird-blob-create.php                     27-Sep-2020 11:03                2599
function.fbird-blob-echo.php                       27-Sep-2020 11:03                2389
function.fbird-blob-get.php                        27-Sep-2020 11:03                2383
function.fbird-blob-import.php                     27-Sep-2020 11:03                2595
function.fbird-blob-info.php                       27-Sep-2020 11:03                1660
function.fbird-blob-open.php                       27-Sep-2020 11:03                2379
function.fbird-close.php                           27-Sep-2020 11:03                2154
function.fbird-commit-ret.php                      27-Sep-2020 11:03                1652
function.fbird-commit.php                          27-Sep-2020 11:03                1624
function.fbird-connect.php                         27-Sep-2020 11:03                2158
function.fbird-db-info.php                         27-Sep-2020 11:03                1636
function.fbird-delete-user.php                     27-Sep-2020 11:03                2222
function.fbird-drop-db.php                         27-Sep-2020 11:03                2174
function.fbird-errcode.php                         27-Sep-2020 11:03                1982
function.fbird-errmsg.php                          27-Sep-2020 11:03                1976
function.fbird-execute.php                         27-Sep-2020 11:03                1987
function.fbird-fetch-assoc.php                     27-Sep-2020 11:03                2238
function.fbird-fetch-object.php                    27-Sep-2020 11:03                2248
function.fbird-fetch-row.php                       27-Sep-2020 11:03                2228
function.fbird-field-info.php                      27-Sep-2020 11:03                2054
function.fbird-free-event-handler.php              27-Sep-2020 11:03                2150
function.fbird-free-query.php                      27-Sep-2020 11:03                1688
function.fbird-free-result.php                     27-Sep-2020 11:03                1672
function.fbird-gen-id.php                          27-Sep-2020 11:03                1634
function.fbird-maintain-db.php                     27-Sep-2020 11:03                1674
function.fbird-modify-user.php                     27-Sep-2020 11:03                2238
function.fbird-name-result.php                     27-Sep-2020 11:03                2221
function.fbird-num-fields.php                      27-Sep-2020 11:03                2043
function.fbird-num-params.php                      27-Sep-2020 11:03                2217
function.fbird-param-info.php                      27-Sep-2020 11:03                2222
function.fbird-pconnect.php                        27-Sep-2020 11:03                2174
function.fbird-prepare.php                         27-Sep-2020 11:03                1626
function.fbird-query.php                           27-Sep-2020 11:03                2523
function.fbird-restore.php                         27-Sep-2020 11:03                1633
function.fbird-rollback-ret.php                    27-Sep-2020 11:03                1680
function.fbird-rollback.php                        27-Sep-2020 11:03                1656
function.fbird-server-info.php                     27-Sep-2020 11:03                1684
function.fbird-service-attach.php                  27-Sep-2020 11:03                1720
function.fbird-service-detach.php                  27-Sep-2020 11:03                1732
function.fbird-set-event-handler.php               27-Sep-2020 11:03                2325
function.fbird-trans.php                           27-Sep-2020 11:03                1634
function.fbird-wait-event.php                      27-Sep-2020 11:03                2257
function.fbsql-affected-rows.php                   27-Sep-2020 11:03                4384
function.fbsql-autocommit.php                      27-Sep-2020 11:03                4308
function.fbsql-blob-size.php                       27-Sep-2020 11:03                3598
function.fbsql-change-user.php                     27-Sep-2020 11:03                3946
function.fbsql-clob-size.php                       27-Sep-2020 11:03                3588
function.fbsql-close.php                           27-Sep-2020 11:03                5065
function.fbsql-commit.php                          27-Sep-2020 11:03                3576
function.fbsql-connect.php                         27-Sep-2020 11:03                5694
function.fbsql-create-blob.php                     27-Sep-2020 11:03                7354
function.fbsql-create-clob.php                     27-Sep-2020 11:03                7361
function.fbsql-create-db.php                       27-Sep-2020 11:03                5584
function.fbsql-data-seek.php                       27-Sep-2020 11:03                7692
function.fbsql-database-password.php               27-Sep-2020 11:03                6423
function.fbsql-database.php                        27-Sep-2020 11:03                3244
function.fbsql-db-query.php                        27-Sep-2020 11:03                4155
function.fbsql-db-status.php                       27-Sep-2020 11:03                5344
function.fbsql-drop-db.php                         27-Sep-2020 11:03                3635
function.fbsql-errno.php                           27-Sep-2020 11:03                6422
function.fbsql-error.php                           27-Sep-2020 11:03                6428
function.fbsql-fetch-array.php                     27-Sep-2020 11:03                8484
function.fbsql-fetch-assoc.php                     27-Sep-2020 11:03                6851
function.fbsql-fetch-field.php                     27-Sep-2020 11:03                8641
function.fbsql-fetch-lengths.php                   27-Sep-2020 11:03                3532
function.fbsql-fetch-object.php                    27-Sep-2020 11:03                6253
function.fbsql-fetch-row.php                       27-Sep-2020 11:03                4360
function.fbsql-field-flags.php                     27-Sep-2020 11:03                3000
function.fbsql-field-len.php                       27-Sep-2020 11:03                2739
function.fbsql-field-name.php                      27-Sep-2020 11:03                5242
function.fbsql-field-seek.php                      27-Sep-2020 11:03                3566
function.fbsql-field-table.php                     27-Sep-2020 11:03                2840
function.fbsql-field-type.php                      27-Sep-2020 11:03                9736
function.fbsql-free-result.php                     27-Sep-2020 11:03                2932
function.fbsql-get-autostart-info.php              27-Sep-2020 11:03                2723
function.fbsql-hostname.php                        27-Sep-2020 11:03                3749
function.fbsql-insert-id.php                       27-Sep-2020 11:03                3873
function.fbsql-list-dbs.php                        27-Sep-2020 11:03                5953
function.fbsql-list-fields.php                     27-Sep-2020 11:03                7611
function.fbsql-list-tables.php                     27-Sep-2020 11:03                3938
function.fbsql-next-result.php                     27-Sep-2020 11:03                5621
function.fbsql-num-fields.php                      27-Sep-2020 11:03                3467
function.fbsql-num-rows.php                        27-Sep-2020 11:03                5817
function.fbsql-password.php                        27-Sep-2020 11:03                3725
function.fbsql-pconnect.php                        27-Sep-2020 11:03                4533
function.fbsql-query.php                           27-Sep-2020 11:03                8438
function.fbsql-read-blob.php                       27-Sep-2020 11:03                8332
function.fbsql-read-clob.php                       27-Sep-2020 11:03                8334
function.fbsql-result.php                          27-Sep-2020 11:03                5208
function.fbsql-rollback.php                        27-Sep-2020 11:03                3568
function.fbsql-rows-fetched.php                    27-Sep-2020 11:03                2520
function.fbsql-select-db.php                       27-Sep-2020 11:03                5041
function.fbsql-set-characterset.php                27-Sep-2020 11:03                2359
function.fbsql-set-lob-mode.php                    27-Sep-2020 11:03                5331
function.fbsql-set-password.php                    27-Sep-2020 11:03                3734
function.fbsql-set-transaction.php                 27-Sep-2020 11:03                4079
function.fbsql-start-db.php                        27-Sep-2020 11:03                3982
function.fbsql-stop-db.php                         27-Sep-2020 11:03                3713
function.fbsql-table-name.php                      27-Sep-2020 11:03                5455
function.fbsql-tablename.php                       27-Sep-2020 11:03                1656
function.fbsql-username.php                        27-Sep-2020 11:03                3728
function.fbsql-warnings.php                        27-Sep-2020 11:03                2928
function.fclose.php                                27-Sep-2020 11:03                4062
function.fdf-add-doc-javascript.php                27-Sep-2020 11:03                5088
function.fdf-add-template.php                      27-Sep-2020 11:03                2296
function.fdf-close.php                             27-Sep-2020 11:03                2884
function.fdf-create.php                            27-Sep-2020 11:03                5308
function.fdf-enum-values.php                       27-Sep-2020 11:03                2225
function.fdf-errno.php                             27-Sep-2020 11:03                2446
function.fdf-error.php                             27-Sep-2020 11:03                2983
function.fdf-get-ap.php                            27-Sep-2020 11:03                3639
function.fdf-get-attachment.php                    27-Sep-2020 11:03                5841
function.fdf-get-encoding.php                      27-Sep-2020 11:03                3150
function.fdf-get-file.php                          27-Sep-2020 11:03                2974
function.fdf-get-flags.php                         27-Sep-2020 11:03                2043
function.fdf-get-opt.php                           27-Sep-2020 11:03                2166
function.fdf-get-status.php                        27-Sep-2020 11:03                2991
function.fdf-get-value.php                         27-Sep-2020 11:03                4271
function.fdf-get-version.php                       27-Sep-2020 11:03                3315
function.fdf-header.php                            27-Sep-2020 11:03                2032
function.fdf-next-field-name.php                   27-Sep-2020 11:03                5193
function.fdf-open-string.php                       27-Sep-2020 11:03                4628
function.fdf-open.php                              27-Sep-2020 11:03                5741
function.fdf-remove-item.php                       27-Sep-2020 11:03                2053
function.fdf-save-string.php                       27-Sep-2020 11:03                5388
function.fdf-save.php                              27-Sep-2020 11:03                3693
function.fdf-set-ap.php                            27-Sep-2020 11:03                3789
function.fdf-set-encoding.php                      27-Sep-2020 11:03                3362
function.fdf-set-file.php                          27-Sep-2020 11:03                6566
function.fdf-set-flags.php                         27-Sep-2020 11:03                3786
function.fdf-set-javascript-action.php             27-Sep-2020 11:03                3969
function.fdf-set-on-import-javascript.php          27-Sep-2020 11:03                2842
function.fdf-set-opt.php                           27-Sep-2020 11:03                3990
function.fdf-set-status.php                        27-Sep-2020 11:03                3411
function.fdf-set-submit-form-action.php            27-Sep-2020 11:03                4190
function.fdf-set-target-frame.php                  27-Sep-2020 11:03                3405
function.fdf-set-value.php                         27-Sep-2020 11:03                5252
function.fdf-set-version.php                       27-Sep-2020 11:03                3634
function.feof.php                                  27-Sep-2020 11:03                7516
function.fflush.php                                27-Sep-2020 11:03                5284
function.fgetc.php                                 27-Sep-2020 11:03                6062
function.fgetcsv.php                               27-Sep-2020 11:03               12198
function.fgets.php                                 27-Sep-2020 11:03                7940
function.fgetss.php                                27-Sep-2020 11:03                9138
function.file-exists.php                           27-Sep-2020 11:03                7103
function.file-get-contents.php                     27-Sep-2020 11:03               16600
function.file-put-contents.php                     27-Sep-2020 11:03               12452
function.file.php                                  27-Sep-2020 11:03               11946
function.fileatime.php                             27-Sep-2020 11:03                6432
function.filectime.php                             27-Sep-2020 11:03                6482
function.filegroup.php                             27-Sep-2020 11:03                5302
function.fileinode.php                             27-Sep-2020 11:03                4881
function.filemtime.php                             27-Sep-2020 11:03                6291
function.fileowner.php                             27-Sep-2020 11:03                5097
function.fileperms.php                             27-Sep-2020 11:03               17557
function.filepro-fieldcount.php                    27-Sep-2020 11:03                2395
function.filepro-fieldname.php                     27-Sep-2020 11:03                2424
function.filepro-fieldtype.php                     27-Sep-2020 11:03                2430
function.filepro-fieldwidth.php                    27-Sep-2020 11:03                2426
function.filepro-retrieve.php                      27-Sep-2020 11:03                3339
function.filepro-rowcount.php                      27-Sep-2020 11:03                2668
function.filepro.php                               27-Sep-2020 11:03                2758
function.filesize.php                              27-Sep-2020 11:03                5292
function.filetype.php                              27-Sep-2020 11:03                6114
function.filter-has-var.php                        27-Sep-2020 11:03                2718
function.filter-id.php                             27-Sep-2020 11:03                2588
function.filter-input-array.php                    27-Sep-2020 11:03               13747
function.filter-input.php                          27-Sep-2020 11:03                7402
function.filter-list.php                           27-Sep-2020 11:03                3317
function.filter-var-array.php                      27-Sep-2020 11:03               13449
function.filter-var.php                            27-Sep-2020 11:03               13528
function.finfo-buffer.php                          27-Sep-2020 11:03                6040
function.finfo-close.php                           27-Sep-2020 11:03                2509
function.finfo-file.php                            27-Sep-2020 11:03                6700
function.finfo-open.php                            27-Sep-2020 11:03                8956
function.finfo-set-flags.php                       27-Sep-2020 11:03                3542
function.floatval.php                              27-Sep-2020 11:03                5960
function.flock.php                                 27-Sep-2020 11:03               12158
function.floor.php                                 27-Sep-2020 11:03                4551
function.flush.php                                 27-Sep-2020 11:02                4436
function.fmod.php                                  27-Sep-2020 11:03                4807
function.fnmatch.php                               27-Sep-2020 11:03                7291
function.fopen.php                                 27-Sep-2020 11:03               21885
function.forward-static-call-array.php             27-Sep-2020 11:03               10108
function.forward-static-call.php                   27-Sep-2020 11:03                9450
function.fpassthru.php                             27-Sep-2020 11:03                7299
function.fprintf.php                               27-Sep-2020 11:03               18076
function.fputcsv.php                               27-Sep-2020 11:03                9236
function.fputs.php                                 27-Sep-2020 11:03                1521
function.fread.php                                 27-Sep-2020 11:03               14463
function.frenchtojd.php                            27-Sep-2020 11:03                3743
function.fscanf.php                                27-Sep-2020 11:03               16721
function.fseek.php                                 27-Sep-2020 11:03                7370
function.fsockopen.php                             27-Sep-2020 11:03               15510
function.fstat.php                                 27-Sep-2020 11:03                5656
function.ftell.php                                 27-Sep-2020 11:03                5797
function.ftok.php                                  27-Sep-2020 11:03                3376
function.ftp-alloc.php                             27-Sep-2020 11:03                7337
function.ftp-append.php                            27-Sep-2020 11:03                3135
function.ftp-cdup.php                              27-Sep-2020 11:03                5854
function.ftp-chdir.php                             27-Sep-2020 11:03                6788
function.ftp-chmod.php                             27-Sep-2020 11:03                6109
function.ftp-close.php                             27-Sep-2020 11:03                5157
function.ftp-connect.php                           27-Sep-2020 11:03                5416
function.ftp-delete.php                            27-Sep-2020 11:03                5345
function.ftp-exec.php                              27-Sep-2020 11:03                5922
function.ftp-fget.php                              27-Sep-2020 11:03                9211
function.ftp-fput.php                              27-Sep-2020 11:03                8575
function.ftp-get-option.php                        27-Sep-2020 11:03                4947
function.ftp-get.php                               27-Sep-2020 11:03                8456
function.ftp-login.php                             27-Sep-2020 11:03                5963
function.ftp-mdtm.php                              27-Sep-2020 11:03                6405
function.ftp-mkdir.php                             27-Sep-2020 11:03                5670
function.ftp-mlsd.php                              27-Sep-2020 11:03                8136
function.ftp-nb-continue.php                       27-Sep-2020 11:03                4642
function.ftp-nb-fget.php                           27-Sep-2020 11:03                9660
function.ftp-nb-fput.php                           27-Sep-2020 11:03                9409
function.ftp-nb-get.php                            27-Sep-2020 11:03               13791
function.ftp-nb-put.php                            27-Sep-2020 11:03               11024
function.ftp-nlist.php                             27-Sep-2020 11:03                5810
function.ftp-pasv.php                              27-Sep-2020 11:03                6380
function.ftp-put.php                               27-Sep-2020 11:03                8110
function.ftp-pwd.php                               27-Sep-2020 11:03                5120
function.ftp-quit.php                              27-Sep-2020 11:03                1533
function.ftp-raw.php                               27-Sep-2020 11:03                4530
function.ftp-rawlist.php                           27-Sep-2020 11:03                7052
function.ftp-rename.php                            27-Sep-2020 11:03                6266
function.ftp-rmdir.php                             27-Sep-2020 11:03                5707
function.ftp-set-option.php                        27-Sep-2020 11:03                6067
function.ftp-site.php                              27-Sep-2020 11:03                5876
function.ftp-size.php                              27-Sep-2020 11:03                6072
function.ftp-ssl-connect.php                       27-Sep-2020 11:03                7908
function.ftp-systype.php                           27-Sep-2020 11:03                4582
function.ftruncate.php                             27-Sep-2020 11:03                6159
function.func-get-arg.php                          27-Sep-2020 11:03               13567
function.func-get-args.php                         27-Sep-2020 11:03               14366
function.func-num-args.php                         27-Sep-2020 11:03                7449
function.function-exists.php                       27-Sep-2020 11:03                5764
function.fwrite.php                                27-Sep-2020 11:03               14632
function.gc-collect-cycles.php                     27-Sep-2020 11:02                2389
function.gc-disable.php                            27-Sep-2020 11:02                2459
function.gc-enable.php                             27-Sep-2020 11:02                2433
function.gc-enabled.php                            27-Sep-2020 11:02                3157
function.gc-mem-caches.php                         27-Sep-2020 11:02                2333
function.gc-status.php                             27-Sep-2020 11:02                5867
function.gd-info.php                               27-Sep-2020 11:03                8446
function.geoip-asnum-by-name.php                   27-Sep-2020 11:03                3989
function.geoip-continent-code-by-name.php          27-Sep-2020 11:03                5512
function.geoip-country-code-by-name.php            27-Sep-2020 11:03                5249
function.geoip-country-code3-by-name.php           27-Sep-2020 11:03                4813
function.geoip-country-name-by-name.php            27-Sep-2020 11:03                4779
function.geoip-database-info.php                   27-Sep-2020 11:03                4012
function.geoip-db-avail.php                        27-Sep-2020 11:03                4154
function.geoip-db-filename.php                     27-Sep-2020 11:03                3888
function.geoip-db-get-all-info.php                 27-Sep-2020 11:03                6468
function.geoip-domain-by-name.php                  27-Sep-2020 11:03                4217
function.geoip-id-by-name.php                      27-Sep-2020 11:03                5757
function.geoip-isp-by-name.php                     27-Sep-2020 11:03                4244
function.geoip-netspeedcell-by-name.php            27-Sep-2020 11:03                4958
function.geoip-org-by-name.php                     27-Sep-2020 11:03                4263
function.geoip-record-by-name.php                  27-Sep-2020 11:03                7348
function.geoip-region-by-name.php                  27-Sep-2020 11:03                4878
function.geoip-region-name-by-code.php             27-Sep-2020 11:03                6983
function.geoip-setup-custom-directory.php          27-Sep-2020 11:03                3999
function.geoip-time-zone-by-country-and-region.php 27-Sep-2020 11:03                7146
function.get-browser.php                           27-Sep-2020 11:03                7422
function.get-called-class.php                      27-Sep-2020 11:03                4659
function.get-cfg-var.php                           27-Sep-2020 11:02                3477
function.get-class-methods.php                     27-Sep-2020 11:03                6594
function.get-class-vars.php                        27-Sep-2020 11:03               10211
function.get-class.php                             27-Sep-2020 11:03               11618
function.get-current-user.php                      27-Sep-2020 11:02                3996
function.get-declared-classes.php                  27-Sep-2020 11:03                4951
function.get-declared-interfaces.php               27-Sep-2020 11:03                3943
function.get-declared-traits.php                   27-Sep-2020 11:03                2742
function.get-defined-constants.php                 27-Sep-2020 11:02                7071
function.get-defined-functions.php                 27-Sep-2020 11:03                6506
function.get-defined-vars.php                      27-Sep-2020 11:03                6100
function.get-extension-funcs.php                   27-Sep-2020 11:02                5253
function.get-headers.php                           27-Sep-2020 11:03                8083
function.get-html-translation-table.php            27-Sep-2020 11:03               11744
function.get-include-path.php                      27-Sep-2020 11:02                3920
function.get-included-files.php                    27-Sep-2020 11:02                5736
function.get-loaded-extensions.php                 27-Sep-2020 11:02                4771
function.get-magic-quotes-gpc.php                  27-Sep-2020 11:02                7329
function.get-magic-quotes-runtime.php              27-Sep-2020 11:02                4602
function.get-meta-tags.php                         27-Sep-2020 11:03                7657
function.get-object-vars.php                       27-Sep-2020 11:03                5900
function.get-parent-class.php                      27-Sep-2020 11:03                7015
function.get-required-files.php                    27-Sep-2020 11:02                1688
function.get-resource-type.php                     27-Sep-2020 11:03                5240
function.get-resources.php                         27-Sep-2020 11:02                6525
function.getallheaders.php                         27-Sep-2020 11:03                4361
function.getcwd.php                                27-Sep-2020 11:03                4834
function.getdate.php                               27-Sep-2020 11:03                8585
function.getenv.php                                27-Sep-2020 11:02                7732
function.gethostbyaddr.php                         27-Sep-2020 11:03                4062
function.gethostbyname.php                         27-Sep-2020 11:03                4361
function.gethostbynamel.php                        27-Sep-2020 11:03                4752
function.gethostname.php                           27-Sep-2020 11:03                3956
function.getimagesize.php                          27-Sep-2020 11:03               16448
function.getimagesizefromstring.php                27-Sep-2020 11:03                5266
function.getlastmod.php                            27-Sep-2020 11:02                4823
function.getmxrr.php                               27-Sep-2020 11:03                5522
function.getmygid.php                              27-Sep-2020 11:02                2952
function.getmyinode.php                            27-Sep-2020 11:02                2959
function.getmypid.php                              27-Sep-2020 11:02                3286
function.getmyuid.php                              27-Sep-2020 11:02                2926
function.getopt.php                                27-Sep-2020 11:02               14586
function.getprotobyname.php                        27-Sep-2020 11:03                4396
function.getprotobynumber.php                      27-Sep-2020 11:03                2903
function.getrandmax.php                            27-Sep-2020 11:03                2680
function.getrusage.php                             27-Sep-2020 11:02               11594
function.getservbyname.php                         27-Sep-2020 11:03                6213
function.getservbyport.php                         27-Sep-2020 11:03                3318
function.gettext.php                               27-Sep-2020 11:03                5810
function.gettimeofday.php                          27-Sep-2020 11:03                4514
function.gettype.php                               27-Sep-2020 11:03                9749
function.glob.php                                  27-Sep-2020 11:03                9094
function.gmdate.php                                27-Sep-2020 11:03                6577
function.gmmktime.php                              27-Sep-2020 11:03                8892
function.gmp-abs.php                               27-Sep-2020 11:03                4276
function.gmp-add.php                               27-Sep-2020 11:03                4482
function.gmp-and.php                               27-Sep-2020 11:03                4965
function.gmp-binomial.php                          27-Sep-2020 11:03                3093
function.gmp-clrbit.php                            27-Sep-2020 11:03                5693
function.gmp-cmp.php                               27-Sep-2020 11:03                5364
function.gmp-com.php                               27-Sep-2020 11:03                3742
function.gmp-div-q.php                             27-Sep-2020 11:03                9883
function.gmp-div-qr.php                            27-Sep-2020 11:03                6378
function.gmp-div-r.php                             27-Sep-2020 11:03                5720
function.gmp-div.php                               27-Sep-2020 11:03                1553
function.gmp-divexact.php                          27-Sep-2020 11:03                5728
function.gmp-export.php                            27-Sep-2020 11:03                4656
function.gmp-fact.php                              27-Sep-2020 11:03                4891
function.gmp-gcd.php                               27-Sep-2020 11:03                4866
function.gmp-gcdext.php                            27-Sep-2020 11:03                9422
function.gmp-hamdist.php                           27-Sep-2020 11:03                6260
function.gmp-import.php                            27-Sep-2020 11:03                5195
function.gmp-init.php                              27-Sep-2020 11:03                5214
function.gmp-intval.php                            27-Sep-2020 11:03                5170
function.gmp-invert.php                            27-Sep-2020 11:03                4942
function.gmp-jacobi.php                            27-Sep-2020 11:03                5473
function.gmp-kronecker.php                         27-Sep-2020 11:03                3722
function.gmp-lcm.php                               27-Sep-2020 11:03                3674
function.gmp-legendre.php                          27-Sep-2020 11:03                5490
function.gmp-mod.php                               27-Sep-2020 11:03                4726
function.gmp-mul.php                               27-Sep-2020 11:03                4803
function.gmp-neg.php                               27-Sep-2020 11:03                4225
function.gmp-nextprime.php                         27-Sep-2020 11:03                4894
function.gmp-or.php                                27-Sep-2020 11:03                5317
function.gmp-perfect-power.php                     27-Sep-2020 11:03                3031
function.gmp-perfect-square.php                    27-Sep-2020 11:03                5320
function.gmp-popcount.php                          27-Sep-2020 11:03                4705
function.gmp-pow.php                               27-Sep-2020 11:03                5588
function.gmp-powm.php                              27-Sep-2020 11:03                5448
function.gmp-prob-prime.php                        27-Sep-2020 11:03                5618
function.gmp-random-bits.php                       27-Sep-2020 11:03                4445
function.gmp-random-range.php                      27-Sep-2020 11:03                5189
function.gmp-random-seed.php                       27-Sep-2020 11:03                6650
function.gmp-random.php                            27-Sep-2020 11:03                5363
function.gmp-root.php                              27-Sep-2020 11:03                2943
function.gmp-rootrem.php                           27-Sep-2020 11:03                3048
function.gmp-scan0.php                             27-Sep-2020 11:03                5410
function.gmp-scan1.php                             27-Sep-2020 11:03                5422
function.gmp-setbit.php                            27-Sep-2020 11:03               12029
function.gmp-sign.php                              27-Sep-2020 11:03                4972
function.gmp-sqrt.php                              27-Sep-2020 11:03                4820
function.gmp-sqrtrem.php                           27-Sep-2020 11:03                6228
function.gmp-strval.php                            27-Sep-2020 11:03                4823
function.gmp-sub.php                               27-Sep-2020 11:03                4898
function.gmp-testbit.php                           27-Sep-2020 11:03                5524
function.gmp-xor.php                               27-Sep-2020 11:03                5317
function.gmstrftime.php                            27-Sep-2020 11:03                6470
function.gnupg-adddecryptkey.php                   27-Sep-2020 11:03                4923
function.gnupg-addencryptkey.php                   27-Sep-2020 11:03                4521
function.gnupg-addsignkey.php                      27-Sep-2020 11:03                4910
function.gnupg-cleardecryptkeys.php                27-Sep-2020 11:03                4114
function.gnupg-clearencryptkeys.php                27-Sep-2020 11:03                4119
function.gnupg-clearsignkeys.php                   27-Sep-2020 11:03                4064
function.gnupg-decrypt.php                         27-Sep-2020 11:03                5727
function.gnupg-decryptverify.php                   27-Sep-2020 11:03                6838
function.gnupg-encrypt.php                         27-Sep-2020 11:03                5663
function.gnupg-encryptsign.php                     27-Sep-2020 11:03                6563
function.gnupg-export.php                          27-Sep-2020 11:03                4802
function.gnupg-geterror.php                        27-Sep-2020 11:03                3984
function.gnupg-getprotocol.php                     27-Sep-2020 11:03                4107
function.gnupg-import.php                          27-Sep-2020 11:03                5067
function.gnupg-init.php                            27-Sep-2020 11:03                3190
function.gnupg-keyinfo.php                         27-Sep-2020 11:03                4988
function.gnupg-setarmor.php                        27-Sep-2020 11:03                5366
function.gnupg-seterrormode.php                    27-Sep-2020 11:03                5325
function.gnupg-setsignmode.php                     27-Sep-2020 11:03                5212
function.gnupg-sign.php                            27-Sep-2020 11:03                5876
function.gnupg-verify.php                          27-Sep-2020 11:03                7867
function.grapheme-extract.php                      27-Sep-2020 11:03                7843
function.grapheme-stripos.php                      27-Sep-2020 11:03                7817
function.grapheme-stristr.php                      27-Sep-2020 11:03                7294
function.grapheme-strlen.php                       27-Sep-2020 11:03                5257
function.grapheme-strpos.php                       27-Sep-2020 11:03                7426
function.grapheme-strripos.php                     27-Sep-2020 11:03                7272
function.grapheme-strrpos.php                      27-Sep-2020 11:03                6872
function.grapheme-strstr.php                       27-Sep-2020 11:03                6907
function.grapheme-substr.php                       27-Sep-2020 11:03                6524
function.gregoriantojd.php                         27-Sep-2020 11:03                7416
function.gzclose.php                               27-Sep-2020 11:02                3985
function.gzcompress.php                            27-Sep-2020 11:02                5559
function.gzdecode.php                              27-Sep-2020 11:02                3004
function.gzdeflate.php                             27-Sep-2020 11:02                5194
function.gzencode.php                              27-Sep-2020 11:02                7287
function.gzeof.php                                 27-Sep-2020 11:02                3878
function.gzfile.php                                27-Sep-2020 11:02                4384
function.gzgetc.php                                27-Sep-2020 11:02                4381
function.gzgets.php                                27-Sep-2020 11:02                5073
function.gzgetss.php                               27-Sep-2020 11:02                5806
function.gzinflate.php                             27-Sep-2020 11:02                4982
function.gzopen.php                                27-Sep-2020 11:02                5267
function.gzpassthru.php                            27-Sep-2020 11:02                4588
function.gzputs.php                                27-Sep-2020 11:02                1520
function.gzread.php                                27-Sep-2020 11:02                5735
function.gzrewind.php                              27-Sep-2020 11:02                2978
function.gzseek.php                                27-Sep-2020 11:02                5857
function.gztell.php                                27-Sep-2020 11:02                3104
function.gzuncompress.php                          27-Sep-2020 11:02                5022
function.gzwrite.php                               27-Sep-2020 11:02                5622
function.halt-compiler.php                         27-Sep-2020 11:03                4872
function.hash-algos.php                            27-Sep-2020 11:02                5159
function.hash-copy.php                             27-Sep-2020 11:02                5336
function.hash-equals.php                           27-Sep-2020 11:02                6408
function.hash-file.php                             27-Sep-2020 11:02                5971
function.hash-final.php                            27-Sep-2020 11:02                5969
function.hash-hkdf.php                             27-Sep-2020 11:02                8672
function.hash-hmac-algos.php                       27-Sep-2020 11:02                4965
function.hash-hmac-file.php                        27-Sep-2020 11:02                6878
function.hash-hmac.php                             27-Sep-2020 11:02                6491
function.hash-init.php                             27-Sep-2020 11:02                7493
function.hash-pbkdf2.php                           27-Sep-2020 11:03               10563
function.hash-update-file.php                      27-Sep-2020 11:03                5155
function.hash-update-stream.php                    27-Sep-2020 11:03                6922
function.hash-update.php                           27-Sep-2020 11:03                4154
function.hash.php                                  27-Sep-2020 11:03               10268
function.header-register-callback.php              27-Sep-2020 11:03                6679
function.header-remove.php                         27-Sep-2020 11:03                5821
function.header.php                                27-Sep-2020 11:03               18194
function.headers-list.php                          27-Sep-2020 11:03                5920
function.headers-sent.php                          27-Sep-2020 11:03                7823
function.hebrev.php                                27-Sep-2020 11:03                3067
function.hebrevc.php                               27-Sep-2020 11:03                3191
function.hex2bin.php                               27-Sep-2020 11:03                4563
function.hexdec.php                                27-Sep-2020 11:03                6317
function.highlight-file.php                        27-Sep-2020 11:03                5056
function.highlight-string.php                      27-Sep-2020 11:03                5370
function.hrtime.php                                27-Sep-2020 11:03                4669
function.html-entity-decode.php                    27-Sep-2020 11:03               12635
function.htmlentities.php                          27-Sep-2020 11:03               15367
function.htmlspecialchars-decode.php               27-Sep-2020 11:03                7380
function.htmlspecialchars.php                      27-Sep-2020 11:03               19025
function.http-build-query.php                      27-Sep-2020 11:03               19430
function.http-response-code.php                    27-Sep-2020 11:03                6765
function.hypot.php                                 27-Sep-2020 11:03                2781
function.ibase-add-user.php                        27-Sep-2020 11:03                4312
function.ibase-affected-rows.php                   27-Sep-2020 11:03                3192
function.ibase-backup.php                          27-Sep-2020 11:03                9750
function.ibase-blob-add.php                        27-Sep-2020 11:03                3781
function.ibase-blob-cancel.php                     27-Sep-2020 11:03                3379
function.ibase-blob-close.php                      27-Sep-2020 11:03                3729
function.ibase-blob-create.php                     27-Sep-2020 11:03                3625
function.ibase-blob-echo.php                       27-Sep-2020 11:03                3752
function.ibase-blob-get.php                        27-Sep-2020 11:03                6412
function.ibase-blob-import.php                     27-Sep-2020 11:03                8191
function.ibase-blob-info.php                       27-Sep-2020 11:03                3115
function.ibase-blob-open.php                       27-Sep-2020 11:03                3779
function.ibase-close.php                           27-Sep-2020 11:03                3423
function.ibase-commit-ret.php                      27-Sep-2020 11:03                2911
function.ibase-commit.php                          27-Sep-2020 11:03                2716
function.ibase-connect.php                         27-Sep-2020 11:03                9511
function.ibase-db-info.php                         27-Sep-2020 11:03                2205
function.ibase-delete-user.php                     27-Sep-2020 11:03                3205
function.ibase-drop-db.php                         27-Sep-2020 11:03                3319
function.ibase-errcode.php                         27-Sep-2020 11:03                2311
function.ibase-errmsg.php                          27-Sep-2020 11:03                2304
function.ibase-execute.php                         27-Sep-2020 11:03                6829
function.ibase-fetch-assoc.php                     27-Sep-2020 11:03                4404
function.ibase-fetch-object.php                    27-Sep-2020 11:03                6447
function.ibase-fetch-row.php                       27-Sep-2020 11:03                4171
function.ibase-field-info.php                      27-Sep-2020 11:03                6977
function.ibase-free-event-handler.php              27-Sep-2020 11:03                3180
function.ibase-free-query.php                      27-Sep-2020 11:03                2476
function.ibase-free-result.php                     27-Sep-2020 11:03                2567
function.ibase-gen-id.php                          27-Sep-2020 11:03                2521
function.ibase-maintain-db.php                     27-Sep-2020 11:03                2519
function.ibase-modify-user.php                     27-Sep-2020 11:03                4314
function.ibase-name-result.php                     27-Sep-2020 11:03                5557
function.ibase-num-fields.php                      27-Sep-2020 11:03                6538
function.ibase-num-params.php                      27-Sep-2020 11:03                3220
function.ibase-param-info.php                      27-Sep-2020 11:03                3422
function.ibase-pconnect.php                        27-Sep-2020 11:03                6788
function.ibase-prepare.php                         27-Sep-2020 11:03                3981
function.ibase-query.php                           27-Sep-2020 11:03                6790
function.ibase-restore.php                         27-Sep-2020 11:03                9828
function.ibase-rollback-ret.php                    27-Sep-2020 11:03                2950
function.ibase-rollback.php                        27-Sep-2020 11:03                2759
function.ibase-server-info.php                     27-Sep-2020 11:03               10708
function.ibase-service-attach.php                  27-Sep-2020 11:03               12523
function.ibase-service-detach.php                  27-Sep-2020 11:03                6886
function.ibase-set-event-handler.php               27-Sep-2020 11:03                7542
function.ibase-trans.php                           27-Sep-2020 11:03                5230
function.ibase-wait-event.php                      27-Sep-2020 11:03                3827
function.iconv-get-encoding.php                    27-Sep-2020 11:03                5345
function.iconv-mime-decode-headers.php             27-Sep-2020 11:03                9521
function.iconv-mime-decode.php                     27-Sep-2020 11:03                7399
function.iconv-mime-encode.php                     27-Sep-2020 11:03               11787
function.iconv-set-encoding.php                    27-Sep-2020 11:03                4678
function.iconv-strlen.php                          27-Sep-2020 11:03                3865
function.iconv-strpos.php                          27-Sep-2020 11:03                6396
function.iconv-strrpos.php                         27-Sep-2020 11:03                5444
function.iconv-substr.php                          27-Sep-2020 11:03                7210
function.iconv.php                                 27-Sep-2020 11:03                7215
function.idate.php                                 27-Sep-2020 11:03                9450
function.idn-to-ascii.php                          27-Sep-2020 11:03                6517
function.idn-to-utf8.php                           27-Sep-2020 11:03                6536
function.ifx-affected-rows.php                     27-Sep-2020 11:03                5948
function.ifx-blobinfile-mode.php                   27-Sep-2020 11:03                2490
function.ifx-byteasvarchar.php                     27-Sep-2020 11:03                2811
function.ifx-close.php                             27-Sep-2020 11:03                4616
function.ifx-connect.php                           27-Sep-2020 11:03                5288
function.ifx-copy-blob.php                         27-Sep-2020 11:03                2805
function.ifx-create-blob.php                       27-Sep-2020 11:03                3462
function.ifx-create-char.php                       27-Sep-2020 11:03                2621
function.ifx-do.php                                27-Sep-2020 11:03                4856
function.ifx-error.php                             27-Sep-2020 11:03                3292
function.ifx-errormsg.php                          27-Sep-2020 11:03                3565
function.ifx-fetch-row.php                         27-Sep-2020 11:03                9437
function.ifx-fieldproperties.php                   27-Sep-2020 11:03                4996
function.ifx-fieldtypes.php                        27-Sep-2020 11:03                4797
function.ifx-free-blob.php                         27-Sep-2020 11:03                2665
function.ifx-free-char.php                         27-Sep-2020 11:03                2667
function.ifx-free-result.php                       27-Sep-2020 11:03                3046
function.ifx-get-blob.php                          27-Sep-2020 11:03                2648
function.ifx-get-char.php                          27-Sep-2020 11:03                2638
function.ifx-getsqlca.php                          27-Sep-2020 11:03                5843
function.ifx-htmltbl-result.php                    27-Sep-2020 11:03                6278
function.ifx-nullformat.php                        27-Sep-2020 11:03                2453
function.ifx-num-fields.php                        27-Sep-2020 11:03                4591
function.ifx-num-rows.php                          27-Sep-2020 11:03                3240
function.ifx-pconnect.php                          27-Sep-2020 11:03                4564
function.ifx-prepare.php                           27-Sep-2020 11:03                5417
function.ifx-query.php                             27-Sep-2020 11:03               10948
function.ifx-textasvarchar.php                     27-Sep-2020 11:03                2803
function.ifx-update-blob.php                       27-Sep-2020 11:03                3051
function.ifx-update-char.php                       27-Sep-2020 11:03                3049
function.ifxus-close-slob.php                      27-Sep-2020 11:03                2743
function.ifxus-create-slob.php                     27-Sep-2020 11:03                3162
function.ifxus-free-slob.php                       27-Sep-2020 11:03                2672
function.ifxus-open-slob.php                       27-Sep-2020 11:03                3427
function.ifxus-read-slob.php                       27-Sep-2020 11:03                2978
function.ifxus-seek-slob.php                       27-Sep-2020 11:03                3254
function.ifxus-tell-slob.php                       27-Sep-2020 11:03                2725
function.ifxus-write-slob.php                      27-Sep-2020 11:03                2948
function.ignore-user-abort.php                     27-Sep-2020 11:03                6932
function.iis-add-server.php                        27-Sep-2020 11:03                2466
function.iis-get-dir-security.php                  27-Sep-2020 11:03                1970
function.iis-get-script-map.php                    27-Sep-2020 11:03                2149
function.iis-get-server-by-comment.php             27-Sep-2020 11:03                1931
function.iis-get-server-by-path.php                27-Sep-2020 11:03                2547
function.iis-get-server-rights.php                 27-Sep-2020 11:03                1994
function.iis-get-service-state.php                 27-Sep-2020 11:03                1902
function.iis-remove-server.php                     27-Sep-2020 11:03                1886
function.iis-set-app-settings.php                  27-Sep-2020 11:03                2127
function.iis-set-dir-security.php                  27-Sep-2020 11:03                2098
function.iis-set-script-map.php                    27-Sep-2020 11:03                2344
function.iis-set-server-rights.php                 27-Sep-2020 11:03                2092
function.iis-start-server.php                      27-Sep-2020 11:03                1844
function.iis-start-service.php                     27-Sep-2020 11:03                1845
function.iis-stop-server.php                       27-Sep-2020 11:03                1826
function.iis-stop-service.php                      27-Sep-2020 11:03                1811
function.image-type-to-extension.php               27-Sep-2020 11:03                4862
function.image-type-to-mime-type.php               27-Sep-2020 11:03                7685
function.image2wbmp.php                            27-Sep-2020 11:03                6138
function.imageaffine.php                           27-Sep-2020 11:03                3163
function.imageaffinematrixconcat.php               27-Sep-2020 11:03                6277
function.imageaffinematrixget.php                  27-Sep-2020 11:03                5961
function.imagealphablending.php                    27-Sep-2020 11:03                6570
function.imageantialias.php                        27-Sep-2020 11:03               10486
function.imagearc.php                              27-Sep-2020 11:03               12647
function.imagebmp.php                              27-Sep-2020 11:03                6507
function.imagechar.php                             27-Sep-2020 11:03                8249
function.imagecharup.php                           27-Sep-2020 11:03                8140
function.imagecolorallocate.php                    27-Sep-2020 11:03                8741
function.imagecolorallocatealpha.php               27-Sep-2020 11:03               17330
function.imagecolorat.php                          27-Sep-2020 11:03                9159
function.imagecolorclosest.php                     27-Sep-2020 11:03               11485
function.imagecolorclosestalpha.php                27-Sep-2020 11:03               12598
function.imagecolorclosesthwb.php                  27-Sep-2020 11:03                5470
function.imagecolordeallocate.php                  27-Sep-2020 11:03                4889
function.imagecolorexact.php                       27-Sep-2020 11:03                7455
function.imagecolorexactalpha.php                  27-Sep-2020 11:03                8350
function.imagecolormatch.php                       27-Sep-2020 11:03                7697
function.imagecolorresolve.php                     27-Sep-2020 11:03                6590
function.imagecolorresolvealpha.php                27-Sep-2020 11:03                7253
function.imagecolorset.php                         27-Sep-2020 11:03                7503
function.imagecolorsforindex.php                   27-Sep-2020 11:03                6089
function.imagecolorstotal.php                      27-Sep-2020 11:03                4984
function.imagecolortransparent.php                 27-Sep-2020 11:03                8160
function.imageconvolution.php                      27-Sep-2020 11:03               11067
function.imagecopy.php                             27-Sep-2020 11:03                7571
function.imagecopymerge.php                        27-Sep-2020 11:03                8073
function.imagecopymergegray.php                    27-Sep-2020 11:03                8605
function.imagecopyresampled.php                    27-Sep-2020 11:03               17662
function.imagecopyresized.php                      27-Sep-2020 11:03               12263
function.imagecreate.php                           27-Sep-2020 11:03                7484
function.imagecreatefrombmp.php                    27-Sep-2020 11:03                4595
function.imagecreatefromgd.php                     27-Sep-2020 11:03                5356
function.imagecreatefromgd2.php                    27-Sep-2020 11:03                5557
function.imagecreatefromgd2part.php                27-Sep-2020 11:03                7932
function.imagecreatefromgif.php                    27-Sep-2020 11:03                9807
function.imagecreatefromjpeg.php                   27-Sep-2020 11:03                9037
function.imagecreatefrompng.php                    27-Sep-2020 11:03                8983
function.imagecreatefromstring.php                 27-Sep-2020 11:03                7243
function.imagecreatefromwbmp.php                   27-Sep-2020 11:03                9029
function.imagecreatefromwebp.php                   27-Sep-2020 11:03                4717
function.imagecreatefromxbm.php                    27-Sep-2020 11:03                4587
function.imagecreatefromxpm.php                    27-Sep-2020 11:03                5423
function.imagecreatetruecolor.php                  27-Sep-2020 11:03                6327
function.imagecrop.php                             27-Sep-2020 11:03                6504
function.imagecropauto.php                         27-Sep-2020 11:03                9613
function.imagedashedline.php                       27-Sep-2020 11:03               12457
function.imagedestroy.php                          27-Sep-2020 11:03                3817
function.imageellipse.php                          27-Sep-2020 11:03                8991
function.imagefill.php                             27-Sep-2020 11:03                6485
function.imagefilledarc.php                        27-Sep-2020 11:03               17354
function.imagefilledellipse.php                    27-Sep-2020 11:03                8630
function.imagefilledpolygon.php                    27-Sep-2020 11:03               10451
function.imagefilledrectangle.php                  27-Sep-2020 11:03                7107
function.imagefilltoborder.php                     27-Sep-2020 11:03                9724
function.imagefilter.php                           27-Sep-2020 11:03               33494
function.imageflip.php                             27-Sep-2020 11:03                8594
function.imagefontheight.php                       27-Sep-2020 11:03                5412
function.imagefontwidth.php                        27-Sep-2020 11:03                5384
function.imageftbbox.php                           27-Sep-2020 11:03               13630
function.imagefttext.php                           27-Sep-2020 11:03               14759
function.imagegammacorrect.php                     27-Sep-2020 11:03                4921
function.imagegd.php                               27-Sep-2020 11:03               10021
function.imagegd2.php                              27-Sep-2020 11:03               10196
function.imagegetclip.php                          27-Sep-2020 11:03                5138
function.imagegif.php                              27-Sep-2020 11:03               16747
function.imagegrabscreen.php                       27-Sep-2020 11:03                3726
function.imagegrabwindow.php                       27-Sep-2020 11:03                8623
function.imageinterlace.php                        27-Sep-2020 11:03                4867
function.imageistruecolor.php                      27-Sep-2020 11:03                6809
function.imagejpeg.php                             27-Sep-2020 11:03               14329
function.imagelayereffect.php                      27-Sep-2020 11:03               11289
function.imageline.php                             27-Sep-2020 11:03               15315
function.imageloadfont.php                         27-Sep-2020 11:03                8577
function.imageopenpolygon.php                      27-Sep-2020 11:03                8288
function.imagepalettecopy.php                      27-Sep-2020 11:03                6892
function.imagepalettetotruecolor.php               27-Sep-2020 11:03                9482
function.imagepng.php                              27-Sep-2020 11:03                7369
function.imagepolygon.php                          27-Sep-2020 11:03                8601
function.imagerectangle.php                        27-Sep-2020 11:03                9444
function.imageresolution.php                       27-Sep-2020 11:03                6521
function.imagerotate.php                           27-Sep-2020 11:03                8126
function.imagesavealpha.php                        27-Sep-2020 11:03                5849
function.imagescale.php                            27-Sep-2020 11:03                5639
function.imagesetbrush.php                         27-Sep-2020 11:03                8304
function.imagesetclip.php                          27-Sep-2020 11:03                3901
function.imagesetinterpolation.php                 27-Sep-2020 11:03                8997
function.imagesetpixel.php                         27-Sep-2020 11:03               10637
function.imagesetstyle.php                         27-Sep-2020 11:03               12273
function.imagesetthickness.php                     27-Sep-2020 11:03                7605
function.imagesettile.php                          27-Sep-2020 11:03                7378
function.imagestring.php                           27-Sep-2020 11:03                8515
function.imagestringup.php                         27-Sep-2020 11:03                7612
function.imagesx.php                               27-Sep-2020 11:03                4300
function.imagesy.php                               27-Sep-2020 11:03                4322
function.imagetruecolortopalette.php               27-Sep-2020 11:03                5818
function.imagettfbbox.php                          27-Sep-2020 11:03               18956
function.imagettftext.php                          27-Sep-2020 11:03               16843
function.imagetypes.php                            27-Sep-2020 11:03                4144
function.imagewbmp.php                             27-Sep-2020 11:03               14163
function.imagewebp.php                             27-Sep-2020 11:03                6278
function.imagexbm.php                              27-Sep-2020 11:03               10519
function.imap-8bit.php                             27-Sep-2020 11:03                2713
function.imap-alerts.php                           27-Sep-2020 11:03                2783
function.imap-append.php                           27-Sep-2020 11:03                8574
function.imap-base64.php                           27-Sep-2020 11:03                3101
function.imap-binary.php                           27-Sep-2020 11:03                2674
function.imap-body.php                             27-Sep-2020 11:03                4239
function.imap-bodystruct.php                       27-Sep-2020 11:03                3484
function.imap-check.php                            27-Sep-2020 11:03                4996
function.imap-clearflag-full.php                   27-Sep-2020 11:03                4514
function.imap-close.php                            27-Sep-2020 11:03                3267
function.imap-create.php                           27-Sep-2020 11:03                1619
function.imap-createmailbox.php                    27-Sep-2020 11:03               14724
function.imap-delete.php                           27-Sep-2020 11:03                8604
function.imap-deletemailbox.php                    27-Sep-2020 11:03                3916
function.imap-errors.php                           27-Sep-2020 11:03                2979
function.imap-expunge.php                          27-Sep-2020 11:03                2650
function.imap-fetch-overview.php                   27-Sep-2020 11:03               10240
function.imap-fetchbody.php                        27-Sep-2020 11:03                4689
function.imap-fetchheader.php                      27-Sep-2020 11:03                4481
function.imap-fetchmime.php                        27-Sep-2020 11:03                4893
function.imap-fetchstructure.php                   27-Sep-2020 11:03                8306
function.imap-fetchtext.php                        27-Sep-2020 11:03                1597
function.imap-gc.php                               27-Sep-2020 11:03                4059
function.imap-get-quota.php                        27-Sep-2020 11:03               11750
function.imap-get-quotaroot.php                    27-Sep-2020 11:03                8495
function.imap-getacl.php                           27-Sep-2020 11:03                4732
function.imap-getmailboxes.php                     27-Sep-2020 11:03               11001
function.imap-getsubscribed.php                    27-Sep-2020 11:03                6233
function.imap-header.php                           27-Sep-2020 11:03                1616
function.imap-headerinfo.php                       27-Sep-2020 11:03               10478
function.imap-headers.php                          27-Sep-2020 11:03                2369
function.imap-last-error.php                       27-Sep-2020 11:03                2683
function.imap-list.php                             27-Sep-2020 11:03                7803
function.imap-listmailbox.php                      27-Sep-2020 11:03                1600
function.imap-listscan.php                         27-Sep-2020 11:03                5578
function.imap-listsubscribed.php                   27-Sep-2020 11:03                1618
function.imap-lsub.php                             27-Sep-2020 11:03                4796
function.imap-mail-compose.php                     27-Sep-2020 11:03               10005
function.imap-mail-copy.php                        27-Sep-2020 11:03                4721
function.imap-mail-move.php                        27-Sep-2020 11:03                5068
function.imap-mail.php                             27-Sep-2020 11:03                5335
function.imap-mailboxmsginfo.php                   27-Sep-2020 11:03                9227
function.imap-mime-header-decode.php               27-Sep-2020 11:03                6069
function.imap-msgno.php                            27-Sep-2020 11:03                3212
function.imap-mutf7-to-utf8.php                    27-Sep-2020 11:03                2929
function.imap-num-msg.php                          27-Sep-2020 11:03                2994
function.imap-num-recent.php                       27-Sep-2020 11:03                2963
function.imap-open.php                             27-Sep-2020 11:03               20938
function.imap-ping.php                             27-Sep-2020 11:03                4012
function.imap-qprint.php                           27-Sep-2020 11:03                2720
function.imap-rename.php                           27-Sep-2020 11:03                1622
function.imap-renamemailbox.php                    27-Sep-2020 11:03                4527
function.imap-reopen.php                           27-Sep-2020 11:03                7386
function.imap-rfc822-parse-adrlist.php             27-Sep-2020 11:03                8025
function.imap-rfc822-parse-headers.php             27-Sep-2020 11:03                3427
function.imap-rfc822-write-address.php             27-Sep-2020 11:03                4823
function.imap-savebody.php                         27-Sep-2020 11:03                4977
function.imap-scan.php                             27-Sep-2020 11:03                1589
function.imap-scanmailbox.php                      27-Sep-2020 11:03                1612
function.imap-search.php                           27-Sep-2020 11:03               12241
function.imap-set-quota.php                        27-Sep-2020 11:03                5770
function.imap-setacl.php                           27-Sep-2020 11:03                4229
function.imap-setflag-full.php                     27-Sep-2020 11:03                6822
function.imap-sort.php                             27-Sep-2020 11:03                5717
function.imap-status.php                           27-Sep-2020 11:03                9756
function.imap-subscribe.php                        27-Sep-2020 11:03                3402
function.imap-thread.php                           27-Sep-2020 11:03                7023
function.imap-timeout.php                          27-Sep-2020 11:03                4180
function.imap-uid.php                              27-Sep-2020 11:03                3540
function.imap-undelete.php                         27-Sep-2020 11:03                3711
function.imap-unsubscribe.php                      27-Sep-2020 11:03                3475
function.imap-utf7-decode.php                      27-Sep-2020 11:03                3472
function.imap-utf7-encode.php                      27-Sep-2020 11:03                3154
function.imap-utf8-to-mutf7.php                    27-Sep-2020 11:03                2932
function.imap-utf8.php                             27-Sep-2020 11:03                2897
function.implode.php                               27-Sep-2020 11:03                6663
function.in-array.php                              27-Sep-2020 11:03               11053
function.include-once.php                          27-Sep-2020 11:02                2116
function.include.php                               27-Sep-2020 11:02               21298
function.inet-ntop.php                             27-Sep-2020 11:03                6084
function.inet-pton.php                             27-Sep-2020 11:03                4562
function.inflate-add.php                           27-Sep-2020 11:02                4476
function.inflate-get-read-len.php                  27-Sep-2020 11:02                2429
function.inflate-get-status.php                    27-Sep-2020 11:02                2342
function.inflate-init.php                          27-Sep-2020 11:02                5205
function.ingres-autocommit-state.php               27-Sep-2020 11:03                3127
function.ingres-autocommit.php                     27-Sep-2020 11:03                4730
function.ingres-charset.php                        27-Sep-2020 11:03                4852
function.ingres-close.php                          27-Sep-2020 11:03                3299
function.ingres-commit.php                         27-Sep-2020 11:03                3980
function.ingres-connect.php                        27-Sep-2020 11:03               15718
function.ingres-cursor.php                         27-Sep-2020 11:03                4613
function.ingres-errno.php                          27-Sep-2020 11:03                5881
function.ingres-error.php                          27-Sep-2020 11:03                5774
function.ingres-errsqlstate.php                    27-Sep-2020 11:03                5961
function.ingres-escape-string.php                  27-Sep-2020 11:03                6143
function.ingres-execute.php                        27-Sep-2020 11:03                6236
function.ingres-fetch-array.php                    27-Sep-2020 11:03               10402
function.ingres-fetch-assoc.php                    27-Sep-2020 11:03                7447
function.ingres-fetch-object.php                   27-Sep-2020 11:03                7503
function.ingres-fetch-proc-return.php              27-Sep-2020 11:03                7178
function.ingres-fetch-row.php                      27-Sep-2020 11:03                7016
function.ingres-field-length.php                   27-Sep-2020 11:03                5609
function.ingres-field-name.php                     27-Sep-2020 11:03                5442
function.ingres-field-nullable.php                 27-Sep-2020 11:03                5526
function.ingres-field-precision.php                27-Sep-2020 11:03                5641
function.ingres-field-scale.php                    27-Sep-2020 11:03                5603
function.ingres-field-type.php                     27-Sep-2020 11:03                6180
function.ingres-free-result.php                    27-Sep-2020 11:03                5038
function.ingres-next-error.php                     27-Sep-2020 11:03                3955
function.ingres-num-fields.php                     27-Sep-2020 11:03                3756
function.ingres-num-rows.php                       27-Sep-2020 11:03                4896
function.ingres-pconnect.php                       27-Sep-2020 11:03                4934
function.ingres-prepare.php                        27-Sep-2020 11:03                7676
function.ingres-query.php                          27-Sep-2020 11:03               20607
function.ingres-result-seek.php                    27-Sep-2020 11:03                8120
function.ingres-rollback.php                       27-Sep-2020 11:03                3490
function.ingres-set-environment.php                27-Sep-2020 11:03               13077
function.ingres-unbuffered-query.php               27-Sep-2020 11:03               16497
function.ini-alter.php                             27-Sep-2020 11:02                1556
function.ini-get-all.php                           27-Sep-2020 11:02                9255
function.ini-get.php                               27-Sep-2020 11:02               10914
function.ini-restore.php                           27-Sep-2020 11:02                6395
function.ini-set.php                               27-Sep-2020 11:02                5316
function.inotify-add-watch.php                     27-Sep-2020 11:03                3828
function.inotify-init.php                          27-Sep-2020 11:03                9043
function.inotify-queue-len.php                     27-Sep-2020 11:03                3625
function.inotify-read.php                          27-Sep-2020 11:03                4251
function.inotify-rm-watch.php                      27-Sep-2020 11:03                3301
function.intdiv.php                                27-Sep-2020 11:03                7195
function.interface-exists.php                      27-Sep-2020 11:03                5029
function.intl-error-name.php                       27-Sep-2020 11:03                4952
function.intl-get-error-code.php                   27-Sep-2020 11:03                4337
function.intl-get-error-message.php                27-Sep-2020 11:03                4330
function.intl-is-failure.php                       27-Sep-2020 11:03                5398
function.intval.php                                27-Sep-2020 11:03               13835
function.ip2long.php                               27-Sep-2020 11:03                9637
function.iptcembed.php                             27-Sep-2020 11:03               12648
function.iptcparse.php                             27-Sep-2020 11:03                4315
function.is-a.php                                  27-Sep-2020 11:03                6579
function.is-array.php                              27-Sep-2020 11:03                5437
function.is-bool.php                               27-Sep-2020 11:03                5629
function.is-callable.php                           27-Sep-2020 11:03               10205
function.is-countable.php                          27-Sep-2020 11:03                6188
function.is-dir.php                                27-Sep-2020 11:03                6325
function.is-double.php                             27-Sep-2020 11:03                1561
function.is-executable.php                         27-Sep-2020 11:03                5284
function.is-file.php                               27-Sep-2020 11:03                5526
function.is-finite.php                             27-Sep-2020 11:03                2949
function.is-float.php                              27-Sep-2020 11:03                5014
function.is-infinite.php                           27-Sep-2020 11:03                3034
function.is-int.php                                27-Sep-2020 11:03                6582
function.is-integer.php                            27-Sep-2020 11:03                1553
function.is-iterable.php                           27-Sep-2020 11:03                5688
function.is-link.php                               27-Sep-2020 11:03                5382
function.is-long.php                               27-Sep-2020 11:03                1537
function.is-nan.php                                27-Sep-2020 11:03                4362
function.is-null.php                               27-Sep-2020 11:03                5776
function.is-numeric.php                            27-Sep-2020 11:03                9253
function.is-object.php                             27-Sep-2020 11:03                7153
function.is-readable.php                           27-Sep-2020 11:03                5997
function.is-real.php                               27-Sep-2020 11:03                1549
function.is-resource.php                           27-Sep-2020 11:03                4936
function.is-scalar.php                             27-Sep-2020 11:03                8182
function.is-soap-fault.php                         27-Sep-2020 11:03                8046
function.is-string.php                             27-Sep-2020 11:03                6684
function.is-subclass-of.php                        27-Sep-2020 11:03               13160
function.is-tainted.php                            27-Sep-2020 11:03                2143
function.is-uploaded-file.php                      27-Sep-2020 11:03                6605
function.is-writable.php                           27-Sep-2020 11:03                5670
function.is-writeable.php                          27-Sep-2020 11:03                1593
function.isset.php                                 27-Sep-2020 11:03               16796
function.iterator-apply.php                        27-Sep-2020 11:03                6470
function.iterator-count.php                        27-Sep-2020 11:03                7779
function.iterator-to-array.php                     27-Sep-2020 11:03                6696
function.jddayofweek.php                           27-Sep-2020 11:03                3420
function.jdmonthname.php                           27-Sep-2020 11:03                4324
function.jdtofrench.php                            27-Sep-2020 11:03                2929
function.jdtogregorian.php                         27-Sep-2020 11:03                2951
function.jdtojewish.php                            27-Sep-2020 11:03                6976
function.jdtojulian.php                            27-Sep-2020 11:03                2932
function.jdtounix.php                              27-Sep-2020 11:03                2948
function.jewishtojd.php                            27-Sep-2020 11:03                4326
function.join.php                                  27-Sep-2020 11:03                1513
function.jpeg2wbmp.php                             27-Sep-2020 11:03                6342
function.json-decode.php                           27-Sep-2020 11:03               20620
function.json-encode.php                           27-Sep-2020 11:03               29634
function.json-last-error-msg.php                   27-Sep-2020 11:03                2919
function.json-last-error.php                       27-Sep-2020 11:03               14621
function.judy-type.php                             27-Sep-2020 11:03                2543
function.judy-version.php                          27-Sep-2020 11:03                2076
function.juliantojd.php                            27-Sep-2020 11:03                4168
function.key-exists.php                            27-Sep-2020 11:03                1585
function.key.php                                   27-Sep-2020 11:03                6957
function.krsort.php                                27-Sep-2020 11:03                5666
function.ksort.php                                 27-Sep-2020 11:03                5446
function.lcfirst.php                               27-Sep-2020 11:03                5407
function.lcg-value.php                             27-Sep-2020 11:03                3199
function.lchgrp.php                                27-Sep-2020 11:03                5900
function.lchown.php                                27-Sep-2020 11:03                5756
function.ldap-8859-to-t61.php                      27-Sep-2020 11:03                2928
function.ldap-add-ext.php                          27-Sep-2020 11:03                3629
function.ldap-add.php                              27-Sep-2020 11:03                9580
function.ldap-bind-ext.php                         27-Sep-2020 11:03                3521
function.ldap-bind.php                             27-Sep-2020 11:03                8925
function.ldap-close.php                            27-Sep-2020 11:03                1571
function.ldap-compare.php                          27-Sep-2020 11:03                9939
function.ldap-connect.php                          27-Sep-2020 11:03                8101
function.ldap-control-paged-result-response.php    27-Sep-2020 11:03                4864
function.ldap-control-paged-result.php             27-Sep-2020 11:03               15077
function.ldap-count-entries.php                    27-Sep-2020 11:03                4233
function.ldap-delete-ext.php                       27-Sep-2020 11:03                3330
function.ldap-delete.php                           27-Sep-2020 11:03                4126
function.ldap-dn2ufn.php                           27-Sep-2020 11:03                2303
function.ldap-err2str.php                          27-Sep-2020 11:03                4536
function.ldap-errno.php                            27-Sep-2020 11:03                6930
function.ldap-error.php                            27-Sep-2020 11:03                3568
function.ldap-escape.php                           27-Sep-2020 11:03                6257
function.ldap-exop-passwd.php                      27-Sep-2020 11:03                9714
function.ldap-exop-refresh.php                     27-Sep-2020 11:03                3889
function.ldap-exop-whoami.php                      27-Sep-2020 11:03                2767
function.ldap-exop.php                             27-Sep-2020 11:03               11588
function.ldap-explode-dn.php                       27-Sep-2020 11:03                3209
function.ldap-first-attribute.php                  27-Sep-2020 11:03                4496
function.ldap-first-entry.php                      27-Sep-2020 11:03                3636
function.ldap-first-reference.php                  27-Sep-2020 11:03                1977
function.ldap-free-result.php                      27-Sep-2020 11:03                2779
function.ldap-get-attributes.php                   27-Sep-2020 11:03                7109
function.ldap-get-dn.php                           27-Sep-2020 11:03                2688
function.ldap-get-entries.php                      27-Sep-2020 11:03                4261
function.ldap-get-option.php                       27-Sep-2020 11:03               10933
function.ldap-get-values-len.php                   27-Sep-2020 11:03                3836
function.ldap-get-values.php                       27-Sep-2020 11:03                7410
function.ldap-list.php                             27-Sep-2020 11:03               11586
function.ldap-mod-add.php                          27-Sep-2020 11:03                5475
function.ldap-mod-del.php                          27-Sep-2020 11:03                5040
function.ldap-mod-replace.php                      27-Sep-2020 11:03                5416
function.ldap-mod_add-ext.php                      27-Sep-2020 11:03                3458
function.ldap-mod_del-ext.php                      27-Sep-2020 11:03                3474
function.ldap-mod_replace-ext.php                  27-Sep-2020 11:03                3528
function.ldap-modify-batch.php                     27-Sep-2020 11:03               19814
function.ldap-modify.php                           27-Sep-2020 11:03                1987
function.ldap-next-attribute.php                   27-Sep-2020 11:03                3976
function.ldap-next-entry.php                       27-Sep-2020 11:03                3897
function.ldap-next-reference.php                   27-Sep-2020 11:03                1961
function.ldap-parse-exop.php                       27-Sep-2020 11:03                3786
function.ldap-parse-reference.php                  27-Sep-2020 11:03                2113
function.ldap-parse-result.php                     27-Sep-2020 11:03                7840
function.ldap-read.php                             27-Sep-2020 11:03                8709
function.ldap-rename-ext.php                       27-Sep-2020 11:03                3639
function.ldap-rename.php                           27-Sep-2020 11:03                5637
function.ldap-sasl-bind.php                        27-Sep-2020 11:03                3969
function.ldap-search.php                           27-Sep-2020 11:03               12821
function.ldap-set-option.php                       27-Sep-2020 11:03               13785
function.ldap-set-rebind-proc.php                  27-Sep-2020 11:03                2058
function.ldap-sort.php                             27-Sep-2020 11:03                6611
function.ldap-start-tls.php                        27-Sep-2020 11:03                1791
function.ldap-t61-to-8859.php                      27-Sep-2020 11:03                1840
function.ldap-unbind.php                           27-Sep-2020 11:03                2748
function.levenshtein.php                           27-Sep-2020 11:03               12661
function.libxml-clear-errors.php                   27-Sep-2020 11:03                2572
function.libxml-disable-entity-loader.php          27-Sep-2020 11:03                3632
function.libxml-get-errors.php                     27-Sep-2020 11:03               11705
function.libxml-get-last-error.php                 27-Sep-2020 11:03                2763
function.libxml-set-external-entity-loader.php     27-Sep-2020 11:03                7939
function.libxml-set-streams-context.php            27-Sep-2020 11:03                5057
function.libxml-use-internal-errors.php            27-Sep-2020 11:03                5778
function.link.php                                  27-Sep-2020 11:03                5118
function.linkinfo.php                              27-Sep-2020 11:03                4201
function.list.php                                  27-Sep-2020 11:03               21757
function.localeconv.php                            27-Sep-2020 11:03                8953
function.localtime.php                             27-Sep-2020 11:03                8167
function.log-cmd-delete.php                        27-Sep-2020 11:03                6259
function.log-cmd-insert.php                        27-Sep-2020 11:03                5848
function.log-cmd-update.php                        27-Sep-2020 11:03                6528
function.log-getmore.php                           27-Sep-2020 11:03                4073
function.log-killcursor.php                        27-Sep-2020 11:03                3821
function.log-reply.php                             27-Sep-2020 11:03                5513
function.log-write-batch.php                       27-Sep-2020 11:03                5812
function.log.php                                   27-Sep-2020 11:03                3543
function.log10.php                                 27-Sep-2020 11:03                2494
function.log1p.php                                 27-Sep-2020 11:03                3299
function.long2ip.php                               27-Sep-2020 11:03                4109
function.lstat.php                                 27-Sep-2020 11:03                5991
function.ltrim.php                                 27-Sep-2020 11:03                9535
function.lzf-compress.php                          27-Sep-2020 11:02                2709
function.lzf-decompress.php                        27-Sep-2020 11:02                2796
function.lzf-optimized-for.php                     27-Sep-2020 11:02                1921
function.mail.php                                  27-Sep-2020 11:03               26922
function.mailparse-determine-best-xfer-encoding..> 27-Sep-2020 11:03                4061
function.mailparse-msg-create.php                  27-Sep-2020 11:03                2602
function.mailparse-msg-extract-part-file.php       27-Sep-2020 11:03                4880
function.mailparse-msg-extract-part.php            27-Sep-2020 11:03                3855
function.mailparse-msg-extract-whole-part-file.php 27-Sep-2020 11:03                3836
function.mailparse-msg-free.php                    27-Sep-2020 11:03                3326
function.mailparse-msg-get-part-data.php           27-Sep-2020 11:03                2341
function.mailparse-msg-get-part.php                27-Sep-2020 11:03                2571
function.mailparse-msg-get-structure.php           27-Sep-2020 11:03                2361
function.mailparse-msg-parse-file.php              27-Sep-2020 11:03                3516
function.mailparse-msg-parse.php                   27-Sep-2020 11:03                3162
function.mailparse-rfc822-parse-addresses.php      27-Sep-2020 11:03                5345
function.mailparse-stream-encode.php               27-Sep-2020 11:03                5552
function.mailparse-uudecode-all.php                27-Sep-2020 11:03                6794
function.main.php                                  27-Sep-2020 11:02                3767
function.max.php                                   27-Sep-2020 11:03               12818
function.maxdb-affected-rows.php                   27-Sep-2020 11:03               17182
function.maxdb-autocommit.php                      27-Sep-2020 11:03                7326
function.maxdb-bind-param.php                      27-Sep-2020 11:03                1871
function.maxdb-bind-result.php                     27-Sep-2020 11:03                1882
function.maxdb-change-user.php                     27-Sep-2020 11:03               13037
function.maxdb-character-set-name.php              27-Sep-2020 11:03                8314
function.maxdb-client-encoding.php                 27-Sep-2020 11:03                1938
function.maxdb-close-long-data.php                 27-Sep-2020 11:03                2031
function.maxdb-close.php                           27-Sep-2020 11:03                3318
function.maxdb-commit.php                          27-Sep-2020 11:03               11349
function.maxdb-connect-errno.php                   27-Sep-2020 11:03                5235
function.maxdb-connect-error.php                   27-Sep-2020 11:03                5497
function.maxdb-connect.php                         27-Sep-2020 11:03                9403
function.maxdb-data-seek.php                       27-Sep-2020 11:03               12023
function.maxdb-debug.php                           27-Sep-2020 11:03                5031
function.maxdb-disable-reads-from-master.php       27-Sep-2020 11:03                2410
function.maxdb-disable-rpl-parse.php               27-Sep-2020 11:03                1910
function.maxdb-dump-debug-info.php                 27-Sep-2020 11:03                1904
function.maxdb-embedded-connect.php                27-Sep-2020 11:03                1935
function.maxdb-enable-reads-from-master.php        27-Sep-2020 11:03                1950
function.maxdb-enable-rpl-parse.php                27-Sep-2020 11:03                1880
function.maxdb-errno.php                           27-Sep-2020 11:03                8600
function.maxdb-error.php                           27-Sep-2020 11:03                8871
function.maxdb-escape-string.php                   27-Sep-2020 11:03                1681
function.maxdb-execute.php                         27-Sep-2020 11:03                1848
function.maxdb-fetch-array.php                     27-Sep-2020 11:03               17338
function.maxdb-fetch-assoc.php                     27-Sep-2020 11:03               12344
function.maxdb-fetch-field-direct.php              27-Sep-2020 11:03               14912
function.maxdb-fetch-field.php                     27-Sep-2020 11:03               15158
function.maxdb-fetch-fields.php                    27-Sep-2020 11:03               15198
function.maxdb-fetch-lengths.php                   27-Sep-2020 11:03               11162
function.maxdb-fetch-object.php                    27-Sep-2020 11:03               11890
function.maxdb-fetch-row.php                       27-Sep-2020 11:03               12060
function.maxdb-fetch.php                           27-Sep-2020 11:03                1820
function.maxdb-field-count.php                     27-Sep-2020 11:03               11004
function.maxdb-field-seek.php                      27-Sep-2020 11:03               13930
function.maxdb-field-tell.php                      27-Sep-2020 11:03               15183
function.maxdb-free-result.php                     27-Sep-2020 11:03                4231
function.maxdb-get-client-info.php                 27-Sep-2020 11:03                4169
function.maxdb-get-client-version.php              27-Sep-2020 11:03                4326
function.maxdb-get-host-info.php                   27-Sep-2020 11:03                7425
function.maxdb-get-metadata.php                    27-Sep-2020 11:03                1916
function.maxdb-get-proto-info.php                  27-Sep-2020 11:03                7395
function.maxdb-get-server-info.php                 27-Sep-2020 11:03                7829
function.maxdb-get-server-version.php              27-Sep-2020 11:03                8050
function.maxdb-info.php                            27-Sep-2020 11:03               10185
function.maxdb-init.php                            27-Sep-2020 11:03                3446
function.maxdb-insert-id.php                       27-Sep-2020 11:03               11892
function.maxdb-kill.php                            27-Sep-2020 11:03                9741
function.maxdb-master-query.php                    27-Sep-2020 11:03                1985
function.maxdb-more-results.php                    27-Sep-2020 11:03                3574
function.maxdb-multi-query.php                     27-Sep-2020 11:03               13743
function.maxdb-next-result.php                     27-Sep-2020 11:03                3193
function.maxdb-num-fields.php                      27-Sep-2020 11:03                9308
function.maxdb-num-rows.php                        27-Sep-2020 11:03               10390
function.maxdb-options.php                         27-Sep-2020 11:03                6849
function.maxdb-param-count.php                     27-Sep-2020 11:03                1862
function.maxdb-ping.php                            27-Sep-2020 11:03                8242
function.maxdb-prepare.php                         27-Sep-2020 11:03               15318
function.maxdb-query.php                           27-Sep-2020 11:03               13361
function.maxdb-real-connect.php                    27-Sep-2020 11:03               12529
function.maxdb-real-escape-string.php              27-Sep-2020 11:03               12593
function.maxdb-real-query.php                      27-Sep-2020 11:03                3831
function.maxdb-report.php                          27-Sep-2020 11:03                5066
function.maxdb-rollback.php                        27-Sep-2020 11:03               16475
function.maxdb-rpl-parse-enabled.php               27-Sep-2020 11:03                1875
function.maxdb-rpl-probe.php                       27-Sep-2020 11:03                1828
function.maxdb-rpl-query-type.php                  27-Sep-2020 11:03                2256
function.maxdb-select-db.php                       27-Sep-2020 11:03               13709
function.maxdb-send-long-data.php                  27-Sep-2020 11:03                1914
function.maxdb-send-query.php                      27-Sep-2020 11:03                2408
function.maxdb-server-end.php                      27-Sep-2020 11:03                1799
function.maxdb-server-init.php                     27-Sep-2020 11:03                1943
function.maxdb-set-opt.php                         27-Sep-2020 11:03                1615
function.maxdb-sqlstate.php                        27-Sep-2020 11:03                8815
function.maxdb-ssl-set.php                         27-Sep-2020 11:03                3243
function.maxdb-stat.php                            27-Sep-2020 11:03                7038
function.maxdb-stmt-affected-rows.php              27-Sep-2020 11:03               12764
function.maxdb-stmt-bind-param.php                 27-Sep-2020 11:03               38134
function.maxdb-stmt-bind-result.php                27-Sep-2020 11:03               14711
function.maxdb-stmt-close-long-data.php            27-Sep-2020 11:03                3814
function.maxdb-stmt-close.php                      27-Sep-2020 11:03                3089
function.maxdb-stmt-data-seek.php                  27-Sep-2020 11:03               13453
function.maxdb-stmt-errno.php                      27-Sep-2020 11:03               12539
function.maxdb-stmt-error.php                      27-Sep-2020 11:03               12311
function.maxdb-stmt-execute.php                    27-Sep-2020 11:03               19474
function.maxdb-stmt-fetch.php                      27-Sep-2020 11:03               13338
function.maxdb-stmt-free-result.php                27-Sep-2020 11:03                3240
function.maxdb-stmt-init.php                       27-Sep-2020 11:03                3226
function.maxdb-stmt-num-rows.php                   27-Sep-2020 11:03               10818
function.maxdb-stmt-param-count.php                27-Sep-2020 11:03                9132
function.maxdb-stmt-prepare.php                    27-Sep-2020 11:03               16011
function.maxdb-stmt-reset.php                      27-Sep-2020 11:03                2251
function.maxdb-stmt-result-metadata.php            27-Sep-2020 11:03               14225
function.maxdb-stmt-send-long-data.php             27-Sep-2020 11:03                4503
function.maxdb-stmt-sqlstate.php                   27-Sep-2020 11:03               12496
function.maxdb-stmt-store-result.php               27-Sep-2020 11:03               11669
function.maxdb-store-result.php                    27-Sep-2020 11:03                3279
function.maxdb-thread-id.php                       27-Sep-2020 11:03               10254
function.maxdb-thread-safe.php                     27-Sep-2020 11:03                2084
function.maxdb-use-result.php                      27-Sep-2020 11:03               12941
function.maxdb-warning-count.php                   27-Sep-2020 11:03                9829
function.mb-check-encoding.php                     27-Sep-2020 11:03                4081
function.mb-chr.php                                27-Sep-2020 11:03                3058
function.mb-convert-case.php                       27-Sep-2020 11:03               11086
function.mb-convert-encoding.php                   27-Sep-2020 11:03                8325
function.mb-convert-kana.php                       27-Sep-2020 11:03                8654
function.mb-convert-variables.php                  27-Sep-2020 11:03                6204
function.mb-decode-mimeheader.php                  27-Sep-2020 11:03                3063
function.mb-decode-numericentity.php               27-Sep-2020 11:03               35916
function.mb-detect-encoding.php                    27-Sep-2020 11:03                6931
function.mb-detect-order.php                       27-Sep-2020 11:03                8111
function.mb-encode-mimeheader.php                  27-Sep-2020 11:03                8141
function.mb-encode-numericentity.php               27-Sep-2020 11:03               12680
function.mb-encoding-aliases.php                   27-Sep-2020 11:03                5530
function.mb-ereg-match.php                         27-Sep-2020 11:03                4340
function.mb-ereg-replace-callback.php              27-Sep-2020 11:03               11923
function.mb-ereg-replace.php                       27-Sep-2020 11:03                5830
function.mb-ereg-search-getpos.php                 27-Sep-2020 11:03                3771
function.mb-ereg-search-getregs.php                27-Sep-2020 11:03                4081
function.mb-ereg-search-init.php                   27-Sep-2020 11:03                4787
function.mb-ereg-search-pos.php                    27-Sep-2020 11:03                4650
function.mb-ereg-search-regs.php                   27-Sep-2020 11:03                4400
function.mb-ereg-search-setpos.php                 27-Sep-2020 11:03                4251
function.mb-ereg-search.php                        27-Sep-2020 11:03                4415
function.mb-ereg.php                               27-Sep-2020 11:03                5781
function.mb-eregi-replace.php                      27-Sep-2020 11:03                5706
function.mb-eregi.php                              27-Sep-2020 11:03                5824
function.mb-get-info.php                           27-Sep-2020 11:03                3905
function.mb-http-input.php                         27-Sep-2020 11:03                3738
function.mb-http-output.php                        27-Sep-2020 11:03                4027
function.mb-internal-encoding.php                  27-Sep-2020 11:03                5270
function.mb-language.php                           27-Sep-2020 11:03                5630
function.mb-list-encodings.php                     27-Sep-2020 11:03                4583
function.mb-ord.php                                27-Sep-2020 11:03                3089
function.mb-output-handler.php                     27-Sep-2020 11:03                4998
function.mb-parse-str.php                          27-Sep-2020 11:03                4342
function.mb-preferred-mime-name.php                27-Sep-2020 11:03                4073
function.mb-regex-encoding.php                     27-Sep-2020 11:03                4038
function.mb-regex-set-options.php                  27-Sep-2020 11:03                5887
function.mb-scrub.php                              27-Sep-2020 11:03                2469
function.mb-send-mail.php                          27-Sep-2020 11:03                9048
function.mb-split.php                              27-Sep-2020 11:03                4371
function.mb-str-split.php                          27-Sep-2020 11:03                4286
function.mb-strcut.php                             27-Sep-2020 11:03                6298
function.mb-strimwidth.php                         27-Sep-2020 11:03                6447
function.mb-stripos.php                            27-Sep-2020 11:03                5448
function.mb-stristr.php                            27-Sep-2020 11:03                5242
function.mb-strlen.php                             27-Sep-2020 11:03                4229
function.mb-strpos.php                             27-Sep-2020 11:03                5501
function.mb-strrchr.php                            27-Sep-2020 11:03                5067
function.mb-strrichr.php                           27-Sep-2020 11:03                5110
function.mb-strripos.php                           27-Sep-2020 11:03                5045
function.mb-strrpos.php                            27-Sep-2020 11:03                5862
function.mb-strstr.php                             27-Sep-2020 11:03                5049
function.mb-strtolower.php                         27-Sep-2020 11:03                6986
function.mb-strtoupper.php                         27-Sep-2020 11:03                6990
function.mb-strwidth.php                           27-Sep-2020 11:03                6801
function.mb-substitute-character.php               27-Sep-2020 11:03                6069
function.mb-substr-count.php                       27-Sep-2020 11:03                5244
function.mb-substr.php                             27-Sep-2020 11:03                5290
function.mcrypt-cbc.php                            27-Sep-2020 11:03                3680
function.mcrypt-cfb.php                            27-Sep-2020 11:03                3692
function.mcrypt-create-iv.php                      27-Sep-2020 11:03                6440
function.mcrypt-decrypt.php                        27-Sep-2020 11:03                5895
function.mcrypt-ecb.php                            27-Sep-2020 11:03                3635
function.mcrypt-enc-get-algorithms-name.php        27-Sep-2020 11:03                5173
function.mcrypt-enc-get-block-size.php             27-Sep-2020 11:03                2821
function.mcrypt-enc-get-iv-size.php                27-Sep-2020 11:03                2949
function.mcrypt-enc-get-key-size.php               27-Sep-2020 11:03                2827
function.mcrypt-enc-get-modes-name.php             27-Sep-2020 11:03                5108
function.mcrypt-enc-get-supported-key-sizes.php    27-Sep-2020 11:03                4858
function.mcrypt-enc-is-block-algorithm-mode.php    27-Sep-2020 11:03                3179
function.mcrypt-enc-is-block-algorithm.php         27-Sep-2020 11:03                3008
function.mcrypt-enc-is-block-mode.php              27-Sep-2020 11:03                3017
function.mcrypt-enc-self-test.php                  27-Sep-2020 11:03                2920
function.mcrypt-encrypt.php                        27-Sep-2020 11:03               16236
function.mcrypt-generic-deinit.php                 27-Sep-2020 11:03                3762
function.mcrypt-generic-end.php                    27-Sep-2020 11:03                3057
function.mcrypt-generic-init.php                   27-Sep-2020 11:03                4905
function.mcrypt-generic.php                        27-Sep-2020 11:03                5686
function.mcrypt-get-block-size.php                 27-Sep-2020 11:03                6113
function.mcrypt-get-cipher-name.php                27-Sep-2020 11:03                4700
function.mcrypt-get-iv-size.php                    27-Sep-2020 11:03                6330
function.mcrypt-get-key-size.php                   27-Sep-2020 11:03                6256
function.mcrypt-list-algorithms.php                27-Sep-2020 11:03                4599
function.mcrypt-list-modes.php                     27-Sep-2020 11:03                4627
function.mcrypt-module-close.php                   27-Sep-2020 11:03                3187
function.mcrypt-module-get-algo-block-size.php     27-Sep-2020 11:03                3246
function.mcrypt-module-get-algo-key-size.php       27-Sep-2020 11:03                3315
function.mcrypt-module-get-supported-key-sizes.php 27-Sep-2020 11:03                4392
function.mcrypt-module-is-block-algorithm-mode.php 27-Sep-2020 11:03                3822
function.mcrypt-module-is-block-algorithm.php      27-Sep-2020 11:03                3574
function.mcrypt-module-is-block-mode.php           27-Sep-2020 11:03                3863
function.mcrypt-module-open.php                    27-Sep-2020 11:03               14664
function.mcrypt-module-self-test.php               27-Sep-2020 11:03                4682
function.mcrypt-ofb.php                            27-Sep-2020 11:03                3719
function.md5-file.php                              27-Sep-2020 11:03                4823
function.md5.php                                   27-Sep-2020 11:03                5797
function.mdecrypt-generic.php                      27-Sep-2020 11:03               11564
function.memcache-debug.php                        27-Sep-2020 11:03                3110
function.memory-get-peak-usage.php                 27-Sep-2020 11:02                3156
function.memory-get-usage.php                      27-Sep-2020 11:02                5379
function.metaphone.php                             27-Sep-2020 11:03                5941
function.method-exists.php                         27-Sep-2020 11:03                6161
function.mhash-count.php                           27-Sep-2020 11:03                3651
function.mhash-get-block-size.php                  27-Sep-2020 11:03                3330
function.mhash-get-hash-name.php                   27-Sep-2020 11:03                3286
function.mhash-keygen-s2k.php                      27-Sep-2020 11:03                4179
function.mhash.php                                 27-Sep-2020 11:03                3168
function.microtime.php                             27-Sep-2020 11:03               10560
function.mime-content-type.php                     27-Sep-2020 11:03                4520
function.min.php                                   27-Sep-2020 11:03               13446
function.mkdir.php                                 27-Sep-2020 11:03                7824
function.mktime.php                                27-Sep-2020 11:03               19458
function.money-format.php                          27-Sep-2020 11:03               18962
function.mongodb.bson-fromjson.php                 27-Sep-2020 11:03                5769
function.mongodb.bson-fromphp.php                  27-Sep-2020 11:03                5808
function.mongodb.bson-tocanonicalextendedjson.php  27-Sep-2020 11:03               16114
function.mongodb.bson-tojson.php                   27-Sep-2020 11:03               17574
function.mongodb.bson-tophp.php                    27-Sep-2020 11:03                8824
function.mongodb.bson-torelaxedextendedjson.php    27-Sep-2020 11:03               15815
function.mongodb.driver.monitoring.addsubscribe..> 27-Sep-2020 11:03                4533
function.mongodb.driver.monitoring.removesubscr..> 27-Sep-2020 11:03                4611
function.move-uploaded-file.php                    27-Sep-2020 11:03                8644
function.mqseries-back.php                         27-Sep-2020 11:03                6371
function.mqseries-begin.php                        27-Sep-2020 11:03                7735
function.mqseries-close.php                        27-Sep-2020 11:03                6322
function.mqseries-cmit.php                         27-Sep-2020 11:03                6318
function.mqseries-conn.php                         27-Sep-2020 11:03                5734
function.mqseries-connx.php                        27-Sep-2020 11:03               14143
function.mqseries-disc.php                         27-Sep-2020 11:03                5571
function.mqseries-get.php                          27-Sep-2020 11:03               12834
function.mqseries-inq.php                          27-Sep-2020 11:03                8850
function.mqseries-open.php                         27-Sep-2020 11:03                7412
function.mqseries-put.php                          27-Sep-2020 11:03               13857
function.mqseries-put1.php                         27-Sep-2020 11:03                5650
function.mqseries-set.php                          27-Sep-2020 11:03                5319
function.mqseries-strerror.php                     27-Sep-2020 11:03                4211
function.msg-get-queue.php                         27-Sep-2020 11:03                4346
function.msg-queue-exists.php                      27-Sep-2020 11:03                3124
function.msg-receive.php                           27-Sep-2020 11:03                9252
function.msg-remove-queue.php                      27-Sep-2020 11:03                3573
function.msg-send.php                              27-Sep-2020 11:03                7426
function.msg-set-queue.php                         27-Sep-2020 11:03                4187
function.msg-stat-queue.php                        27-Sep-2020 11:03                5460
function.msql-affected-rows.php                    27-Sep-2020 11:03                2965
function.msql-close.php                            27-Sep-2020 11:03                3632
function.msql-connect.php                          27-Sep-2020 11:03                4030
function.msql-create-db.php                        27-Sep-2020 11:03                3363
function.msql-createdb.php                         27-Sep-2020 11:03                1615
function.msql-data-seek.php                        27-Sep-2020 11:03                3982
function.msql-db-query.php                         27-Sep-2020 11:03                3573
function.msql-dbname.php                           27-Sep-2020 11:03                1586
function.msql-drop-db.php                          27-Sep-2020 11:03                3331
function.msql-error.php                            27-Sep-2020 11:03                2055
function.msql-fetch-array.php                      27-Sep-2020 11:03                8038
function.msql-fetch-field.php                      27-Sep-2020 11:03                4200
function.msql-fetch-object.php                     27-Sep-2020 11:03                7638
function.msql-fetch-row.php                        27-Sep-2020 11:03                7231
function.msql-field-flags.php                      27-Sep-2020 11:03                3120
function.msql-field-len.php                        27-Sep-2020 11:03                2883
function.msql-field-name.php                       27-Sep-2020 11:03                3263
function.msql-field-seek.php                       27-Sep-2020 11:03                3402
function.msql-field-table.php                      27-Sep-2020 11:03                2853
function.msql-field-type.php                       27-Sep-2020 11:03                3135
function.msql-fieldflags.php                       27-Sep-2020 11:03                1631
function.msql-fieldlen.php                         27-Sep-2020 11:03                1613
function.msql-fieldname.php                        27-Sep-2020 11:03                1621
function.msql-fieldtable.php                       27-Sep-2020 11:03                1631
function.msql-fieldtype.php                        27-Sep-2020 11:03                1627
function.msql-free-result.php                      27-Sep-2020 11:03                2836
function.msql-list-dbs.php                         27-Sep-2020 11:03                3551
function.msql-list-fields.php                      27-Sep-2020 11:03                4004
function.msql-list-tables.php                      27-Sep-2020 11:03                3777
function.msql-num-fields.php                       27-Sep-2020 11:03                3253
function.msql-num-rows.php                         27-Sep-2020 11:03                2897
function.msql-numfields.php                        27-Sep-2020 11:03                1617
function.msql-numrows.php                          27-Sep-2020 11:03                1601
function.msql-pconnect.php                         27-Sep-2020 11:03                4212
function.msql-query.php                            27-Sep-2020 11:03                6466
function.msql-regcase.php                          27-Sep-2020 11:03                1579
function.msql-result.php                           27-Sep-2020 11:03                4388
function.msql-select-db.php                        27-Sep-2020 11:03                3963
function.msql-tablename.php                        27-Sep-2020 11:03                1585
function.msql.php                                  27-Sep-2020 11:03                1534
function.mt-getrandmax.php                         27-Sep-2020 11:03                5207
function.mt-rand.php                               27-Sep-2020 11:03                9906
function.mt-srand.php                              27-Sep-2020 11:03                7771
function.mysql-affected-rows.php                   27-Sep-2020 11:03               12227
function.mysql-client-encoding.php                 27-Sep-2020 11:03                6055
function.mysql-close.php                           27-Sep-2020 11:03                7128
function.mysql-connect.php                         27-Sep-2020 11:03               17283
function.mysql-create-db.php                       27-Sep-2020 11:03                8313
function.mysql-data-seek.php                       27-Sep-2020 11:03               12201
function.mysql-db-name.php                         27-Sep-2020 11:03                8302
function.mysql-db-query.php                        27-Sep-2020 11:03                9852
function.mysql-drop-db.php                         27-Sep-2020 11:03                7611
function.mysql-errno.php                           27-Sep-2020 11:03                8163
function.mysql-error.php                           27-Sep-2020 11:03                8067
function.mysql-escape-string.php                   27-Sep-2020 11:03                6764
function.mysql-fetch-array.php                     27-Sep-2020 11:03               15462
function.mysql-fetch-assoc.php                     27-Sep-2020 11:03               12022
function.mysql-fetch-field.php                     27-Sep-2020 11:03               13518
function.mysql-fetch-lengths.php                   27-Sep-2020 11:03                7516
function.mysql-fetch-object.php                    27-Sep-2020 11:03               11534
function.mysql-fetch-row.php                       27-Sep-2020 11:03                7601
function.mysql-field-flags.php                     27-Sep-2020 11:03                8347
function.mysql-field-len.php                       27-Sep-2020 11:03                6859
function.mysql-field-name.php                      27-Sep-2020 11:03                9022
function.mysql-field-seek.php                      27-Sep-2020 11:03                4784
function.mysql-field-table.php                     27-Sep-2020 11:03                7728
function.mysql-field-type.php                      27-Sep-2020 11:03               11959
function.mysql-free-result.php                     27-Sep-2020 11:03                7755
function.mysql-get-client-info.php                 27-Sep-2020 11:03                4760
function.mysql-get-host-info.php                   27-Sep-2020 11:03                6540
function.mysql-get-proto-info.php                  27-Sep-2020 11:03                6266
function.mysql-get-server-info.php                 27-Sep-2020 11:03                6614
function.mysql-info.php                            27-Sep-2020 11:03                5980
function.mysql-insert-id.php                       27-Sep-2020 11:03                8151
function.mysql-list-dbs.php                        27-Sep-2020 11:03                8682
function.mysql-list-fields.php                     27-Sep-2020 11:03                8746
function.mysql-list-processes.php                  27-Sep-2020 11:03                7338
function.mysql-list-tables.php                     27-Sep-2020 11:03                9401
function.mysql-num-fields.php                      27-Sep-2020 11:03                6511
function.mysql-num-rows.php                        27-Sep-2020 11:03                7894
function.mysql-pconnect.php                        27-Sep-2020 11:03                8172
function.mysql-ping.php                            27-Sep-2020 11:03                7962
function.mysql-query.php                           27-Sep-2020 11:03               14389
function.mysql-real-escape-string.php              27-Sep-2020 11:03               16357
function.mysql-result.php                          27-Sep-2020 11:03                9670
function.mysql-select-db.php                       27-Sep-2020 11:03                7533
function.mysql-set-charset.php                     27-Sep-2020 11:03                5539
function.mysql-stat.php                            27-Sep-2020 11:03                9036
function.mysql-tablename.php                       27-Sep-2020 11:03                8512
function.mysql-thread-id.php                       27-Sep-2020 11:03                6293
function.mysql-unbuffered-query.php                27-Sep-2020 11:03                6708
function.mysql-xdevapi-expression.php              27-Sep-2020 11:03                4671
function.mysql-xdevapi-getsession.php              27-Sep-2020 11:03               13035
function.mysqli-bind-param.php                     27-Sep-2020 11:03                2321
function.mysqli-bind-result.php                    27-Sep-2020 11:03                2340
function.mysqli-client-encoding.php                27-Sep-2020 11:03                2432
function.mysqli-connect.php                        27-Sep-2020 11:03                5304
function.mysqli-disable-reads-from-master.php      27-Sep-2020 11:03                2711
function.mysqli-disable-rpl-parse.php              27-Sep-2020 11:03                2218
function.mysqli-enable-reads-from-master.php       27-Sep-2020 11:03                2241
function.mysqli-enable-rpl-parse.php               27-Sep-2020 11:03                2185
function.mysqli-escape-string.php                  27-Sep-2020 11:03                1716
function.mysqli-execute.php                        27-Sep-2020 11:03                2347
function.mysqli-fetch.php                          27-Sep-2020 11:03                2262
function.mysqli-get-cache-stats.php                27-Sep-2020 11:03                3176
function.mysqli-get-client-stats.php               27-Sep-2020 11:03                8149
function.mysqli-get-links-stats.php                27-Sep-2020 11:03                3290
function.mysqli-get-metadata.php                   27-Sep-2020 11:03                2370
function.mysqli-master-query.php                   27-Sep-2020 11:03                2288
function.mysqli-param-count.php                    27-Sep-2020 11:03                2323
function.mysqli-report.php                         27-Sep-2020 11:03                1622
function.mysqli-rpl-parse-enabled.php              27-Sep-2020 11:03                2160
function.mysqli-rpl-probe.php                      27-Sep-2020 11:03                2117
function.mysqli-send-long-data.php                 27-Sep-2020 11:03                2323
function.mysqli-set-opt.php                        27-Sep-2020 11:03                1733
function.mysqli-slave-query.php                    27-Sep-2020 11:03                2247
function.mysqlnd-memcache-get-config.php           27-Sep-2020 11:03               11870
function.mysqlnd-memcache-set.php                  27-Sep-2020 11:03               10813
function.mysqlnd-ms-dump-servers.php               27-Sep-2020 11:03                9174
function.mysqlnd-ms-fabric-select-global.php       27-Sep-2020 11:03                3903
function.mysqlnd-ms-fabric-select-shard.php        27-Sep-2020 11:03                4204
function.mysqlnd-ms-get-last-gtid.php              27-Sep-2020 11:03                9550
function.mysqlnd-ms-get-last-used-connection.php   27-Sep-2020 11:03               10045
function.mysqlnd-ms-get-stats.php                  27-Sep-2020 11:03               31532
function.mysqlnd-ms-match-wild.php                 27-Sep-2020 11:03                6923
function.mysqlnd-ms-query-is-select.php            27-Sep-2020 11:03                9057
function.mysqlnd-ms-set-qos.php                    27-Sep-2020 11:03               15508
function.mysqlnd-ms-set-user-pick-server.php       27-Sep-2020 11:03               19023
function.mysqlnd-ms-xa-begin.php                   27-Sep-2020 11:03                8523
function.mysqlnd-ms-xa-commit.php                  27-Sep-2020 11:03                4576
function.mysqlnd-ms-xa-gc.php                      27-Sep-2020 11:03                6343
function.mysqlnd-ms-xa-rollback.php                27-Sep-2020 11:03                4323
function.mysqlnd-qc-clear-cache.php                27-Sep-2020 11:03                2933
function.mysqlnd-qc-get-available-handlers.php     27-Sep-2020 11:03                4844
function.mysqlnd-qc-get-cache-info.php             27-Sep-2020 11:03               20024
function.mysqlnd-qc-get-core-stats.php             27-Sep-2020 11:03               19316
function.mysqlnd-qc-get-normalized-query-trace-..> 27-Sep-2020 11:03               15472
function.mysqlnd-qc-get-query-trace-log.php        27-Sep-2020 11:03               16520
function.mysqlnd-qc-set-cache-condition.php        27-Sep-2020 11:03                9185
function.mysqlnd-qc-set-is-select.php              27-Sep-2020 11:03               11803
function.mysqlnd-qc-set-storage-handler.php        27-Sep-2020 11:03                6358
function.mysqlnd-qc-set-user-handlers.php          27-Sep-2020 11:03                5798
function.mysqlnd-uh-convert-to-mysqlnd.php         27-Sep-2020 11:03                8052
function.mysqlnd-uh-set-connection-proxy.php       27-Sep-2020 11:03               11103
function.mysqlnd-uh-set-statement-proxy.php        27-Sep-2020 11:03                4514
function.natcasesort.php                           27-Sep-2020 11:03                6742
function.natsort.php                               27-Sep-2020 11:03               10048
function.ncurses-addch.php                         27-Sep-2020 11:02                2473
function.ncurses-addchnstr.php                     27-Sep-2020 11:02                2740
function.ncurses-addchstr.php                      27-Sep-2020 11:02                2498
function.ncurses-addnstr.php                       27-Sep-2020 11:02                2715
function.ncurses-addstr.php                        27-Sep-2020 11:02                2502
function.ncurses-assume-default-colors.php         27-Sep-2020 11:02                2807
function.ncurses-attroff.php                       27-Sep-2020 11:02                2514
function.ncurses-attron.php                        27-Sep-2020 11:02                2479
function.ncurses-attrset.php                       27-Sep-2020 11:02                2479
function.ncurses-baudrate.php                      27-Sep-2020 11:02                2121
function.ncurses-beep.php                          27-Sep-2020 11:02                2453
function.ncurses-bkgd.php                          27-Sep-2020 11:02                2469
function.ncurses-bkgdset.php                       27-Sep-2020 11:02                2505
function.ncurses-border.php                        27-Sep-2020 11:02                4773
function.ncurses-bottom-panel.php                  27-Sep-2020 11:02                2235
function.ncurses-can-change-color.php              27-Sep-2020 11:02                3454
function.ncurses-cbreak.php                        27-Sep-2020 11:02                2815
function.ncurses-clear.php                         27-Sep-2020 11:02                2955
function.ncurses-clrtobot.php                      27-Sep-2020 11:02                3026
function.ncurses-clrtoeol.php                      27-Sep-2020 11:02                3033
function.ncurses-color-content.php                 27-Sep-2020 11:02                4524
function.ncurses-color-set.php                     27-Sep-2020 11:02                5999
function.ncurses-curs-set.php                      27-Sep-2020 11:02                2500
function.ncurses-def-prog-mode.php                 27-Sep-2020 11:02                2914
function.ncurses-def-shell-mode.php                27-Sep-2020 11:02                2931
function.ncurses-define-key.php                    27-Sep-2020 11:02                2751
function.ncurses-del-panel.php                     27-Sep-2020 11:02                2237
function.ncurses-delay-output.php                  27-Sep-2020 11:02                2553
function.ncurses-delch.php                         27-Sep-2020 11:02                2911
function.ncurses-deleteln.php                      27-Sep-2020 11:02                2855
function.ncurses-delwin.php                        27-Sep-2020 11:02                2477
function.ncurses-doupdate.php                      27-Sep-2020 11:02                2412
function.ncurses-echo.php                          27-Sep-2020 11:02                2795
function.ncurses-echochar.php                      27-Sep-2020 11:02                2493
function.ncurses-end.php                           27-Sep-2020 11:02                2101
function.ncurses-erase.php                         27-Sep-2020 11:02                2999
function.ncurses-erasechar.php                     27-Sep-2020 11:02                2613
function.ncurses-filter.php                        27-Sep-2020 11:02                2157
function.ncurses-flash.php                         27-Sep-2020 11:02                2670
function.ncurses-flushinp.php                      27-Sep-2020 11:02                2337
function.ncurses-getch.php                         27-Sep-2020 11:02                2112
function.ncurses-getmaxyx.php                      27-Sep-2020 11:02                3392
function.ncurses-getmouse.php                      27-Sep-2020 11:02                6440
function.ncurses-getyx.php                         27-Sep-2020 11:02                2661
function.ncurses-halfdelay.php                     27-Sep-2020 11:02                2500
function.ncurses-has-colors.php                    27-Sep-2020 11:02                5490
function.ncurses-has-ic.php                        27-Sep-2020 11:02                2743
function.ncurses-has-il.php                        27-Sep-2020 11:02                2747
function.ncurses-has-key.php                       27-Sep-2020 11:02                2515
function.ncurses-hide-panel.php                    27-Sep-2020 11:02                2199
function.ncurses-hline.php                         27-Sep-2020 11:02                2757
function.ncurses-inch.php                          27-Sep-2020 11:02                2228
function.ncurses-init-color.php                    27-Sep-2020 11:02                4654
function.ncurses-init-pair.php                     27-Sep-2020 11:02                7743
function.ncurses-init.php                          27-Sep-2020 11:02                2769
function.ncurses-insch.php                         27-Sep-2020 11:02                2514
function.ncurses-insdelln.php                      27-Sep-2020 11:02                2543
function.ncurses-insertln.php                      27-Sep-2020 11:02                2068
function.ncurses-insstr.php                        27-Sep-2020 11:02                2501
function.ncurses-instr.php                         27-Sep-2020 11:02                2729
function.ncurses-isendwin.php                      27-Sep-2020 11:02                3142
function.ncurses-keyok.php                         27-Sep-2020 11:02                2694
function.ncurses-keypad.php                        27-Sep-2020 11:02                2366
function.ncurses-killchar.php                      27-Sep-2020 11:02                2620
function.ncurses-longname.php                      27-Sep-2020 11:02                2696
function.ncurses-meta.php                          27-Sep-2020 11:02                2386
function.ncurses-mouse-trafo.php                   27-Sep-2020 11:02                2652
function.ncurses-mouseinterval.php                 27-Sep-2020 11:02                2559
function.ncurses-mousemask.php                     27-Sep-2020 11:02                8146
function.ncurses-move-panel.php                    27-Sep-2020 11:02                2675
function.ncurses-move.php                          27-Sep-2020 11:02                2662
function.ncurses-mvaddch.php                       27-Sep-2020 11:02                2919
function.ncurses-mvaddchnstr.php                   27-Sep-2020 11:02                3198
function.ncurses-mvaddchstr.php                    27-Sep-2020 11:02                2956
function.ncurses-mvaddnstr.php                     27-Sep-2020 11:02                3173
function.ncurses-mvaddstr.php                      27-Sep-2020 11:02                2917
function.ncurses-mvcur.php                         27-Sep-2020 11:02                3137
function.ncurses-mvdelch.php                       27-Sep-2020 11:02                2715
function.ncurses-mvgetch.php                       27-Sep-2020 11:02                2707
function.ncurses-mvhline.php                       27-Sep-2020 11:02                3208
function.ncurses-mvinch.php                        27-Sep-2020 11:02                2710
function.ncurses-mvvline.php                       27-Sep-2020 11:02                3210
function.ncurses-mvwaddstr.php                     27-Sep-2020 11:02                3168
function.ncurses-napms.php                         27-Sep-2020 11:02                2460
function.ncurses-new-panel.php                     27-Sep-2020 11:02                2195
function.ncurses-newpad.php                        27-Sep-2020 11:02                2373
function.ncurses-newwin.php                        27-Sep-2020 11:02                3603
function.ncurses-nl.php                            27-Sep-2020 11:02                2107
function.ncurses-nocbreak.php                      27-Sep-2020 11:02                2974
function.ncurses-noecho.php                        27-Sep-2020 11:02                2837
function.ncurses-nonl.php                          27-Sep-2020 11:02                2130
function.ncurses-noqiflush.php                     27-Sep-2020 11:02                2160
function.ncurses-noraw.php                         27-Sep-2020 11:02                3317
function.ncurses-pair-content.php                  27-Sep-2020 11:02                4730
function.ncurses-panel-above.php                   27-Sep-2020 11:02                2442
function.ncurses-panel-below.php                   27-Sep-2020 11:02                2432
function.ncurses-panel-window.php                  27-Sep-2020 11:02                2234
function.ncurses-pnoutrefresh.php                  27-Sep-2020 11:02                3609
function.ncurses-prefresh.php                      27-Sep-2020 11:02                3569
function.ncurses-putp.php                          27-Sep-2020 11:02                2481
function.ncurses-qiflush.php                       27-Sep-2020 11:02                2136
function.ncurses-raw.php                           27-Sep-2020 11:02                3283
function.ncurses-refresh.php                       27-Sep-2020 11:02                2462
function.ncurses-replace-panel.php                 27-Sep-2020 11:02                2469
function.ncurses-reset-prog-mode.php               27-Sep-2020 11:02                1897
function.ncurses-reset-shell-mode.php              27-Sep-2020 11:02                1892
function.ncurses-resetty.php                       27-Sep-2020 11:02                2756
function.ncurses-savetty.php                       27-Sep-2020 11:02                2752
function.ncurses-scr-dump.php                      27-Sep-2020 11:02                2496
function.ncurses-scr-init.php                      27-Sep-2020 11:02                2509
function.ncurses-scr-restore.php                   27-Sep-2020 11:02                2522
function.ncurses-scr-set.php                       27-Sep-2020 11:02                2490
function.ncurses-scrl.php                          27-Sep-2020 11:02                2498
function.ncurses-show-panel.php                    27-Sep-2020 11:02                2215
function.ncurses-slk-attr.php                      27-Sep-2020 11:02                2251
function.ncurses-slk-attroff.php                   27-Sep-2020 11:02                2549
function.ncurses-slk-attron.php                    27-Sep-2020 11:02                2548
function.ncurses-slk-attrset.php                   27-Sep-2020 11:02                2542
function.ncurses-slk-clear.php                     27-Sep-2020 11:02                2393
function.ncurses-slk-color.php                     27-Sep-2020 11:02                2503
function.ncurses-slk-init.php                      27-Sep-2020 11:02                3454
function.ncurses-slk-noutrefresh.php               27-Sep-2020 11:02                2198
function.ncurses-slk-refresh.php                   27-Sep-2020 11:02                2094
function.ncurses-slk-restore.php                   27-Sep-2020 11:02                2177
function.ncurses-slk-set.php                       27-Sep-2020 11:02                2624
function.ncurses-slk-touch.php                     27-Sep-2020 11:02                2215
function.ncurses-standend.php                      27-Sep-2020 11:02                2146
function.ncurses-standout.php                      27-Sep-2020 11:02                2151
function.ncurses-start-color.php                   27-Sep-2020 11:02                5667
function.ncurses-termattrs.php                     27-Sep-2020 11:02                2182
function.ncurses-termname.php                      27-Sep-2020 11:02                2686
function.ncurses-timeout.php                       27-Sep-2020 11:02                2531
function.ncurses-top-panel.php                     27-Sep-2020 11:02                2196
function.ncurses-typeahead.php                     27-Sep-2020 11:02                2519
function.ncurses-ungetch.php                       27-Sep-2020 11:02                2506
function.ncurses-ungetmouse.php                    27-Sep-2020 11:02                3930
function.ncurses-update-panels.php                 27-Sep-2020 11:02                1951
function.ncurses-use-default-colors.php            27-Sep-2020 11:02                2227
function.ncurses-use-env.php                       27-Sep-2020 11:02                2583
function.ncurses-use-extended-names.php            27-Sep-2020 11:02                2591
function.ncurses-vidattr.php                       27-Sep-2020 11:02                2531
function.ncurses-vline.php                         27-Sep-2020 11:02                2753
function.ncurses-waddch.php                        27-Sep-2020 11:02                2406
function.ncurses-waddstr.php                       27-Sep-2020 11:02                2619
function.ncurses-wattroff.php                      27-Sep-2020 11:02                2400
function.ncurses-wattron.php                       27-Sep-2020 11:02                2395
function.ncurses-wattrset.php                      27-Sep-2020 11:02                2398
function.ncurses-wborder.php                       27-Sep-2020 11:02                5084
function.ncurses-wclear.php                        27-Sep-2020 11:02                2144
function.ncurses-wcolor-set.php                    27-Sep-2020 11:02                2416
function.ncurses-werase.php                        27-Sep-2020 11:02                2150
function.ncurses-wgetch.php                        27-Sep-2020 11:02                2161
function.ncurses-whline.php                        27-Sep-2020 11:02                2695
function.ncurses-wmouse-trafo.php                  27-Sep-2020 11:02                2895
function.ncurses-wmove.php                         27-Sep-2020 11:02                2602
function.ncurses-wnoutrefresh.php                  27-Sep-2020 11:02                2202
function.ncurses-wrefresh.php                      27-Sep-2020 11:02                2512
function.ncurses-wstandend.php                     27-Sep-2020 11:02                2185
function.ncurses-wstandout.php                     27-Sep-2020 11:02                2183
function.ncurses-wvline.php                        27-Sep-2020 11:02                2671
function.next.php                                  27-Sep-2020 11:03                7990
function.ngettext.php                              27-Sep-2020 11:03                5561
function.nl-langinfo.php                           27-Sep-2020 11:03               13461
function.nl2br.php                                 27-Sep-2020 11:03                6609
function.nsapi-request-headers.php                 27-Sep-2020 11:03                4191
function.nsapi-response-headers.php                27-Sep-2020 11:03                2558
function.nsapi-virtual.php                         27-Sep-2020 11:03                3948
function.number-format.php                         27-Sep-2020 11:03                9118
function.oauth-get-sbs.php                         27-Sep-2020 11:03                2792
function.oauth-urlencode.php                       27-Sep-2020 11:03                2368
function.ob-clean.php                              27-Sep-2020 11:02                3202
function.ob-end-clean.php                          27-Sep-2020 11:02                4942
function.ob-end-flush.php                          27-Sep-2020 11:02                5706
function.ob-flush.php                              27-Sep-2020 11:02                3417
function.ob-get-clean.php                          27-Sep-2020 11:02                4971
function.ob-get-contents.php                       27-Sep-2020 11:02                4332
function.ob-get-flush.php                          27-Sep-2020 11:02                5320
function.ob-get-length.php                         27-Sep-2020 11:02                4309
function.ob-get-level.php                          27-Sep-2020 11:02                2525
function.ob-get-status.php                         27-Sep-2020 11:02                6670
function.ob-gzhandler.php                          27-Sep-2020 11:02                5531
function.ob-iconv-handler.php                      27-Sep-2020 11:03                4923
function.ob-implicit-flush.php                     27-Sep-2020 11:02                3440
function.ob-list-handlers.php                      27-Sep-2020 11:02                5587
function.ob-start.php                              27-Sep-2020 11:02               17138
function.ob-tidyhandler.php                        27-Sep-2020 11:03                4081
function.oci-bind-array-by-name.php                27-Sep-2020 11:03               13562
function.oci-bind-by-name.php                      27-Sep-2020 11:03               84358
function.oci-cancel.php                            27-Sep-2020 11:03                2364
function.oci-client-version.php                    27-Sep-2020 11:03                3883
function.oci-close.php                             27-Sep-2020 11:03               20115
function.oci-commit.php                            27-Sep-2020 11:03               11329
function.oci-connect.php                           27-Sep-2020 11:03               36748
function.oci-define-by-name.php                    27-Sep-2020 11:03               25373
function.oci-error.php                             27-Sep-2020 11:03               11293
function.oci-execute.php                           27-Sep-2020 11:03               21831
function.oci-fetch-all.php                         27-Sep-2020 11:03               26710
function.oci-fetch-array.php                       27-Sep-2020 11:03               71167
function.oci-fetch-assoc.php                       27-Sep-2020 11:03                8614
function.oci-fetch-object.php                      27-Sep-2020 11:03               19287
function.oci-fetch-row.php                         27-Sep-2020 11:03                8559
function.oci-fetch.php                             27-Sep-2020 11:03               14049
function.oci-field-is-null.php                     27-Sep-2020 11:03                8420
function.oci-field-name.php                        27-Sep-2020 11:03               10833
function.oci-field-precision.php                   27-Sep-2020 11:03                9478
function.oci-field-scale.php                       27-Sep-2020 11:03                9444
function.oci-field-size.php                        27-Sep-2020 11:03               11549
function.oci-field-type-raw.php                    27-Sep-2020 11:03                8598
function.oci-field-type.php                        27-Sep-2020 11:03               11774
function.oci-free-descriptor.php                   27-Sep-2020 11:03                2770
function.oci-free-statement.php                    27-Sep-2020 11:03                2636
function.oci-get-implicit-resultset.php            27-Sep-2020 11:03               32196
function.oci-internal-debug.php                    27-Sep-2020 11:03                3059
function.oci-lob-copy.php                          27-Sep-2020 11:03                3280
function.oci-lob-is-equal.php                      27-Sep-2020 11:03                2682
function.oci-new-collection.php                    27-Sep-2020 11:03                3997
function.oci-new-connect.php                       27-Sep-2020 11:03               15148
function.oci-new-cursor.php                        27-Sep-2020 11:03                8374
function.oci-new-descriptor.php                    27-Sep-2020 11:03               21110
function.oci-num-fields.php                        27-Sep-2020 11:03                7662
function.oci-num-rows.php                          27-Sep-2020 11:03                8288
function.oci-parse.php                             27-Sep-2020 11:03               13037
function.oci-password-change.php                   27-Sep-2020 11:03               13595
function.oci-pconnect.php                          27-Sep-2020 11:03               13605
function.oci-register-taf-callback.php             27-Sep-2020 11:03                5158
function.oci-result.php                            27-Sep-2020 11:03                9302
function.oci-rollback.php                          27-Sep-2020 11:03               14910
function.oci-server-version.php                    27-Sep-2020 11:03                5035
function.oci-set-action.php                        27-Sep-2020 11:03                8222
function.oci-set-call-timout.php                   27-Sep-2020 11:03                5599
function.oci-set-client-identifier.php             27-Sep-2020 11:03                7996
function.oci-set-client-info.php                   27-Sep-2020 11:03                8144
function.oci-set-db-operation.php                  27-Sep-2020 11:03                7563
function.oci-set-edition.php                       27-Sep-2020 11:03                9680
function.oci-set-module-name.php                   27-Sep-2020 11:03                8329
function.oci-set-prefetch.php                      27-Sep-2020 11:03               22742
function.oci-statement-type.php                    27-Sep-2020 11:03                6889
function.oci-unregister-taf-callback.php           27-Sep-2020 11:03                3294
function.ocibindbyname.php                         27-Sep-2020 11:03                1861
function.ocicancel.php                             27-Sep-2020 11:03                1802
function.ocicloselob.php                           27-Sep-2020 11:03                1810
function.ocicollappend.php                         27-Sep-2020 11:03                1866
function.ocicollassign.php                         27-Sep-2020 11:03                1870
function.ocicollassignelem.php                     27-Sep-2020 11:03                1912
function.ocicollgetelem.php                        27-Sep-2020 11:03                1882
function.ocicollmax.php                            27-Sep-2020 11:03                1838
function.ocicollsize.php                           27-Sep-2020 11:03                1840
function.ocicolltrim.php                           27-Sep-2020 11:03                1850
function.ocicolumnisnull.php                       27-Sep-2020 11:03                1866
function.ocicolumnname.php                         27-Sep-2020 11:03                1860
function.ocicolumnprecision.php                    27-Sep-2020 11:03                1898
function.ocicolumnscale.php                        27-Sep-2020 11:03                1866
function.ocicolumnsize.php                         27-Sep-2020 11:03                1848
function.ocicolumntype.php                         27-Sep-2020 11:03                1852
function.ocicolumntyperaw.php                      27-Sep-2020 11:03                1872
function.ocicommit.php                             27-Sep-2020 11:03                1816
function.ocidefinebyname.php                       27-Sep-2020 11:03                1856
function.ocierror.php                              27-Sep-2020 11:03                1794
function.ociexecute.php                            27-Sep-2020 11:03                1796
function.ocifetch.php                              27-Sep-2020 11:03                1788
function.ocifetchinto.php                          27-Sep-2020 11:03                2531
function.ocifetchstatement.php                     27-Sep-2020 11:03                1872
function.ocifreecollection.php                     27-Sep-2020 11:03                1894
function.ocifreecursor.php                         27-Sep-2020 11:03                1866
function.ocifreedesc.php                           27-Sep-2020 11:03                1816
function.ocifreestatement.php                      27-Sep-2020 11:03                1882
function.ociinternaldebug.php                      27-Sep-2020 11:03                1880
function.ociloadlob.php                            27-Sep-2020 11:03                1802
function.ocilogoff.php                             27-Sep-2020 11:03                1786
function.ocilogon.php                              27-Sep-2020 11:03                1802
function.ocinewcollection.php                      27-Sep-2020 11:03                1880
function.ocinewcursor.php                          27-Sep-2020 11:03                1852
function.ocinewdescriptor.php                      27-Sep-2020 11:03                1870
function.ocinlogon.php                             27-Sep-2020 11:03                1826
function.ocinumcols.php                            27-Sep-2020 11:03                1810
function.ociparse.php                              27-Sep-2020 11:03                1782
function.ociplogon.php                             27-Sep-2020 11:03                1796
function.ociresult.php                             27-Sep-2020 11:03                1794
function.ocirollback.php                           27-Sep-2020 11:03                1814
function.ocirowcount.php                           27-Sep-2020 11:03                1816
function.ocisavelob.php                            27-Sep-2020 11:03                1802
function.ocisavelobfile.php                        27-Sep-2020 11:03                1836
function.ociserverversion.php                      27-Sep-2020 11:03                1884
function.ocisetprefetch.php                        27-Sep-2020 11:03                1872
function.ocistatementtype.php                      27-Sep-2020 11:03                1890
function.ociwritelobtofile.php                     27-Sep-2020 11:03                1874
function.ociwritetemporarylob.php                  27-Sep-2020 11:03                1900
function.octdec.php                                27-Sep-2020 11:03                5689
function.odbc-autocommit.php                       27-Sep-2020 11:03                4040
function.odbc-binmode.php                          27-Sep-2020 11:03                6192
function.odbc-close-all.php                        27-Sep-2020 11:03                2475
function.odbc-close.php                            27-Sep-2020 11:03                2724
function.odbc-columnprivileges.php                 27-Sep-2020 11:03                8064
function.odbc-columns.php                          27-Sep-2020 11:03                9739
function.odbc-commit.php                           27-Sep-2020 11:03                2412
function.odbc-connect.php                          27-Sep-2020 11:03                8270
function.odbc-cursor.php                           27-Sep-2020 11:03                2215
function.odbc-data-source.php                      27-Sep-2020 11:03                5514
function.odbc-do.php                               27-Sep-2020 11:03                1552
function.odbc-error.php                            27-Sep-2020 11:03                3279
function.odbc-errormsg.php                         27-Sep-2020 11:03                3326
function.odbc-exec.php                             27-Sep-2020 11:03                3515
function.odbc-execute.php                          27-Sep-2020 11:03                6762
function.odbc-fetch-array.php                      27-Sep-2020 11:03                3905
function.odbc-fetch-into.php                       27-Sep-2020 11:03                4793
function.odbc-fetch-object.php                     27-Sep-2020 11:03                3911
function.odbc-fetch-row.php                        27-Sep-2020 11:03                3910
function.odbc-field-len.php                        27-Sep-2020 11:03                3050
function.odbc-field-name.php                       27-Sep-2020 11:03                2647
function.odbc-field-num.php                        27-Sep-2020 11:03                2664
function.odbc-field-precision.php                  27-Sep-2020 11:03                2080
function.odbc-field-scale.php                      27-Sep-2020 11:03                2663
function.odbc-field-type.php                       27-Sep-2020 11:03                2647
function.odbc-foreignkeys.php                      27-Sep-2020 11:03                8158
function.odbc-free-result.php                      27-Sep-2020 11:03                3101
function.odbc-gettypeinfo.php                      27-Sep-2020 11:03                4127
function.odbc-longreadlen.php                      27-Sep-2020 11:03                3320
function.odbc-next-result.php                      27-Sep-2020 11:03                8918
function.odbc-num-fields.php                       27-Sep-2020 11:03                2391
function.odbc-num-rows.php                         27-Sep-2020 11:03                3030
function.odbc-pconnect.php                         27-Sep-2020 11:03                4016
function.odbc-prepare.php                          27-Sep-2020 11:03                6076
function.odbc-primarykeys.php                      27-Sep-2020 11:03                7326
function.odbc-procedurecolumns.php                 27-Sep-2020 11:03               10219
function.odbc-procedures.php                       27-Sep-2020 11:03                8304
function.odbc-result-all.php                       27-Sep-2020 11:03                2737
function.odbc-result.php                           27-Sep-2020 11:03                5359
function.odbc-rollback.php                         27-Sep-2020 11:03                2429
function.odbc-setoption.php                        27-Sep-2020 11:03                6891
function.odbc-specialcolumns.php                   27-Sep-2020 11:03                6612
function.odbc-statistics.php                       27-Sep-2020 11:03                9077
function.odbc-tableprivileges.php                  27-Sep-2020 11:03                7703
function.odbc-tables.php                           27-Sep-2020 11:03               10690
function.opcache-compile-file.php                  27-Sep-2020 11:02                3461
function.opcache-get-configuration.php             27-Sep-2020 11:02                2841
function.opcache-get-status.php                    27-Sep-2020 11:02                3321
function.opcache-invalidate.php                    27-Sep-2020 11:02                3801
function.opcache-is-script-cached.php              27-Sep-2020 11:02                3037
function.opcache-reset.php                         27-Sep-2020 11:02                2737
function.openal-buffer-create.php                  27-Sep-2020 11:02                2512
function.openal-buffer-data.php                    27-Sep-2020 11:02                4177
function.openal-buffer-destroy.php                 27-Sep-2020 11:02                2863
function.openal-buffer-get.php                     27-Sep-2020 11:02                3339
function.openal-buffer-loadwav.php                 27-Sep-2020 11:02                3384
function.openal-context-create.php                 27-Sep-2020 11:02                3131
function.openal-context-current.php                27-Sep-2020 11:02                2917
function.openal-context-destroy.php                27-Sep-2020 11:02                2903
function.openal-context-process.php                27-Sep-2020 11:02                3321
function.openal-context-suspend.php                27-Sep-2020 11:02                3315
function.openal-device-close.php                   27-Sep-2020 11:02                2872
function.openal-device-open.php                    27-Sep-2020 11:02                3096
function.openal-listener-get.php                   27-Sep-2020 11:02                3019
function.openal-listener-set.php                   27-Sep-2020 11:02                3316
function.openal-source-create.php                  27-Sep-2020 11:02                2720
function.openal-source-destroy.php                 27-Sep-2020 11:02                2871
function.openal-source-get.php                     27-Sep-2020 11:02                4519
function.openal-source-pause.php                   27-Sep-2020 11:02                3204
function.openal-source-play.php                    27-Sep-2020 11:02                3204
function.openal-source-rewind.php                  27-Sep-2020 11:02                3212
function.openal-source-set.php                     27-Sep-2020 11:02                5047
function.openal-source-stop.php                    27-Sep-2020 11:02                3186
function.openal-stream.php                         27-Sep-2020 11:02                3700
function.opendir.php                               27-Sep-2020 11:03                7200
function.openlog.php                               27-Sep-2020 11:03                8257
function.openssl-cipher-iv-length.php              27-Sep-2020 11:03                4051
function.openssl-csr-export-to-file.php            27-Sep-2020 11:03                7267
function.openssl-csr-export.php                    27-Sep-2020 11:03                7055
function.openssl-csr-get-public-key.php            27-Sep-2020 11:03                7124
function.openssl-csr-get-subject.php               27-Sep-2020 11:03                8504
function.openssl-csr-new.php                       27-Sep-2020 11:03               20632
function.openssl-csr-sign.php                      27-Sep-2020 11:03                9964
function.openssl-decrypt.php                       27-Sep-2020 11:03                6496
function.openssl-dh-compute-key.php                27-Sep-2020 11:03               15175
function.openssl-digest.php                        27-Sep-2020 11:03                3994
function.openssl-encrypt.php                       27-Sep-2020 11:03               17387
function.openssl-error-string.php                  27-Sep-2020 11:03                3414
function.openssl-free-key.php                      27-Sep-2020 11:03                2443
function.openssl-get-cert-locations.php            27-Sep-2020 11:03                3890
function.openssl-get-cipher-methods.php            27-Sep-2020 11:03               12226
function.openssl-get-curve-names.php               27-Sep-2020 11:03                6857
function.openssl-get-md-methods.php                27-Sep-2020 11:03                6868
function.openssl-get-privatekey.php                27-Sep-2020 11:03                1760
function.openssl-get-publickey.php                 27-Sep-2020 11:03                1733
function.openssl-open.php                          27-Sep-2020 11:03                8043
function.openssl-pbkdf2.php                        27-Sep-2020 11:03                6929
function.openssl-pkcs12-export-to-file.php         27-Sep-2020 11:03                4760
function.openssl-pkcs12-export.php                 27-Sep-2020 11:03                4731
function.openssl-pkcs12-read.php                   27-Sep-2020 11:03                5258
function.openssl-pkcs7-decrypt.php                 27-Sep-2020 11:03                5906
function.openssl-pkcs7-encrypt.php                 27-Sep-2020 11:03                9035
function.openssl-pkcs7-read.php                    27-Sep-2020 11:03                2723
function.openssl-pkcs7-sign.php                    27-Sep-2020 11:03                9505
function.openssl-pkcs7-verify.php                  27-Sep-2020 11:03                6188
function.openssl-pkey-export-to-file.php           27-Sep-2020 11:03                4323
function.openssl-pkey-export.php                   27-Sep-2020 11:03                4203
function.openssl-pkey-free.php                     27-Sep-2020 11:03                2446
function.openssl-pkey-get-details.php              27-Sep-2020 11:03                8023
function.openssl-pkey-get-private.php              27-Sep-2020 11:03                3530
function.openssl-pkey-get-public.php               27-Sep-2020 11:03                3251
function.openssl-pkey-new.php                      27-Sep-2020 11:03                3814
function.openssl-private-decrypt.php               27-Sep-2020 11:03                4703
function.openssl-private-encrypt.php               27-Sep-2020 11:03                4526
function.openssl-public-decrypt.php                27-Sep-2020 11:03                4592
function.openssl-public-encrypt.php                27-Sep-2020 11:03                4787
function.openssl-random-pseudo-bytes.php           27-Sep-2020 11:03                8119
function.openssl-seal.php                          27-Sep-2020 11:03                9243
function.openssl-sign.php                          27-Sep-2020 11:03               11215
function.openssl-spki-export-challenge.php         27-Sep-2020 11:03                7310
function.openssl-spki-export.php                   27-Sep-2020 11:03                7968
function.openssl-spki-new.php                      27-Sep-2020 11:03                7889
function.openssl-spki-verify.php                   27-Sep-2020 11:03                7662
function.openssl-verify.php                        27-Sep-2020 11:03               11986
function.openssl-x509-check-private-key.php        27-Sep-2020 11:03                3689
function.openssl-x509-checkpurpose.php             27-Sep-2020 11:03                5527
function.openssl-x509-export-to-file.php           27-Sep-2020 11:03                3674
function.openssl-x509-export.php                   27-Sep-2020 11:03                3621
function.openssl-x509-fingerprint.php              27-Sep-2020 11:03                3913
function.openssl-x509-free.php                     27-Sep-2020 11:03                2452
function.openssl-x509-parse.php                    27-Sep-2020 11:03                3516
function.openssl-x509-read.php                     27-Sep-2020 11:03                2758
function.openssl-x509-verify.php                   27-Sep-2020 11:03               11168
function.ord.php                                   27-Sep-2020 11:03                7053
function.output-add-rewrite-var.php                27-Sep-2020 11:02                8002
function.output-reset-rewrite-vars.php             27-Sep-2020 11:02                6132
function.pack.php                                  27-Sep-2020 11:03               12751
function.parse-ini-file.php                        27-Sep-2020 11:03               15178
function.parse-ini-string.php                      27-Sep-2020 11:03                6335
function.parse-str.php                             27-Sep-2020 11:03               10803
function.parse-url.php                             27-Sep-2020 11:03               13910
function.passthru.php                              27-Sep-2020 11:03                6252
function.password-algos.php                        27-Sep-2020 11:03                3217
function.password-get-info.php                     27-Sep-2020 11:03                3301
function.password-hash.php                         27-Sep-2020 11:03               21511
function.password-needs-rehash.php                 27-Sep-2020 11:03                7738
function.password-verify.php                       27-Sep-2020 11:03                5685
function.pathinfo.php                              27-Sep-2020 11:03               11361
function.pclose.php                                27-Sep-2020 11:03                4640
function.pcntl-alarm.php                           27-Sep-2020 11:03                2696
function.pcntl-async-signals.php                   27-Sep-2020 11:03                3122
function.pcntl-errno.php                           27-Sep-2020 11:03                1636
function.pcntl-exec.php                            27-Sep-2020 11:03                3451
function.pcntl-fork.php                            27-Sep-2020 11:03                4805
function.pcntl-get-last-error.php                  27-Sep-2020 11:03                2632
function.pcntl-getpriority.php                     27-Sep-2020 11:03                4119
function.pcntl-setpriority.php                     27-Sep-2020 11:03                4043
function.pcntl-signal-dispatch.php                 27-Sep-2020 11:03                5368
function.pcntl-signal-get-handler.php              27-Sep-2020 11:03                6458
function.pcntl-signal.php                          27-Sep-2020 11:03               11709
function.pcntl-sigprocmask.php                     27-Sep-2020 11:03                5482
function.pcntl-sigtimedwait.php                    27-Sep-2020 11:03                4448
function.pcntl-sigwaitinfo.php                     27-Sep-2020 11:03                7033
function.pcntl-strerror.php                        27-Sep-2020 11:03                2800
function.pcntl-wait.php                            27-Sep-2020 11:03                7754
function.pcntl-waitpid.php                         27-Sep-2020 11:03                8905
function.pcntl-wexitstatus.php                     27-Sep-2020 11:03                3269
function.pcntl-wifexited.php                       27-Sep-2020 11:03                3194
function.pcntl-wifsignaled.php                     27-Sep-2020 11:03                3244
function.pcntl-wifstopped.php                      27-Sep-2020 11:03                3246
function.pcntl-wstopsig.php                        27-Sep-2020 11:03                3262
function.pcntl-wtermsig.php                        27-Sep-2020 11:03                3467
function.pdf-activate-item.php                     27-Sep-2020 11:03                1989
function.pdf-add-annotation.php                    27-Sep-2020 11:03                1641
function.pdf-add-bookmark.php                      27-Sep-2020 11:03                1635
function.pdf-add-launchlink.php                    27-Sep-2020 11:03                2757
function.pdf-add-locallink.php                     27-Sep-2020 11:03                3018
function.pdf-add-nameddest.php                     27-Sep-2020 11:03                2094
function.pdf-add-note.php                          27-Sep-2020 11:03                2973
function.pdf-add-outline.php                       27-Sep-2020 11:03                1576
function.pdf-add-pdflink.php                       27-Sep-2020 11:03                3094
function.pdf-add-table-cell.php                    27-Sep-2020 11:03                2312
function.pdf-add-textflow.php                      27-Sep-2020 11:03                2138
function.pdf-add-thumbnail.php                     27-Sep-2020 11:03                1994
function.pdf-add-weblink.php                       27-Sep-2020 11:03                2877
function.pdf-arc.php                               27-Sep-2020 11:03                2198
function.pdf-arcn.php                              27-Sep-2020 11:03                2335
function.pdf-attach-file.php                       27-Sep-2020 11:03                3114
function.pdf-begin-document.php                    27-Sep-2020 11:03                1968
function.pdf-begin-font.php                        27-Sep-2020 11:03                2566
function.pdf-begin-glyph.php                       27-Sep-2020 11:03                2378
function.pdf-begin-item.php                        27-Sep-2020 11:03                1999
function.pdf-begin-layer.php                       27-Sep-2020 11:03                1994
function.pdf-begin-page-ext.php                    27-Sep-2020 11:03                3553
function.pdf-begin-page.php                        27-Sep-2020 11:03                2260
function.pdf-begin-pattern.php                     27-Sep-2020 11:03                2301
function.pdf-begin-template-ext.php                27-Sep-2020 11:03                2103
function.pdf-begin-template.php                    27-Sep-2020 11:03                2210
function.pdf-circle.php                            27-Sep-2020 11:03                2066
function.pdf-clip.php                              27-Sep-2020 11:03                1789
function.pdf-close-image.php                       27-Sep-2020 11:03                1953
function.pdf-close-pdi-page.php                    27-Sep-2020 11:03                1981
function.pdf-close-pdi.php                         27-Sep-2020 11:03                2137
function.pdf-close.php                             27-Sep-2020 11:03                2052
function.pdf-closepath-fill-stroke.php             27-Sep-2020 11:03                1907
function.pdf-closepath-stroke.php                  27-Sep-2020 11:03                1869
function.pdf-closepath.php                         27-Sep-2020 11:03                1793
function.pdf-concat.php                            27-Sep-2020 11:03                2462
function.pdf-continue-text.php                     27-Sep-2020 11:03                1965
function.pdf-create-3dview.php                     27-Sep-2020 11:03                1995
function.pdf-create-action.php                     27-Sep-2020 11:03                2010
function.pdf-create-annotation.php                 27-Sep-2020 11:03                2437
function.pdf-create-bookmark.php                   27-Sep-2020 11:03                1979
function.pdf-create-field.php                      27-Sep-2020 11:03                2521
function.pdf-create-fieldgroup.php                 27-Sep-2020 11:03                2002
function.pdf-create-gstate.php                     27-Sep-2020 11:03                1879
function.pdf-create-pvf.php                        27-Sep-2020 11:03                2088
function.pdf-create-textflow.php                   27-Sep-2020 11:03                1985
function.pdf-curveto.php                           27-Sep-2020 11:03                2470
function.pdf-define-layer.php                      27-Sep-2020 11:03                1988
function.pdf-delete-pvf.php                        27-Sep-2020 11:03                1882
function.pdf-delete-table.php                      27-Sep-2020 11:03                1964
function.pdf-delete-textflow.php                   27-Sep-2020 11:03                1868
function.pdf-delete.php                            27-Sep-2020 11:03                1849
function.pdf-encoding-set-char.php                 27-Sep-2020 11:03                2228
function.pdf-end-document.php                      27-Sep-2020 11:03                1859
function.pdf-end-font.php                          27-Sep-2020 11:03                1707
function.pdf-end-glyph.php                         27-Sep-2020 11:03                1726
function.pdf-end-item.php                          27-Sep-2020 11:03                1831
function.pdf-end-layer.php                         27-Sep-2020 11:03                1868
function.pdf-end-page-ext.php                      27-Sep-2020 11:03                1932
function.pdf-end-page.php                          27-Sep-2020 11:03                1779
function.pdf-end-pattern.php                       27-Sep-2020 11:03                1823
function.pdf-end-template.php                      27-Sep-2020 11:03                1826
function.pdf-endpath.php                           27-Sep-2020 11:03                1711
function.pdf-fill-imageblock.php                   27-Sep-2020 11:03                2335
function.pdf-fill-pdfblock.php                     27-Sep-2020 11:03                2331
function.pdf-fill-stroke.php                       27-Sep-2020 11:03                1876
function.pdf-fill-textblock.php                    27-Sep-2020 11:03                2317
function.pdf-fill.php                              27-Sep-2020 11:03                1807
function.pdf-findfont.php                          27-Sep-2020 11:03                2874
function.pdf-fit-image.php                         27-Sep-2020 11:03                2272
function.pdf-fit-pdi-page.php                      27-Sep-2020 11:03                2288
function.pdf-fit-table.php                         27-Sep-2020 11:03                2366
function.pdf-fit-textflow.php                      27-Sep-2020 11:03                2417
function.pdf-fit-textline.php                      27-Sep-2020 11:03                2301
function.pdf-get-apiname.php                       27-Sep-2020 11:03                1777
function.pdf-get-buffer.php                        27-Sep-2020 11:03                1744
function.pdf-get-errmsg.php                        27-Sep-2020 11:03                1754
function.pdf-get-errnum.php                        27-Sep-2020 11:03                1751
function.pdf-get-font.php                          27-Sep-2020 11:03                1612
function.pdf-get-fontname.php                      27-Sep-2020 11:03                1649
function.pdf-get-fontsize.php                      27-Sep-2020 11:03                1656
function.pdf-get-image-height.php                  27-Sep-2020 11:03                1685
function.pdf-get-image-width.php                   27-Sep-2020 11:03                1687
function.pdf-get-majorversion.php                  27-Sep-2020 11:03                1931
function.pdf-get-minorversion.php                  27-Sep-2020 11:03                2012
function.pdf-get-parameter.php                     27-Sep-2020 11:03                2015
function.pdf-get-pdi-parameter.php                 27-Sep-2020 11:03                2473
function.pdf-get-pdi-value.php                     27-Sep-2020 11:03                2451
function.pdf-get-value.php                         27-Sep-2020 11:03                1967
function.pdf-info-font.php                         27-Sep-2020 11:03                2067
function.pdf-info-matchbox.php                     27-Sep-2020 11:03                2083
function.pdf-info-table.php                        27-Sep-2020 11:03                1991
function.pdf-info-textflow.php                     27-Sep-2020 11:03                1961
function.pdf-info-textline.php                     27-Sep-2020 11:03                2124
function.pdf-initgraphics.php                      27-Sep-2020 11:03                1868
function.pdf-lineto.php                            27-Sep-2020 11:03                2010
function.pdf-load-3ddata.php                       27-Sep-2020 11:03                1997
function.pdf-load-font.php                         27-Sep-2020 11:03                2066
function.pdf-load-iccprofile.php                   27-Sep-2020 11:03                2000
function.pdf-load-image.php                        27-Sep-2020 11:03                2088
function.pdf-makespotcolor.php                     27-Sep-2020 11:03                2003
function.pdf-moveto.php                            27-Sep-2020 11:03                1992
function.pdf-new.php                               27-Sep-2020 11:03                1618
function.pdf-open-ccitt.php                        27-Sep-2020 11:03                2562
function.pdf-open-file.php                         27-Sep-2020 11:03                2166
function.pdf-open-gif.php                          27-Sep-2020 11:03                1566
function.pdf-open-image-file.php                   27-Sep-2020 11:03                2467
function.pdf-open-image.php                        27-Sep-2020 11:03                2952
function.pdf-open-jpeg.php                         27-Sep-2020 11:03                1575
function.pdf-open-memory-image.php                 27-Sep-2020 11:03                1932
function.pdf-open-pdi-document.php                 27-Sep-2020 11:03                2027
function.pdf-open-pdi-page.php                     27-Sep-2020 11:03                2219
function.pdf-open-pdi.php                          27-Sep-2020 11:03                2325
function.pdf-open-tiff.php                         27-Sep-2020 11:03                1571
function.pdf-pcos-get-number.php                   27-Sep-2020 11:03                2013
function.pdf-pcos-get-stream.php                   27-Sep-2020 11:03                2166
function.pdf-pcos-get-string.php                   27-Sep-2020 11:03                2031
function.pdf-place-image.php                       27-Sep-2020 11:03                2481
function.pdf-place-pdi-page.php                    27-Sep-2020 11:03                2601
function.pdf-process-pdi.php                       27-Sep-2020 11:03                2069
function.pdf-rect.php                              27-Sep-2020 11:03                2173
function.pdf-restore.php                           27-Sep-2020 11:03                1797
function.pdf-resume-page.php                       27-Sep-2020 11:03                1808
function.pdf-rotate.php                            27-Sep-2020 11:03                1881
function.pdf-save.php                              27-Sep-2020 11:03                1750
function.pdf-scale.php                             27-Sep-2020 11:03                1987
function.pdf-set-border-color.php                  27-Sep-2020 11:03                2495
function.pdf-set-border-dash.php                   27-Sep-2020 11:03                2432
function.pdf-set-border-style.php                  27-Sep-2020 11:03                2467
function.pdf-set-char-spacing.php                  27-Sep-2020 11:03                1688
function.pdf-set-duration.php                      27-Sep-2020 11:03                1787
function.pdf-set-gstate.php                        27-Sep-2020 11:03                1841
function.pdf-set-horiz-scaling.php                 27-Sep-2020 11:03                1695
function.pdf-set-info-author.php                   27-Sep-2020 11:03                1643
function.pdf-set-info-creator.php                  27-Sep-2020 11:03                1648
function.pdf-set-info-keywords.php                 27-Sep-2020 11:03                1655
function.pdf-set-info-subject.php                  27-Sep-2020 11:03                1646
function.pdf-set-info-title.php                    27-Sep-2020 11:03                1617
function.pdf-set-info.php                          27-Sep-2020 11:03                2138
function.pdf-set-layer-dependency.php              27-Sep-2020 11:03                2197
function.pdf-set-leading.php                       27-Sep-2020 11:03                1678
function.pdf-set-parameter.php                     27-Sep-2020 11:03                2073
function.pdf-set-text-matrix.php                   27-Sep-2020 11:03                1893
function.pdf-set-text-pos.php                      27-Sep-2020 11:03                2071
function.pdf-set-text-rendering.php                27-Sep-2020 11:03                1703
function.pdf-set-text-rise.php                     27-Sep-2020 11:03                1661
function.pdf-set-value.php                         27-Sep-2020 11:03                2081
function.pdf-set-word-spacing.php                  27-Sep-2020 11:03                1674
function.pdf-setcolor.php                          27-Sep-2020 11:03                2476
function.pdf-setdash.php                           27-Sep-2020 11:03                2099
function.pdf-setdashpattern.php                    27-Sep-2020 11:03                1942
function.pdf-setflat.php                           27-Sep-2020 11:03                1896
function.pdf-setfont.php                           27-Sep-2020 11:03                2225
function.pdf-setgray-fill.php                      27-Sep-2020 11:03                2186
function.pdf-setgray-stroke.php                    27-Sep-2020 11:03                2200
function.pdf-setgray.php                           27-Sep-2020 11:03                2163
function.pdf-setlinecap.php                        27-Sep-2020 11:03                1907
function.pdf-setlinejoin.php                       27-Sep-2020 11:03                2022
function.pdf-setlinewidth.php                      27-Sep-2020 11:03                1923
function.pdf-setmatrix.php                         27-Sep-2020 11:03                2486
function.pdf-setmiterlimit.php                     27-Sep-2020 11:03                1928
function.pdf-setpolydash.php                       27-Sep-2020 11:03                1628
function.pdf-setrgbcolor-fill.php                  27-Sep-2020 11:03                2434
function.pdf-setrgbcolor-stroke.php                27-Sep-2020 11:03                2448
function.pdf-setrgbcolor.php                       27-Sep-2020 11:03                2432
function.pdf-shading-pattern.php                   27-Sep-2020 11:03                2043
function.pdf-shading.php                           27-Sep-2020 11:03                2845
function.pdf-shfill.php                            27-Sep-2020 11:03                1874
function.pdf-show-boxed.php                        27-Sep-2020 11:03                2743
function.pdf-show-xy.php                           27-Sep-2020 11:03                2136
function.pdf-show.php                              27-Sep-2020 11:03                1942
function.pdf-skew.php                              27-Sep-2020 11:03                2103
function.pdf-stringwidth.php                       27-Sep-2020 11:03                2067
function.pdf-stroke.php                            27-Sep-2020 11:03                1819
function.pdf-suspend-page.php                      27-Sep-2020 11:03                1953
function.pdf-translate.php                         27-Sep-2020 11:03                1947
function.pdf-utf16-to-utf8.php                     27-Sep-2020 11:03                1877
function.pdf-utf32-to-utf16.php                    27-Sep-2020 11:03                2014
function.pdf-utf8-to-utf16.php                     27-Sep-2020 11:03                1977
function.pfsockopen.php                            27-Sep-2020 11:03                3265
function.pg-affected-rows.php                      27-Sep-2020 11:03                5984
function.pg-cancel-query.php                       27-Sep-2020 11:03                6785
function.pg-client-encoding.php                    27-Sep-2020 11:03                5478
function.pg-close.php                              27-Sep-2020 11:03                5068
function.pg-connect-poll.php                       27-Sep-2020 11:03                2795
function.pg-connect.php                            27-Sep-2020 11:03               10791
function.pg-connection-busy.php                    27-Sep-2020 11:03                4933
function.pg-connection-reset.php                   27-Sep-2020 11:03                4925
function.pg-connection-status.php                  27-Sep-2020 11:03                4735
function.pg-consume-input.php                      27-Sep-2020 11:03                2557
function.pg-convert.php                            27-Sep-2020 11:03                8726
function.pg-copy-from.php                          27-Sep-2020 11:03                6763
function.pg-copy-to.php                            27-Sep-2020 11:03                6146
function.pg-dbname.php                             27-Sep-2020 11:03                3990
function.pg-delete.php                             27-Sep-2020 11:03                9015
function.pg-end-copy.php                           27-Sep-2020 11:03                5962
function.pg-escape-bytea.php                       27-Sep-2020 11:03                6981
function.pg-escape-identifier.php                  27-Sep-2020 11:03                6892
function.pg-escape-literal.php                     27-Sep-2020 11:03                7552
function.pg-escape-string.php                      27-Sep-2020 11:03                6858
function.pg-execute.php                            27-Sep-2020 11:03                9010
function.pg-fetch-all-columns.php                  27-Sep-2020 11:03                6456
function.pg-fetch-all.php                          27-Sep-2020 11:03                7318
function.pg-fetch-array.php                        27-Sep-2020 11:03               11475
function.pg-fetch-assoc.php                        27-Sep-2020 11:03                8200
function.pg-fetch-object.php                       27-Sep-2020 11:03               10238
function.pg-fetch-result.php                       27-Sep-2020 11:03                7597
function.pg-fetch-row.php                          27-Sep-2020 11:03                7383
function.pg-field-is-null.php                      27-Sep-2020 11:03                7548
function.pg-field-name.php                         27-Sep-2020 11:03                8614
function.pg-field-num.php                          27-Sep-2020 11:03                5666
function.pg-field-prtlen.php                       27-Sep-2020 11:03               10087
function.pg-field-size.php                         27-Sep-2020 11:03                8853
function.pg-field-table.php                        27-Sep-2020 11:03                7490
function.pg-field-type-oid.php                     27-Sep-2020 11:03                6686
function.pg-field-type.php                         27-Sep-2020 11:03                6592
function.pg-flush.php                              27-Sep-2020 11:03                2596
function.pg-free-result.php                        27-Sep-2020 11:03                6498
function.pg-get-notify.php                         27-Sep-2020 11:03                6344
function.pg-get-pid.php                            27-Sep-2020 11:03                4315
function.pg-get-result.php                         27-Sep-2020 11:03                7572
function.pg-host.php                               27-Sep-2020 11:03                5072
function.pg-insert.php                             27-Sep-2020 11:03                9483
function.pg-last-error.php                         27-Sep-2020 11:03                6150
function.pg-last-notice.php                        27-Sep-2020 11:03                7363
function.pg-last-oid.php                           27-Sep-2020 11:03                6589
function.pg-lo-close.php                           27-Sep-2020 11:03                6618
function.pg-lo-create.php                          27-Sep-2020 11:03                7712
function.pg-lo-export.php                          27-Sep-2020 11:03                7113
function.pg-lo-import.php                          27-Sep-2020 11:03                6718
function.pg-lo-open.php                            27-Sep-2020 11:03                7405
function.pg-lo-read-all.php                        27-Sep-2020 11:03                5736
function.pg-lo-read.php                            27-Sep-2020 11:03                6254
function.pg-lo-seek.php                            27-Sep-2020 11:03                7457
function.pg-lo-tell.php                            27-Sep-2020 11:03                6943
function.pg-lo-truncate.php                        27-Sep-2020 11:03                6384
function.pg-lo-unlink.php                          27-Sep-2020 11:03                6057
function.pg-lo-write.php                           27-Sep-2020 11:03                6920
function.pg-meta-data.php                          27-Sep-2020 11:03                7005
function.pg-num-fields.php                         27-Sep-2020 11:03                5064
function.pg-num-rows.php                           27-Sep-2020 11:03                5008
function.pg-options.php                            27-Sep-2020 11:03                4333
function.pg-parameter-status.php                   27-Sep-2020 11:03                7238
function.pg-pconnect.php                           27-Sep-2020 11:03                8689
function.pg-ping.php                               27-Sep-2020 11:03                4635
function.pg-port.php                               27-Sep-2020 11:03                4548
function.pg-prepare.php                            27-Sep-2020 11:03                8958
function.pg-put-line.php                           27-Sep-2020 11:03                7661
function.pg-query-params.php                       27-Sep-2020 11:03                9311
function.pg-query.php                              27-Sep-2020 11:03               11036
function.pg-result-error-field.php                 27-Sep-2020 11:03                7472
function.pg-result-error.php                       27-Sep-2020 11:03                7256
function.pg-result-seek.php                        27-Sep-2020 11:03                6407
function.pg-result-status.php                      27-Sep-2020 11:03                6968
function.pg-select.php                             27-Sep-2020 11:03                9478
function.pg-send-execute.php                       27-Sep-2020 11:03               10136
function.pg-send-prepare.php                       27-Sep-2020 11:03               10509
function.pg-send-query-params.php                  27-Sep-2020 11:03                7142
function.pg-send-query.php                         27-Sep-2020 11:03                8998
function.pg-set-client-encoding.php                27-Sep-2020 11:03                7936
function.pg-set-error-verbosity.php                27-Sep-2020 11:03                7436
function.pg-socket.php                             27-Sep-2020 11:03                2690
function.pg-trace.php                              27-Sep-2020 11:03                6827
function.pg-transaction-status.php                 27-Sep-2020 11:03                5628
function.pg-tty.php                                27-Sep-2020 11:03                4874
function.pg-unescape-bytea.php                     27-Sep-2020 11:03                6882
function.pg-untrace.php                            27-Sep-2020 11:03                5191
function.pg-update.php                             27-Sep-2020 11:03               10210
function.pg-version.php                            27-Sep-2020 11:03                5258
function.php-ini-loaded-file.php                   27-Sep-2020 11:02                4432
function.php-ini-scanned-files.php                 27-Sep-2020 11:02                6113
function.php-sapi-name.php                         27-Sep-2020 11:02                5494
function.php-strip-whitespace.php                  27-Sep-2020 11:03                4947
function.php-uname.php                             27-Sep-2020 11:02                9312
function.phpcredits.php                            27-Sep-2020 11:02                7887
function.phpdbg-break-file.php                     27-Sep-2020 11:02                3542
function.phpdbg-break-function.php                 27-Sep-2020 11:02                3324
function.phpdbg-break-method.php                   27-Sep-2020 11:02                3608
function.phpdbg-break-next.php                     27-Sep-2020 11:02                3056
function.phpdbg-clear.php                          27-Sep-2020 11:02                3321
function.phpdbg-color.php                          27-Sep-2020 11:02                3438
function.phpdbg-end-oplog.php                      27-Sep-2020 11:02                2245
function.phpdbg-exec.php                           27-Sep-2020 11:02                2686
function.phpdbg-get-executable.php                 27-Sep-2020 11:02                2292
function.phpdbg-prompt.php                         27-Sep-2020 11:02                2630
function.phpdbg-start-oplog.php                    27-Sep-2020 11:02                2151
function.phpinfo.php                               27-Sep-2020 11:02                9309
function.phpversion.php                            27-Sep-2020 11:02               10213
function.pi.php                                    27-Sep-2020 11:03                2729
function.png2wbmp.php                              27-Sep-2020 11:03                6316
function.popen.php                                 27-Sep-2020 11:03                8411
function.pos.php                                   27-Sep-2020 11:03                1488
function.posix-access.php                          27-Sep-2020 11:03                6401
function.posix-ctermid.php                         27-Sep-2020 11:03                4043
function.posix-errno.php                           27-Sep-2020 11:03                1652
function.posix-get-last-error.php                  27-Sep-2020 11:03                3893
function.posix-getcwd.php                          27-Sep-2020 11:03                3848
function.posix-getegid.php                         27-Sep-2020 11:03                5077
function.posix-geteuid.php                         27-Sep-2020 11:03                5018
function.posix-getgid.php                          27-Sep-2020 11:03                4525
function.posix-getgrgid.php                        27-Sep-2020 11:03                6194
function.posix-getgrnam.php                        27-Sep-2020 11:03                6205
function.posix-getgroups.php                       27-Sep-2020 11:03                3627
function.posix-getlogin.php                        27-Sep-2020 11:03                3126
function.posix-getpgid.php                         27-Sep-2020 11:03                4293
function.posix-getpgrp.php                         27-Sep-2020 11:03                2279
function.posix-getpid.php                          27-Sep-2020 11:03                3076
function.posix-getppid.php                         27-Sep-2020 11:03                2702
function.posix-getpwnam.php                        27-Sep-2020 11:03                6447
function.posix-getpwuid.php                        27-Sep-2020 11:03                6364
function.posix-getrlimit.php                       27-Sep-2020 11:03                6714
function.posix-getsid.php                          27-Sep-2020 11:03                4321
function.posix-getuid.php                          27-Sep-2020 11:03                3112
function.posix-initgroups.php                      27-Sep-2020 11:03                2920
function.posix-isatty.php                          27-Sep-2020 11:03                3703
function.posix-kill.php                            27-Sep-2020 11:03                3077
function.posix-mkfifo.php                          27-Sep-2020 11:03                3567
function.posix-mknod.php                           27-Sep-2020 11:03                6867
function.posix-setegid.php                         27-Sep-2020 11:03                4927
function.posix-seteuid.php                         27-Sep-2020 11:03                3225
function.posix-setgid.php                          27-Sep-2020 11:03                5131
function.posix-setpgid.php                         27-Sep-2020 11:03                2968
function.posix-setrlimit.php                       27-Sep-2020 11:03                4033
function.posix-setsid.php                          27-Sep-2020 11:03                2199
function.posix-setuid.php                          27-Sep-2020 11:03                5246
function.posix-strerror.php                        27-Sep-2020 11:03                4571
function.posix-times.php                           27-Sep-2020 11:03                4111
function.posix-ttyname.php                         27-Sep-2020 11:03                3292
function.posix-uname.php                           27-Sep-2020 11:03                4217
function.pow.php                                   27-Sep-2020 11:03                7118
function.preg-filter.php                           27-Sep-2020 11:03                8810
function.preg-grep.php                             27-Sep-2020 11:03                5244
function.preg-last-error.php                       27-Sep-2020 11:03                4114
function.preg-match-all.php                        27-Sep-2020 11:03               25197
function.preg-match.php                            27-Sep-2020 11:03               22991
function.preg-quote.php                            27-Sep-2020 11:03                8538
function.preg-replace-callback-array.php           27-Sep-2020 11:03                9736
function.preg-replace-callback.php                 27-Sep-2020 11:03               17272
function.preg-replace.php                          27-Sep-2020 11:03               21180
function.preg-split.php                            27-Sep-2020 11:03               11792
function.prev.php                                  27-Sep-2020 11:03                7585
function.print-r.php                               27-Sep-2020 11:03                9099
function.print.php                                 27-Sep-2020 11:03                7914
function.printf.php                                27-Sep-2020 11:03               23736
function.proc-close.php                            27-Sep-2020 11:03                3450
function.proc-get-status.php                       27-Sep-2020 11:03                6189
function.proc-nice.php                             27-Sep-2020 11:03                7037
function.proc-open.php                             27-Sep-2020 11:03               21630
function.proc-terminate.php                        27-Sep-2020 11:03                4514
function.property-exists.php                       27-Sep-2020 11:03                8442
function.ps-add-bookmark.php                       27-Sep-2020 11:03                4666
function.ps-add-launchlink.php                     27-Sep-2020 11:03                5101
function.ps-add-locallink.php                      27-Sep-2020 11:03                5809
function.ps-add-note.php                           27-Sep-2020 11:03                6397
function.ps-add-pdflink.php                        27-Sep-2020 11:03                6105
function.ps-add-weblink.php                        27-Sep-2020 11:03                5190
function.ps-arc.php                                27-Sep-2020 11:03                4588
function.ps-arcn.php                               27-Sep-2020 11:03                4593
function.ps-begin-page.php                         27-Sep-2020 11:03                6589
function.ps-begin-pattern.php                      27-Sep-2020 11:03               12941
function.ps-begin-template.php                     27-Sep-2020 11:03               11254
function.ps-circle.php                             27-Sep-2020 11:03                4273
function.ps-clip.php                               27-Sep-2020 11:03                2802
function.ps-close-image.php                        27-Sep-2020 11:03                3575
function.ps-close.php                              27-Sep-2020 11:03                3454
function.ps-closepath-stroke.php                   27-Sep-2020 11:03                2863
function.ps-closepath.php                          27-Sep-2020 11:03                3046
function.ps-continue-text.php                      27-Sep-2020 11:03                3817
function.ps-curveto.php                            27-Sep-2020 11:03                4382
function.ps-delete.php                             27-Sep-2020 11:03                3317
function.ps-end-page.php                           27-Sep-2020 11:03                3042
function.ps-end-pattern.php                        27-Sep-2020 11:03                2969
function.ps-end-template.php                       27-Sep-2020 11:03                2975
function.ps-fill-stroke.php                        27-Sep-2020 11:03                3092
function.ps-fill.php                               27-Sep-2020 11:03                3029
function.ps-findfont.php                           27-Sep-2020 11:03                6651
function.ps-get-buffer.php                         27-Sep-2020 11:03                3041
function.ps-get-parameter.php                      27-Sep-2020 11:03                7348
function.ps-get-value.php                          27-Sep-2020 11:03                9204
function.ps-hyphenate.php                          27-Sep-2020 11:03                6961
function.ps-include-file.php                       27-Sep-2020 11:03                2809
function.ps-lineto.php                             27-Sep-2020 11:03                8077
function.ps-makespotcolor.php                      27-Sep-2020 11:03               10189
function.ps-moveto.php                             27-Sep-2020 11:03                3511
function.ps-new.php                                27-Sep-2020 11:03                2585
function.ps-open-file.php                          27-Sep-2020 11:03                3362
function.ps-open-image-file.php                    27-Sep-2020 11:03                4424
function.ps-open-image.php                         27-Sep-2020 11:03                6162
function.ps-open-memory-image.php                  27-Sep-2020 11:03                2603
function.ps-place-image.php                        27-Sep-2020 11:03                4682
function.ps-rect.php                               27-Sep-2020 11:03                4424
function.ps-restore.php                            27-Sep-2020 11:03                3155
function.ps-rotate.php                             27-Sep-2020 11:03               12243
function.ps-save.php                               27-Sep-2020 11:03                2905
function.ps-scale.php                              27-Sep-2020 11:03                3436
function.ps-set-border-color.php                   27-Sep-2020 11:03                4380
function.ps-set-border-dash.php                    27-Sep-2020 11:03                4132
function.ps-set-border-style.php                   27-Sep-2020 11:03                4193
function.ps-set-info.php                           27-Sep-2020 11:03                5671
function.ps-set-parameter.php                      27-Sep-2020 11:03                3604
function.ps-set-text-pos.php                       27-Sep-2020 11:03                9233
function.ps-set-value.php                          27-Sep-2020 11:03                4444
function.ps-setcolor.php                           27-Sep-2020 11:03                5149
function.ps-setdash.php                            27-Sep-2020 11:03                3306
function.ps-setflat.php                            27-Sep-2020 11:03                2803
function.ps-setfont.php                            27-Sep-2020 11:03                3739
function.ps-setgray.php                            27-Sep-2020 11:03                3029
function.ps-setlinecap.php                         27-Sep-2020 11:03                3582
function.ps-setlinejoin.php                        27-Sep-2020 11:03                3599
function.ps-setlinewidth.php                       27-Sep-2020 11:03                3462
function.ps-setmiterlimit.php                      27-Sep-2020 11:03                3881
function.ps-setoverprintmode.php                   27-Sep-2020 11:03                2831
function.ps-setpolydash.php                        27-Sep-2020 11:03                7633
function.ps-shading-pattern.php                    27-Sep-2020 11:03                3856
function.ps-shading.php                            27-Sep-2020 11:03                6071
function.ps-shfill.php                             27-Sep-2020 11:03                3694
function.ps-show-boxed.php                         27-Sep-2020 11:03               11098
function.ps-show-xy.php                            27-Sep-2020 11:03                3757
function.ps-show-xy2.php                           27-Sep-2020 11:03                2498
function.ps-show.php                               27-Sep-2020 11:03                5519
function.ps-show2.php                              27-Sep-2020 11:03                2961
function.ps-string-geometry.php                    27-Sep-2020 11:03                4474
function.ps-stringwidth.php                        27-Sep-2020 11:03                3940
function.ps-stroke.php                             27-Sep-2020 11:03                3239
function.ps-symbol-name.php                        27-Sep-2020 11:03                3644
function.ps-symbol-width.php                       27-Sep-2020 11:03                4028
function.ps-symbol.php                             27-Sep-2020 11:03                3440
function.ps-translate.php                          27-Sep-2020 11:03               14279
function.pspell-add-to-personal.php                27-Sep-2020 11:03                5302
function.pspell-add-to-session.php                 27-Sep-2020 11:03                2898
function.pspell-check.php                          27-Sep-2020 11:03                3987
function.pspell-clear-session.php                  27-Sep-2020 11:03                4815
function.pspell-config-create.php                  27-Sep-2020 11:03                6759
function.pspell-config-data-dir.php                27-Sep-2020 11:03                2318
function.pspell-config-dict-dir.php                27-Sep-2020 11:03                2317
function.pspell-config-ignore.php                  27-Sep-2020 11:03                4657
function.pspell-config-mode.php                    27-Sep-2020 11:03                5309
function.pspell-config-personal.php                27-Sep-2020 11:03                5412
function.pspell-config-repl.php                    27-Sep-2020 11:03                5728
function.pspell-config-runtogether.php             27-Sep-2020 11:03                5176
function.pspell-config-save-repl.php               27-Sep-2020 11:03                4065
function.pspell-new-config.php                     27-Sep-2020 11:03                4895
function.pspell-new-personal.php                   27-Sep-2020 11:03                8890
function.pspell-new.php                            27-Sep-2020 11:03                7548
function.pspell-save-wordlist.php                  27-Sep-2020 11:03                5135
function.pspell-store-replacement.php              27-Sep-2020 11:03                6708
function.pspell-suggest.php                        27-Sep-2020 11:03                4553
function.putenv.php                                27-Sep-2020 11:02                5235
function.px-close.php                              27-Sep-2020 11:03                3071
function.px-create-fp.php                          27-Sep-2020 11:03                9741
function.px-date2string.php                        27-Sep-2020 11:03                6802
function.px-delete-record.php                      27-Sep-2020 11:03                3181
function.px-delete.php                             27-Sep-2020 11:03                2444
function.px-get-field.php                          27-Sep-2020 11:03                2941
function.px-get-info.php                           27-Sep-2020 11:03                5358
function.px-get-parameter.php                      27-Sep-2020 11:03                3865
function.px-get-record.php                         27-Sep-2020 11:03                4740
function.px-get-schema.php                         27-Sep-2020 11:03                3753
function.px-get-value.php                          27-Sep-2020 11:03                3026
function.px-insert-record.php                      27-Sep-2020 11:03               14281
function.px-new.php                                27-Sep-2020 11:03                6536
function.px-numfields.php                          27-Sep-2020 11:03                2612
function.px-numrecords.php                         27-Sep-2020 11:03                2631
function.px-open-fp.php                            27-Sep-2020 11:03                3832
function.px-put-record.php                         27-Sep-2020 11:03                3687
function.px-retrieve-record.php                    27-Sep-2020 11:03                4823
function.px-set-blob-file.php                      27-Sep-2020 11:03                3983
function.px-set-parameter.php                      27-Sep-2020 11:03                4340
function.px-set-tablename.php                      27-Sep-2020 11:03                3467
function.px-set-targetencoding.php                 27-Sep-2020 11:03                4147
function.px-set-value.php                          27-Sep-2020 11:03                3560
function.px-timestamp2string.php                   27-Sep-2020 11:03                8197
function.px-update-record.php                      27-Sep-2020 11:03                4064
function.quoted-printable-decode.php               27-Sep-2020 11:03                3342
function.quoted-printable-encode.php               27-Sep-2020 11:03                3293
function.quotemeta.php                             27-Sep-2020 11:03                4575
function.rad2deg.php                               27-Sep-2020 11:03                3414
function.radius-acct-open.php                      27-Sep-2020 11:02                2920
function.radius-add-server.php                     27-Sep-2020 11:02                7130
function.radius-auth-open.php                      27-Sep-2020 11:02                2929
function.radius-close.php                          27-Sep-2020 11:02                2050
function.radius-config.php                         27-Sep-2020 11:02                3709
function.radius-create-request.php                 27-Sep-2020 11:02                4884
function.radius-cvt-addr.php                       27-Sep-2020 11:02                6113
function.radius-cvt-int.php                        27-Sep-2020 11:02                5335
function.radius-cvt-string.php                     27-Sep-2020 11:02                5389
function.radius-demangle-mppe-key.php              27-Sep-2020 11:02                2448
function.radius-demangle.php                       27-Sep-2020 11:02                2191
function.radius-get-attr.php                       27-Sep-2020 11:02                6373
function.radius-get-tagged-attr-data.php           27-Sep-2020 11:02                6539
function.radius-get-tagged-attr-tag.php            27-Sep-2020 11:02                6595
function.radius-get-vendor-attr.php                27-Sep-2020 11:02                8413
function.radius-put-addr.php                       27-Sep-2020 11:02                4704
function.radius-put-attr.php                       27-Sep-2020 11:02                8123
function.radius-put-int.php                        27-Sep-2020 11:02                6798
function.radius-put-string.php                     27-Sep-2020 11:02                7183
function.radius-put-vendor-addr.php                27-Sep-2020 11:02                4776
function.radius-put-vendor-attr.php                27-Sep-2020 11:02                6920
function.radius-put-vendor-int.php                 27-Sep-2020 11:02                5373
function.radius-put-vendor-string.php              27-Sep-2020 11:02                5761
function.radius-request-authenticator.php          27-Sep-2020 11:02                2583
function.radius-salt-encrypt-attr.php              27-Sep-2020 11:02                3776
function.radius-send-request.php                   27-Sep-2020 11:02                3221
function.radius-server-secret.php                  27-Sep-2020 11:02                2119
function.radius-strerror.php                       27-Sep-2020 11:02                2072
function.rand.php                                  27-Sep-2020 11:03                9685
function.random-bytes.php                          27-Sep-2020 11:02                6712
function.random-int.php                            27-Sep-2020 11:02                6841
function.range.php                                 27-Sep-2020 11:03                7638
function.rar-wrapper-cache-stats.php               27-Sep-2020 11:02                2198
function.rawurldecode.php                          27-Sep-2020 11:03                4444
function.rawurlencode.php                          27-Sep-2020 11:03                6414
function.read-exif-data.php                        27-Sep-2020 11:03                2084
function.readdir.php                               27-Sep-2020 11:03                9880
function.readfile.php                              27-Sep-2020 11:03                9645
function.readgzfile.php                            27-Sep-2020 11:02                4077
function.readline-add-history.php                  27-Sep-2020 11:02                2430
function.readline-callback-handler-install.php     27-Sep-2020 11:02                9835
function.readline-callback-handler-remove.php      27-Sep-2020 11:02                3446
function.readline-callback-read-char.php           27-Sep-2020 11:02                3509
function.readline-clear-history.php                27-Sep-2020 11:02                2051
function.readline-completion-function.php          27-Sep-2020 11:02                2753
function.readline-info.php                         27-Sep-2020 11:02                3053
function.readline-list-history.php                 27-Sep-2020 11:02                1991
function.readline-on-new-line.php                  27-Sep-2020 11:02                2002
function.readline-read-history.php                 27-Sep-2020 11:02                2442
function.readline-redisplay.php                    27-Sep-2020 11:02                1935
function.readline-write-history.php                27-Sep-2020 11:02                2399
function.readline.php                              27-Sep-2020 11:02                4747
function.readlink.php                              27-Sep-2020 11:03                4149
function.realpath-cache-get.php                    27-Sep-2020 11:03                3862
function.realpath-cache-size.php                   27-Sep-2020 11:03                3347
function.realpath.php                              27-Sep-2020 11:03                7915
function.recode-file.php                           27-Sep-2020 11:03                5482
function.recode-string.php                         27-Sep-2020 11:03                4318
function.recode.php                                27-Sep-2020 11:03                1596
function.register-shutdown-function.php            27-Sep-2020 11:03                7025
function.register-tick-function.php                27-Sep-2020 11:03                5673
function.rename.php                                27-Sep-2020 11:03                5050
function.require-once.php                          27-Sep-2020 11:02                1664
function.require.php                               27-Sep-2020 11:02                1720
function.reset.php                                 27-Sep-2020 11:03                8040
function.restore-error-handler.php                 27-Sep-2020 11:02                5461
function.restore-exception-handler.php             27-Sep-2020 11:02                6589
function.restore-include-path.php                  27-Sep-2020 11:02                4730
function.return.php                                27-Sep-2020 11:02                3656
function.rewind.php                                27-Sep-2020 11:03                6056
function.rewinddir.php                             27-Sep-2020 11:03                2768
function.rmdir.php                                 27-Sep-2020 11:03                5112
function.round.php                                 27-Sep-2020 11:03               23563
function.rpmaddtag.php                             27-Sep-2020 11:03                3016
function.rpmdbinfo.php                             27-Sep-2020 11:03                4728
function.rpmdbsearch.php                           27-Sep-2020 11:03                5410
function.rpminfo.php                               27-Sep-2020 11:03                4825
function.rpmvercmp.php                             27-Sep-2020 11:03                2462
function.rrd-create.php                            27-Sep-2020 11:03                2547
function.rrd-error.php                             27-Sep-2020 11:03                1954
function.rrd-fetch.php                             27-Sep-2020 11:03                2662
function.rrd-first.php                             27-Sep-2020 11:03                2586
function.rrd-graph.php                             27-Sep-2020 11:03                2835
function.rrd-info.php                              27-Sep-2020 11:03                2216
function.rrd-last.php                              27-Sep-2020 11:03                2222
function.rrd-lastupdate.php                        27-Sep-2020 11:03                2341
function.rrd-restore.php                           27-Sep-2020 11:03                2841
function.rrd-tune.php                              27-Sep-2020 11:03                2614
function.rrd-update.php                            27-Sep-2020 11:03                2693
function.rrd-version.php                           27-Sep-2020 11:03                2046
function.rrd-xport.php                             27-Sep-2020 11:03                2396
function.rrdc-disconnect.php                       27-Sep-2020 11:03                2427
function.rsort.php                                 27-Sep-2020 11:03                6015
function.rtrim.php                                 27-Sep-2020 11:03                9540
function.runkit7-constant-add.php                  27-Sep-2020 11:02                4037
function.runkit7-constant-redefine.php             27-Sep-2020 11:02                3909
function.runkit7-constant-remove.php               27-Sep-2020 11:02                3296
function.runkit7-function-add.php                  27-Sep-2020 11:02                8219
function.runkit7-function-copy.php                 27-Sep-2020 11:02                5134
function.runkit7-function-redefine.php             27-Sep-2020 11:02                8601
function.runkit7-function-remove.php               27-Sep-2020 11:02                3754
function.runkit7-function-rename.php               27-Sep-2020 11:02                3975
function.runkit7-import.php                        27-Sep-2020 11:02                3162
function.runkit7-method-add.php                    27-Sep-2020 11:02               10052
function.runkit7-method-copy.php                   27-Sep-2020 11:02                6699
function.runkit7-method-redefine.php               27-Sep-2020 11:02               10513
function.runkit7-method-remove.php                 27-Sep-2020 11:02                6323
function.runkit7-method-rename.php                 27-Sep-2020 11:02                6328
function.runkit7-object-id.php                     27-Sep-2020 11:02                2960
function.runkit7-superglobals.php                  27-Sep-2020 11:02                2481
function.runkit7-zval-inspect.php                  27-Sep-2020 11:02                2046
function.sapi-windows-cp-conv.php                  27-Sep-2020 11:03                4083
function.sapi-windows-cp-get.php                   27-Sep-2020 11:03                2729
function.sapi-windows-cp-is-utf8.php               27-Sep-2020 11:03                2577
function.sapi-windows-cp-set.php                   27-Sep-2020 11:03                2700
function.sapi-windows-generate-ctrl-event.php      27-Sep-2020 11:03                7493
function.sapi-windows-set-ctrl-handler.php         27-Sep-2020 11:03                7199
function.sapi-windows-vt100-support.php            27-Sep-2020 11:03                9043
function.scandir.php                               27-Sep-2020 11:03                7559
function.scoutapm-get-calls.php                    27-Sep-2020 11:03                4283
function.scoutapm-list-instrumented-functions.php  27-Sep-2020 11:03                3602
function.seaslog-get-author.php                    27-Sep-2020 11:03                2939
function.seaslog-get-version.php                   27-Sep-2020 11:03                2936
function.sem-acquire.php                           27-Sep-2020 11:03                4508
function.sem-get.php                               27-Sep-2020 11:03                5327
function.sem-release.php                           27-Sep-2020 11:03                3237
function.sem-remove.php                            27-Sep-2020 11:03                3224
function.serialize.php                             27-Sep-2020 11:03               11084
function.session-abort.php                         27-Sep-2020 11:03                3735
function.session-cache-expire.php                  27-Sep-2020 11:03                6542
function.session-cache-limiter.php                 27-Sep-2020 11:03                7816
function.session-commit.php                        27-Sep-2020 11:03                1682
function.session-create-id.php                     27-Sep-2020 11:03               10621
function.session-decode.php                        27-Sep-2020 11:03                3435
function.session-destroy.php                       27-Sep-2020 11:03                9293
function.session-encode.php                        27-Sep-2020 11:03                3345
function.session-gc.php                            27-Sep-2020 11:03                7747
function.session-get-cookie-params.php             27-Sep-2020 11:03                5234
function.session-id.php                            27-Sep-2020 11:03                4841
function.session-is-registered.php                 27-Sep-2020 11:03                4027
function.session-module-name.php                   27-Sep-2020 11:03                3464
function.session-name.php                          27-Sep-2020 11:03                6855
function.session-regenerate-id.php                 27-Sep-2020 11:03               17949
function.session-register-shutdown.php             27-Sep-2020 11:03                2550
function.session-register.php                      27-Sep-2020 11:03                9726
function.session-reset.php                         27-Sep-2020 11:03                3804
function.session-save-path.php                     27-Sep-2020 11:03                3475
function.session-set-cookie-params.php             27-Sep-2020 11:03                8609
function.session-set-save-handler.php              27-Sep-2020 11:03               33726
function.session-start.php                         27-Sep-2020 11:03               14606
function.session-status.php                        27-Sep-2020 11:03                2754
function.session-unregister.php                    27-Sep-2020 11:03                4625
function.session-unset.php                         27-Sep-2020 11:03                4008
function.session-write-close.php                   27-Sep-2020 11:03                3581
function.set-error-handler.php                     27-Sep-2020 11:02               27332
function.set-exception-handler.php                 27-Sep-2020 11:02                8592
function.set-file-buffer.php                       27-Sep-2020 11:03                1643
function.set-include-path.php                      27-Sep-2020 11:02                5898
function.set-time-limit.php                        27-Sep-2020 11:02                4710
function.setcookie.php                             27-Sep-2020 11:03               25187
function.setlocale.php                             27-Sep-2020 11:03               14110
function.setproctitle.php                          27-Sep-2020 11:03                4172
function.setrawcookie.php                          27-Sep-2020 11:03                4870
function.setthreadtitle.php                        27-Sep-2020 11:03                3887
function.settype.php                               27-Sep-2020 11:03                6187
function.sha1-file.php                             27-Sep-2020 11:03                5370
function.sha1.php                                  27-Sep-2020 11:03                5653
function.shell-exec.php                            27-Sep-2020 11:03                5077
function.shm-attach.php                            27-Sep-2020 11:03                7099
function.shm-detach.php                            27-Sep-2020 11:03                3500
function.shm-get-var.php                           27-Sep-2020 11:03                3453
function.shm-has-var.php                           27-Sep-2020 11:03                3283
function.shm-put-var.php                           27-Sep-2020 11:03                4341
function.shm-remove-var.php                        27-Sep-2020 11:03                3162
function.shm-remove.php                            27-Sep-2020 11:03                2916
function.shmop-close.php                           27-Sep-2020 11:03                4197
function.shmop-delete.php                          27-Sep-2020 11:03                3902
function.shmop-open.php                            27-Sep-2020 11:03                7800
function.shmop-read.php                            27-Sep-2020 11:03                5132
function.shmop-size.php                            27-Sep-2020 11:03                4043
function.shmop-write.php                           27-Sep-2020 11:03                5223
function.show-source.php                           27-Sep-2020 11:03                1610
function.shuffle.php                               27-Sep-2020 11:03                5389
function.similar-text.php                          27-Sep-2020 11:03                6922
function.simplexml-import-dom.php                  27-Sep-2020 11:03                6525
function.simplexml-load-file.php                   27-Sep-2020 11:03               10095
function.simplexml-load-string.php                 27-Sep-2020 11:03                9429
function.sin.php                                   27-Sep-2020 11:03                4520
function.sinh.php                                  27-Sep-2020 11:03                3000
function.sizeof.php                                27-Sep-2020 11:03                1505
function.sleep.php                                 27-Sep-2020 11:03                5616
function.snmp-get-quick-print.php                  27-Sep-2020 11:03                3264
function.snmp-get-valueretrieval.php               27-Sep-2020 11:03                4063
function.snmp-read-mib.php                         27-Sep-2020 11:03                4273
function.snmp-set-enum-print.php                   27-Sep-2020 11:03                4711
function.snmp-set-oid-numeric-print.php            27-Sep-2020 11:03                2406
function.snmp-set-oid-output-format.php            27-Sep-2020 11:03                7324
function.snmp-set-quick-print.php                  27-Sep-2020 11:03                6345
function.snmp-set-valueretrieval.php               27-Sep-2020 11:03                8815
function.snmp2-get.php                             27-Sep-2020 11:03                5118
function.snmp2-getnext.php                         27-Sep-2020 11:03                5489
function.snmp2-real-walk.php                       27-Sep-2020 11:03                5761
function.snmp2-set.php                             27-Sep-2020 11:03                9957
function.snmp2-walk.php                            27-Sep-2020 11:03                6291
function.snmp3-get.php                             27-Sep-2020 11:03                6990
function.snmp3-getnext.php                         27-Sep-2020 11:03                7325
function.snmp3-real-walk.php                       27-Sep-2020 11:03                7983
function.snmp3-set.php                             27-Sep-2020 11:03               12364
function.snmp3-walk.php                            27-Sep-2020 11:03                8284
function.snmpget.php                               27-Sep-2020 11:03                5122
function.snmpgetnext.php                           27-Sep-2020 11:03                5373
function.snmprealwalk.php                          27-Sep-2020 11:03                5646
function.snmpset.php                               27-Sep-2020 11:03               10076
function.snmpwalk.php                              27-Sep-2020 11:03                6334
function.snmpwalkoid.php                           27-Sep-2020 11:03                6969
function.socket-accept.php                         27-Sep-2020 11:03                5431
function.socket-addrinfo-bind.php                  27-Sep-2020 11:03                3718
function.socket-addrinfo-connect.php               27-Sep-2020 11:03                3496
function.socket-addrinfo-explain.php               27-Sep-2020 11:03                3488
function.socket-addrinfo-lookup.php                27-Sep-2020 11:03                4153
function.socket-bind.php                           27-Sep-2020 11:03               10095
function.socket-clear-error.php                    27-Sep-2020 11:03                3368
function.socket-close.php                          27-Sep-2020 11:03                3644
function.socket-cmsg-space.php                     27-Sep-2020 11:03                3323
function.socket-connect.php                        27-Sep-2020 11:03                5703
function.socket-create-listen.php                  27-Sep-2020 11:03                5891
function.socket-create-pair.php                    27-Sep-2020 11:03               19611
function.socket-create.php                         27-Sep-2020 11:03               10677
function.socket-export-stream.php                  27-Sep-2020 11:03                2464
function.socket-get-option.php                     27-Sep-2020 11:03               23597
function.socket-get-status.php                     27-Sep-2020 11:03                1677
function.socket-getopt.php                         27-Sep-2020 11:03                1662
function.socket-getpeername.php                    27-Sep-2020 11:03                6721
function.socket-getsockname.php                    27-Sep-2020 11:03                6035
function.socket-import-stream.php                  27-Sep-2020 11:03                4190
function.socket-last-error.php                     27-Sep-2020 11:03                5989
function.socket-listen.php                         27-Sep-2020 11:03                6202
function.socket-read.php                           27-Sep-2020 11:03                6597
function.socket-recv.php                           27-Sep-2020 11:03               15483
function.socket-recvfrom.php                       27-Sep-2020 11:03               11963
function.socket-recvmsg.php                        27-Sep-2020 11:03                3354
function.socket-select.php                         27-Sep-2020 11:03               14872
function.socket-send.php                           27-Sep-2020 11:03                5276
function.socket-sendmsg.php                        27-Sep-2020 11:03                3424
function.socket-sendto.php                         27-Sep-2020 11:03                8235
function.socket-set-block.php                      27-Sep-2020 11:03                5116
function.socket-set-blocking.php                   27-Sep-2020 11:03                1695
function.socket-set-nonblock.php                   27-Sep-2020 11:03                5470
function.socket-set-option.php                     27-Sep-2020 11:03               10531
function.socket-set-timeout.php                    27-Sep-2020 11:03                1664
function.socket-setopt.php                         27-Sep-2020 11:03                1656
function.socket-shutdown.php                       27-Sep-2020 11:03                3873
function.socket-strerror.php                       27-Sep-2020 11:03                7088
function.socket-write.php                          27-Sep-2020 11:03                5929
function.socket-wsaprotocol-info-export.php        27-Sep-2020 11:03                3949
function.socket-wsaprotocol-info-import.php        27-Sep-2020 11:03                3261
function.socket-wsaprotocol-info-release.php       27-Sep-2020 11:03                3266
function.sodium-add.php                            27-Sep-2020 11:03                2518
function.sodium-base642bin.php                     27-Sep-2020 11:03                2743
function.sodium-bin2base64.php                     27-Sep-2020 11:03                2518
function.sodium-bin2hex.php                        27-Sep-2020 11:03                2281
function.sodium-compare.php                        27-Sep-2020 11:03                2545
function.sodium-crypto-aead-aes256gcm-decrypt.php  27-Sep-2020 11:03                3231
function.sodium-crypto-aead-aes256gcm-encrypt.php  27-Sep-2020 11:03                3271
function.sodium-crypto-aead-aes256gcm-is-availa..> 27-Sep-2020 11:03                2474
function.sodium-crypto-aead-aes256gcm-keygen.php   27-Sep-2020 11:03                2435
function.sodium-crypto-aead-chacha20poly1305-de..> 27-Sep-2020 11:03                3353
function.sodium-crypto-aead-chacha20poly1305-en..> 27-Sep-2020 11:03                3335
function.sodium-crypto-aead-chacha20poly1305-ie..> 27-Sep-2020 11:03                3424
function.sodium-crypto-aead-chacha20poly1305-ie..> 27-Sep-2020 11:03                3388
function.sodium-crypto-aead-chacha20poly1305-ie..> 27-Sep-2020 11:03                2555
function.sodium-crypto-aead-chacha20poly1305-ke..> 27-Sep-2020 11:03                2522
function.sodium-crypto-aead-xchacha20poly1305-i..> 27-Sep-2020 11:03                3397
function.sodium-crypto-aead-xchacha20poly1305-i..> 27-Sep-2020 11:03                3395
function.sodium-crypto-aead-xchacha20poly1305-i..> 27-Sep-2020 11:03                2519
function.sodium-crypto-auth-keygen.php             27-Sep-2020 11:03                2323
function.sodium-crypto-auth-verify.php             27-Sep-2020 11:03                2889
function.sodium-crypto-auth.php                    27-Sep-2020 11:03                2646
function.sodium-crypto-box-keypair-from-secretk..> 27-Sep-2020 11:03                2908
function.sodium-crypto-box-keypair.php             27-Sep-2020 11:03                2366
function.sodium-crypto-box-open.php                27-Sep-2020 11:03                2903
function.sodium-crypto-box-publickey-from-secre..> 27-Sep-2020 11:03                2559
function.sodium-crypto-box-publickey.php           27-Sep-2020 11:03                2464
function.sodium-crypto-box-seal-open.php           27-Sep-2020 11:03                2674
function.sodium-crypto-box-seal.php                27-Sep-2020 11:03                2620
function.sodium-crypto-box-secretkey.php           27-Sep-2020 11:03                2430
function.sodium-crypto-box-seed-keypair.php        27-Sep-2020 11:03                2485
function.sodium-crypto-box.php                     27-Sep-2020 11:03                2818
function.sodium-crypto-generichash-final.php       27-Sep-2020 11:03                2774
function.sodium-crypto-generichash-init.php        27-Sep-2020 11:03                2784
function.sodium-crypto-generichash-keygen.php      27-Sep-2020 11:03                2364
function.sodium-crypto-generichash-update.php      27-Sep-2020 11:03                2733
function.sodium-crypto-generichash.php             27-Sep-2020 11:03                2976
function.sodium-crypto-kdf-derive-from-key.php     27-Sep-2020 11:03                3185
function.sodium-crypto-kdf-keygen.php              27-Sep-2020 11:03                2306
function.sodium-crypto-kx-client-session-keys.php  27-Sep-2020 11:03                2763
function.sodium-crypto-kx-keypair.php              27-Sep-2020 11:03                4869
function.sodium-crypto-kx-publickey.php            27-Sep-2020 11:03                2417
function.sodium-crypto-kx-secretkey.php            27-Sep-2020 11:03                2427
function.sodium-crypto-kx-seed-keypair.php         27-Sep-2020 11:03                2474
function.sodium-crypto-kx-server-session-keys.php  27-Sep-2020 11:03                2829
function.sodium-crypto-pwhash-scryptsalsa208sha..> 27-Sep-2020 11:03                3001
function.sodium-crypto-pwhash-scryptsalsa208sha..> 27-Sep-2020 11:03                3162
function.sodium-crypto-pwhash-scryptsalsa208sha..> 27-Sep-2020 11:03                3563
function.sodium-crypto-pwhash-str-needs-rehash.php 27-Sep-2020 11:03                3032
function.sodium-crypto-pwhash-str-verify.php       27-Sep-2020 11:03                4392
function.sodium-crypto-pwhash-str.php              27-Sep-2020 11:03                7944
function.sodium-crypto-pwhash.php                  27-Sep-2020 11:03                9075
function.sodium-crypto-scalarmult-base.php         27-Sep-2020 11:03                1858
function.sodium-crypto-scalarmult.php              27-Sep-2020 11:03                2712
function.sodium-crypto-secretbox-keygen.php        27-Sep-2020 11:03                2326
function.sodium-crypto-secretbox-open.php          27-Sep-2020 11:03                2929
function.sodium-crypto-secretbox.php               27-Sep-2020 11:03                2920
function.sodium-crypto-secretstream-xchacha20po..> 27-Sep-2020 11:03                2954
function.sodium-crypto-secretstream-xchacha20po..> 27-Sep-2020 11:03                2778
function.sodium-crypto-secretstream-xchacha20po..> 27-Sep-2020 11:03                2604
function.sodium-crypto-secretstream-xchacha20po..> 27-Sep-2020 11:03                3184
function.sodium-crypto-secretstream-xchacha20po..> 27-Sep-2020 11:03                3411
function.sodium-crypto-secretstream-xchacha20po..> 27-Sep-2020 11:03                2735
function.sodium-crypto-shorthash-keygen.php        27-Sep-2020 11:03                2368
function.sodium-crypto-shorthash.php               27-Sep-2020 11:03                2666
function.sodium-crypto-sign-detached.php           27-Sep-2020 11:03                2700
function.sodium-crypto-sign-ed25519-pk-to-curve..> 27-Sep-2020 11:03                2655
function.sodium-crypto-sign-ed25519-sk-to-curve..> 27-Sep-2020 11:03                2711
function.sodium-crypto-sign-keypair-from-secret..> 27-Sep-2020 11:03                2969
function.sodium-crypto-sign-keypair.php            27-Sep-2020 11:03                2379
function.sodium-crypto-sign-open.php               27-Sep-2020 11:03                2713
function.sodium-crypto-sign-publickey-from-secr..> 27-Sep-2020 11:03                2603
function.sodium-crypto-sign-publickey.php          27-Sep-2020 11:03                2485
function.sodium-crypto-sign-secretkey.php          27-Sep-2020 11:03                2453
function.sodium-crypto-sign-seed-keypair.php       27-Sep-2020 11:03                2530
function.sodium-crypto-sign-verify-detached.php    27-Sep-2020 11:03                2982
function.sodium-crypto-sign.php                    27-Sep-2020 11:03                2609
function.sodium-crypto-stream-keygen.php           27-Sep-2020 11:03                2279
function.sodium-crypto-stream-xor.php              27-Sep-2020 11:03                2853
function.sodium-crypto-stream.php                  27-Sep-2020 11:03                2839
function.sodium-hex2bin.php                        27-Sep-2020 11:03                2946
function.sodium-increment.php                      27-Sep-2020 11:03                2332
function.sodium-memcmp.php                         27-Sep-2020 11:03                2509
function.sodium-memzero.php                        27-Sep-2020 11:03                2308
function.sodium-pad.php                            27-Sep-2020 11:03                2468
function.sodium-unpad.php                          27-Sep-2020 11:03                2476
function.solr-get-version.php                      27-Sep-2020 11:03                3775
function.sort.php                                  27-Sep-2020 11:03               11201
function.soundex.php                               27-Sep-2020 11:03                6723
function.spl-autoload-call.php                     27-Sep-2020 11:03                2443
function.spl-autoload-extensions.php               27-Sep-2020 11:03                3976
function.spl-autoload-functions.php                27-Sep-2020 11:03                2432
function.spl-autoload-register.php                 27-Sep-2020 11:03                9751
function.spl-autoload-unregister.php               27-Sep-2020 11:03                2823
function.spl-autoload.php                          27-Sep-2020 11:03                3600
function.spl-classes.php                           27-Sep-2020 11:03                3667
function.spl-object-hash.php                       27-Sep-2020 11:03                3871
function.spl-object-id.php                         27-Sep-2020 11:03                3943
function.split.php                                 27-Sep-2020 11:03               11011
function.spliti.php                                27-Sep-2020 11:03                7834
function.sprintf.php                               27-Sep-2020 11:03               24384
function.sql-regcase.php                           27-Sep-2020 11:03                4293
function.sqlite-array-query.php                    27-Sep-2020 11:03               12567
function.sqlite-busy-timeout.php                   27-Sep-2020 11:03                7137
function.sqlite-changes.php                        27-Sep-2020 11:03                6897
function.sqlite-close.php                          27-Sep-2020 11:03                4133
function.sqlite-column.php                         27-Sep-2020 11:03                6079
function.sqlite-create-aggregate.php               27-Sep-2020 11:03               14968
function.sqlite-create-function.php                27-Sep-2020 11:03               12144
function.sqlite-current.php                        27-Sep-2020 11:03                6783
function.sqlite-error-string.php                   27-Sep-2020 11:03                3245
function.sqlite-escape-string.php                  27-Sep-2020 11:03                5185
function.sqlite-exec.php                           27-Sep-2020 11:03               10919
function.sqlite-fetch-all.php                      27-Sep-2020 11:03               11950
function.sqlite-fetch-array.php                    27-Sep-2020 11:03               11184
function.sqlite-fetch-single.php                   27-Sep-2020 11:03                7617
function.sqlite-fetch-string.php                   27-Sep-2020 11:03                1714
function.sqlite-field-name.php                     27-Sep-2020 11:03                4152
function.sqlite-has-more.php                       27-Sep-2020 11:03                3115
function.sqlite-last-error.php                     27-Sep-2020 11:03                3761
function.sqlite-last-insert-rowid.php              27-Sep-2020 11:03                3443
function.sqlite-libencoding.php                    27-Sep-2020 11:03                3964
function.sqlite-libversion.php                     27-Sep-2020 11:03                2340
function.sqlite-next.php                           27-Sep-2020 11:03                3991
function.sqlite-num-fields.php                     27-Sep-2020 11:03                3784
function.sqlite-num-rows.php                       27-Sep-2020 11:03                6898
function.sqlite-open.php                           27-Sep-2020 11:03                9430
function.sqlite-popen.php                          27-Sep-2020 11:03                5889
function.sqlite-query.php                          27-Sep-2020 11:03                9480
function.sqlite-rewind.php                         27-Sep-2020 11:03                3826
function.sqlite-seek.php                           27-Sep-2020 11:03                4394
function.sqlite-single-query.php                   27-Sep-2020 11:03                3038
function.sqlite-udf-decode-binary.php              27-Sep-2020 11:03                9727
function.sqlite-udf-encode-binary.php              27-Sep-2020 11:03                4827
function.sqlite-unbuffered-query.php               27-Sep-2020 11:03                8737
function.sqlsrv-begin-transaction.php              27-Sep-2020 11:03               11934
function.sqlsrv-cancel.php                         27-Sep-2020 11:03               10624
function.sqlsrv-client-info.php                    27-Sep-2020 11:03                6835
function.sqlsrv-close.php                          27-Sep-2020 11:03                5445
function.sqlsrv-commit.php                         27-Sep-2020 11:03               11789
function.sqlsrv-configure.php                      27-Sep-2020 11:03                4340
function.sqlsrv-connect.php                        27-Sep-2020 11:03               12602
function.sqlsrv-errors.php                         27-Sep-2020 11:03               10517
function.sqlsrv-execute.php                        27-Sep-2020 11:03               10741
function.sqlsrv-fetch-array.php                    27-Sep-2020 11:03               14926
function.sqlsrv-fetch-object.php                   27-Sep-2020 11:03               12074
function.sqlsrv-fetch.php                          27-Sep-2020 11:03               11012
function.sqlsrv-field-metadata.php                 27-Sep-2020 11:03                8902
function.sqlsrv-free-stmt.php                      27-Sep-2020 11:03                7646
function.sqlsrv-get-config.php                     27-Sep-2020 11:03                3145
function.sqlsrv-get-field.php                      27-Sep-2020 11:03               10561
function.sqlsrv-has-rows.php                       27-Sep-2020 11:03                6368
function.sqlsrv-next-result.php                    27-Sep-2020 11:03                9514
function.sqlsrv-num-fields.php                     27-Sep-2020 11:03                8468
function.sqlsrv-num-rows.php                       27-Sep-2020 11:03                7985
function.sqlsrv-prepare.php                        27-Sep-2020 11:03               14667
function.sqlsrv-query.php                          27-Sep-2020 11:03               11407
function.sqlsrv-rollback.php                       27-Sep-2020 11:03               11257
function.sqlsrv-rows-affected.php                  27-Sep-2020 11:03                8026
function.sqlsrv-send-stream-data.php               27-Sep-2020 11:03                8866
function.sqlsrv-server-info.php                    27-Sep-2020 11:03                6220
function.sqrt.php                                  27-Sep-2020 11:03                3700
function.srand.php                                 27-Sep-2020 11:03                6264
function.sscanf.php                                27-Sep-2020 11:03               11551
function.ssdeep-fuzzy-compare.php                  27-Sep-2020 11:03                2938
function.ssdeep-fuzzy-hash-filename.php            27-Sep-2020 11:03                2704
function.ssdeep-fuzzy-hash.php                     27-Sep-2020 11:03                2555
function.ssh2-auth-agent.php                       27-Sep-2020 11:03                4451
function.ssh2-auth-hostbased-file.php              27-Sep-2020 11:03                7374
function.ssh2-auth-none.php                        27-Sep-2020 11:03                4706
function.ssh2-auth-password.php                    27-Sep-2020 11:03                4663
function.ssh2-auth-pubkey-file.php                 27-Sep-2020 11:03                6881
function.ssh2-connect.php                          27-Sep-2020 11:03               15484
function.ssh2-disconnect.php                       27-Sep-2020 11:03                2768
function.ssh2-exec.php                             27-Sep-2020 11:03                6635
function.ssh2-fetch-stream.php                     27-Sep-2020 11:03                5298
function.ssh2-fingerprint.php                      27-Sep-2020 11:03                5223
function.ssh2-methods-negotiated.php               27-Sep-2020 11:03                8049
function.ssh2-publickey-add.php                    27-Sep-2020 11:03                7816
function.ssh2-publickey-init.php                   27-Sep-2020 11:03                4261
function.ssh2-publickey-list.php                   27-Sep-2020 11:03                8786
function.ssh2-publickey-remove.php                 27-Sep-2020 11:03                4313
function.ssh2-scp-recv.php                         27-Sep-2020 11:03                5096
function.ssh2-scp-send.php                         27-Sep-2020 11:03                5555
function.ssh2-sftp-chmod.php                       27-Sep-2020 11:03                5631
function.ssh2-sftp-lstat.php                       27-Sep-2020 11:03                7202
function.ssh2-sftp-mkdir.php                       27-Sep-2020 11:03                6188
function.ssh2-sftp-readlink.php                    27-Sep-2020 11:03                5178
function.ssh2-sftp-realpath.php                    27-Sep-2020 11:03                5412
function.ssh2-sftp-rename.php                      27-Sep-2020 11:03                5188
function.ssh2-sftp-rmdir.php                       27-Sep-2020 11:03                5263
function.ssh2-sftp-stat.php                        27-Sep-2020 11:03                7101
function.ssh2-sftp-symlink.php                     27-Sep-2020 11:03                5400
function.ssh2-sftp-unlink.php                      27-Sep-2020 11:03                4704
function.ssh2-sftp.php                             27-Sep-2020 11:03                5180
function.ssh2-shell.php                            27-Sep-2020 11:03                6892
function.ssh2-tunnel.php                           27-Sep-2020 11:03                5091
function.stat.php                                  27-Sep-2020 11:03               15794
function.stomp-connect-error.php                   27-Sep-2020 11:03                3548
function.stomp-version.php                         27-Sep-2020 11:03                2978
function.str-getcsv.php                            27-Sep-2020 11:03                5672
function.str-ireplace.php                          27-Sep-2020 11:03                8145
function.str-pad.php                               27-Sep-2020 11:03                7628
function.str-repeat.php                            27-Sep-2020 11:03                4480
function.str-replace.php                           27-Sep-2020 11:03               17401
function.str-rot13.php                             27-Sep-2020 11:03                3417
function.str-shuffle.php                           27-Sep-2020 11:03                5355
function.str-split.php                             27-Sep-2020 11:03                6733
function.str-word-count.php                        27-Sep-2020 11:03                8380
function.strcasecmp.php                            27-Sep-2020 11:03                5408
function.strchr.php                                27-Sep-2020 11:03                1526
function.strcmp.php                                27-Sep-2020 11:03                5340
function.strcoll.php                               27-Sep-2020 11:03                4875
function.strcspn.php                               27-Sep-2020 11:03               10443
function.stream-bucket-append.php                  27-Sep-2020 11:03                2010
function.stream-bucket-make-writeable.php          27-Sep-2020 11:03                1960
function.stream-bucket-new.php                     27-Sep-2020 11:03                2009
function.stream-bucket-prepend.php                 27-Sep-2020 11:03                6510
function.stream-context-create.php                 27-Sep-2020 11:03                6603
function.stream-context-get-default.php            27-Sep-2020 11:03                8584
function.stream-context-get-options.php            27-Sep-2020 11:03                4327
function.stream-context-get-params.php             27-Sep-2020 11:03                5354
function.stream-context-set-default.php            27-Sep-2020 11:03                6317
function.stream-context-set-option.php             27-Sep-2020 11:03                4197
function.stream-context-set-params.php             27-Sep-2020 11:03                4443
function.stream-copy-to-stream.php                 27-Sep-2020 11:03                6458
function.stream-filter-append.php                  27-Sep-2020 11:03               10580
function.stream-filter-prepend.php                 27-Sep-2020 11:03                7344
function.stream-filter-register.php                27-Sep-2020 11:03               19623
function.stream-filter-remove.php                  27-Sep-2020 11:03                6443
function.stream-get-contents.php                   27-Sep-2020 11:03                7669
function.stream-get-filters.php                    27-Sep-2020 11:03                3735
function.stream-get-line.php                       27-Sep-2020 11:03                4349
function.stream-get-meta-data.php                  27-Sep-2020 11:03                9862
function.stream-get-transports.php                 27-Sep-2020 11:03                3715
function.stream-get-wrappers.php                   27-Sep-2020 11:03                4618
function.stream-is-local.php                       27-Sep-2020 11:03                3902
function.stream-isatty.php                         27-Sep-2020 11:03                3689
function.stream-notification-callback.php          27-Sep-2020 11:03               24970
function.stream-register-wrapper.php               27-Sep-2020 11:03                1775
function.stream-resolve-include-path.php           27-Sep-2020 11:03                3937
function.stream-select.php                         27-Sep-2020 11:03               14541
function.stream-set-blocking.php                   27-Sep-2020 11:03                4705
function.stream-set-chunk-size.php                 27-Sep-2020 11:03                3100
function.stream-set-read-buffer.php                27-Sep-2020 11:03                3466
function.stream-set-timeout.php                    27-Sep-2020 11:03                8005
function.stream-set-write-buffer.php               27-Sep-2020 11:03                5728
function.stream-socket-accept.php                  27-Sep-2020 11:03                6311
function.stream-socket-client.php                  27-Sep-2020 11:03               15760
function.stream-socket-enable-crypto.php           27-Sep-2020 11:03               11352
function.stream-socket-get-name.php                27-Sep-2020 11:03                3291
function.stream-socket-pair.php                    27-Sep-2020 11:03                8966
function.stream-socket-recvfrom.php                27-Sep-2020 11:03               10225
function.stream-socket-sendto.php                  27-Sep-2020 11:03                6910
function.stream-socket-server.php                  27-Sep-2020 11:03               14021
function.stream-socket-shutdown.php                27-Sep-2020 11:03                6082
function.stream-supports-lock.php                  27-Sep-2020 11:03                2886
function.stream-wrapper-register.php               27-Sep-2020 11:03                8948
function.stream-wrapper-restore.php                27-Sep-2020 11:03                2575
function.stream-wrapper-unregister.php             27-Sep-2020 11:03                2773
function.strftime.php                              27-Sep-2020 11:03               58674
function.strip-tags.php                            27-Sep-2020 11:03                8958
function.stripcslashes.php                         27-Sep-2020 11:03                2824
function.stripos.php                               27-Sep-2020 11:03               10693
function.stripslashes.php                          27-Sep-2020 11:03                7863
function.stristr.php                               27-Sep-2020 11:03                9637
function.strlen.php                                27-Sep-2020 11:03                5313
function.strnatcasecmp.php                         27-Sep-2020 11:03                5032
function.strnatcmp.php                             27-Sep-2020 11:03                8057
function.strncasecmp.php                           27-Sep-2020 11:03                4519
function.strncmp.php                               27-Sep-2020 11:03                4530
function.strpbrk.php                               27-Sep-2020 11:03                5069
function.strpos.php                                27-Sep-2020 11:03               13372
function.strptime.php                              27-Sep-2020 11:03               10461
function.strrchr.php                               27-Sep-2020 11:03                6862
function.strrev.php                                27-Sep-2020 11:03                2997
function.strripos.php                              27-Sep-2020 11:03                9861
function.strrpos.php                               27-Sep-2020 11:03               13028
function.strspn.php                                27-Sep-2020 11:03                9823
function.strstr.php                                27-Sep-2020 11:03                8107
function.strtok.php                                27-Sep-2020 11:03                8294
function.strtolower.php                            27-Sep-2020 11:03                4866
function.strtotime.php                             27-Sep-2020 11:03               12752
function.strtoupper.php                            27-Sep-2020 11:03                4856
function.strtr.php                                 27-Sep-2020 11:03               11521
function.strval.php                                27-Sep-2020 11:03                6333
function.substr-compare.php                        27-Sep-2020 11:03                9875
function.substr-count.php                          27-Sep-2020 11:03                9146
function.substr-replace.php                        27-Sep-2020 11:03               15740
function.substr.php                                27-Sep-2020 11:03               21608
function.svn-add.php                               27-Sep-2020 11:03                5833
function.svn-auth-get-parameter.php                27-Sep-2020 11:03                3737
function.svn-auth-set-parameter.php                27-Sep-2020 11:03                5235
function.svn-blame.php                             27-Sep-2020 11:03                4777
function.svn-cat.php                               27-Sep-2020 11:03                4560
function.svn-checkout.php                          27-Sep-2020 11:03                6910
function.svn-cleanup.php                           27-Sep-2020 11:03                4919
function.svn-client-version.php                    27-Sep-2020 11:03                3176
function.svn-commit.php                            27-Sep-2020 11:03                7658
function.svn-delete.php                            27-Sep-2020 11:03                4246
function.svn-diff.php                              27-Sep-2020 11:03               13137
function.svn-export.php                            27-Sep-2020 11:03                4738
function.svn-fs-abort-txn.php                      27-Sep-2020 11:03                2411
function.svn-fs-apply-text.php                     27-Sep-2020 11:03                2514
function.svn-fs-begin-txn2.php                     27-Sep-2020 11:03                2459
function.svn-fs-change-node-prop.php               27-Sep-2020 11:03                2759
function.svn-fs-check-path.php                     27-Sep-2020 11:03                2565
function.svn-fs-contents-changed.php               27-Sep-2020 11:03                2760
function.svn-fs-copy.php                           27-Sep-2020 11:03                2732
function.svn-fs-delete.php                         27-Sep-2020 11:03                2500
function.svn-fs-dir-entries.php                    27-Sep-2020 11:03                2577
function.svn-fs-file-contents.php                  27-Sep-2020 11:03                2592
function.svn-fs-file-length.php                    27-Sep-2020 11:03                2523
function.svn-fs-is-dir.php                         27-Sep-2020 11:03                2486
function.svn-fs-is-file.php                        27-Sep-2020 11:03                2476
function.svn-fs-make-dir.php                       27-Sep-2020 11:03                2520
function.svn-fs-make-file.php                      27-Sep-2020 11:03                2534
function.svn-fs-node-created-rev.php               27-Sep-2020 11:03                2561
function.svn-fs-node-prop.php                      27-Sep-2020 11:03                2608
function.svn-fs-props-changed.php                  27-Sep-2020 11:03                2750
function.svn-fs-revision-prop.php                  27-Sep-2020 11:03                2619
function.svn-fs-revision-root.php                  27-Sep-2020 11:03                2539
function.svn-fs-txn-root.php                       27-Sep-2020 11:03                2363
function.svn-fs-youngest-rev.php                   27-Sep-2020 11:03                2407
function.svn-import.php                            27-Sep-2020 11:03                5665
function.svn-log.php                               27-Sep-2020 11:03                8454
function.svn-ls.php                                27-Sep-2020 11:03                6819
function.svn-mkdir.php                             27-Sep-2020 11:03                2885
function.svn-repos-create.php                      27-Sep-2020 11:03                2608
function.svn-repos-fs-begin-txn-for-commit.php     27-Sep-2020 11:03                2806
function.svn-repos-fs-commit-txn.php               27-Sep-2020 11:03                2458
function.svn-repos-fs.php                          27-Sep-2020 11:03                2363
function.svn-repos-hotcopy.php                     27-Sep-2020 11:03                2625
function.svn-repos-open.php                        27-Sep-2020 11:03                2337
function.svn-repos-recover.php                     27-Sep-2020 11:03                2383
function.svn-revert.php                            27-Sep-2020 11:03                3211
function.svn-status.php                            27-Sep-2020 11:03               14450
function.svn-update.php                            27-Sep-2020 11:03                5805
function.swoole-async-dns-lookup.php               27-Sep-2020 11:03                3461
function.swoole-async-read.php                     27-Sep-2020 11:03                3982
function.swoole-async-readfile.php                 27-Sep-2020 11:03                3487
function.swoole-async-set.php                      27-Sep-2020 11:03                2038
function.swoole-async-write.php                    27-Sep-2020 11:03                3148
function.swoole-async-writefile.php                27-Sep-2020 11:03                3209
function.swoole-client-select.php                  27-Sep-2020 11:03                3027
function.swoole-cpu-num.php                        27-Sep-2020 11:03                1998
function.swoole-errno.php                          27-Sep-2020 11:03                1981
function.swoole-event-add.php                      27-Sep-2020 11:03                3064
function.swoole-event-defer.php                    27-Sep-2020 11:03                2364
function.swoole-event-del.php                      27-Sep-2020 11:03                2274
function.swoole-event-exit.php                     27-Sep-2020 11:03                2071
function.swoole-event-set.php                      27-Sep-2020 11:03                3063
function.swoole-event-wait.php                     27-Sep-2020 11:03                2042
function.swoole-event-write.php                    27-Sep-2020 11:03                2496
function.swoole-get-local-ip.php                   27-Sep-2020 11:03                2064
function.swoole-last-error.php                     27-Sep-2020 11:03                2025
function.swoole-load-module.php                    27-Sep-2020 11:03                2165
function.swoole-select.php                         27-Sep-2020 11:03                2956
function.swoole-set-process-name.php               27-Sep-2020 11:03                2392
function.swoole-strerror.php                       27-Sep-2020 11:03                2321
function.swoole-timer-after.php                    27-Sep-2020 11:03                2799
function.swoole-timer-exists.php                   27-Sep-2020 11:03                2207
function.swoole-timer-tick.php                     27-Sep-2020 11:03                2673
function.swoole-version.php                        27-Sep-2020 11:03                2001
function.symlink.php                               27-Sep-2020 11:03                4999
function.sys-get-temp-dir.php                      27-Sep-2020 11:02                3890
function.sys-getloadavg.php                        27-Sep-2020 11:03                3743
function.syslog.php                                27-Sep-2020 11:03                9015
function.system.php                                27-Sep-2020 11:03                8294
function.taint.php                                 27-Sep-2020 11:03                2403
function.tan.php                                   27-Sep-2020 11:03                4152
function.tanh.php                                  27-Sep-2020 11:03                3007
function.tcpwrap-check.php                         27-Sep-2020 11:03                5150
function.tempnam.php                               27-Sep-2020 11:03                6195
function.textdomain.php                            27-Sep-2020 11:03                2614
function.tidy-access-count.php                     27-Sep-2020 11:03                6402
function.tidy-config-count.php                     27-Sep-2020 11:03                4231
function.tidy-error-count.php                      27-Sep-2020 11:03                5188
function.tidy-get-output.php                       27-Sep-2020 11:03                4088
function.tidy-warning-count.php                    27-Sep-2020 11:03                4789
function.time-nanosleep.php                        27-Sep-2020 11:03                8741
function.time-sleep-until.php                      27-Sep-2020 11:03                5501
function.time.php                                  27-Sep-2020 11:03                5602
function.timezone-abbreviations-list.php           27-Sep-2020 11:03                1768
function.timezone-identifiers-list.php             27-Sep-2020 11:03                1786
function.timezone-location-get.php                 27-Sep-2020 11:03                1746
function.timezone-name-from-abbr.php               27-Sep-2020 11:03                5762
function.timezone-name-get.php                     27-Sep-2020 11:03                1694
function.timezone-offset-get.php                   27-Sep-2020 11:03                1690
function.timezone-open.php                         27-Sep-2020 11:03                1684
function.timezone-transitions-get.php              27-Sep-2020 11:03                1746
function.timezone-version-get.php                  27-Sep-2020 11:03                3160
function.tmpfile.php                               27-Sep-2020 11:03                4989
function.token-get-all.php                         27-Sep-2020 11:03               11744
function.token-name.php                            27-Sep-2020 11:03                3971
function.touch.php                                 27-Sep-2020 11:03                6963
function.trader-acos.php                           27-Sep-2020 11:03                2259
function.trader-ad.php                             27-Sep-2020 11:03                2912
function.trader-add.php                            27-Sep-2020 11:03                2541
function.trader-adosc.php                          27-Sep-2020 11:03                3545
function.trader-adx.php                            27-Sep-2020 11:03                2962
function.trader-adxr.php                           27-Sep-2020 11:03                2972
function.trader-apo.php                            27-Sep-2020 11:03                3092
function.trader-aroon.php                          27-Sep-2020 11:03                2691
function.trader-aroonosc.php                       27-Sep-2020 11:03                2725
function.trader-asin.php                           27-Sep-2020 11:03                2274
function.trader-atan.php                           27-Sep-2020 11:03                2267
function.trader-atr.php                            27-Sep-2020 11:03                2952
function.trader-avgprice.php                       27-Sep-2020 11:03                2963
function.trader-bbands.php                         27-Sep-2020 11:03                3736
function.trader-beta.php                           27-Sep-2020 11:03                2660
function.trader-bop.php                            27-Sep-2020 11:03                2917
function.trader-cci.php                            27-Sep-2020 11:03                2957
function.trader-cdl2crows.php                      27-Sep-2020 11:03                2984
function.trader-cdl3blackcrows.php                 27-Sep-2020 11:03                3041
function.trader-cdl3inside.php                     27-Sep-2020 11:03                3026
function.trader-cdl3linestrike.php                 27-Sep-2020 11:03                3045
function.trader-cdl3outside.php                    27-Sep-2020 11:03                3040
function.trader-cdl3starsinsouth.php               27-Sep-2020 11:03                3084
function.trader-cdl3whitesoldiers.php              27-Sep-2020 11:03                3107
function.trader-cdlabandonedbaby.php               27-Sep-2020 11:03                3384
function.trader-cdladvanceblock.php                27-Sep-2020 11:03                3062
function.trader-cdlbelthold.php                    27-Sep-2020 11:03                3022
function.trader-cdlbreakaway.php                   27-Sep-2020 11:03                3035
function.trader-cdlclosingmarubozu.php             27-Sep-2020 11:03                3100
function.trader-cdlconcealbabyswall.php            27-Sep-2020 11:03                3122
function.trader-cdlcounterattack.php               27-Sep-2020 11:03                3089
function.trader-cdldarkcloudcover.php              27-Sep-2020 11:03                3377
function.trader-cdldoji.php                        27-Sep-2020 11:03                2983
function.trader-cdldojistar.php                    27-Sep-2020 11:03                3014
function.trader-cdldragonflydoji.php               27-Sep-2020 11:03                3064
function.trader-cdlengulfing.php                   27-Sep-2020 11:03                3053
function.trader-cdleveningdojistar.php             27-Sep-2020 11:03                3393
function.trader-cdleveningstar.php                 27-Sep-2020 11:03                3374
function.trader-cdlgapsidesidewhite.php            27-Sep-2020 11:03                3129
function.trader-cdlgravestonedoji.php              27-Sep-2020 11:03                3084
function.trader-cdlhammer.php                      27-Sep-2020 11:03                3007
function.trader-cdlhangingman.php                  27-Sep-2020 11:03                3024
function.trader-cdlharami.php                      27-Sep-2020 11:03                3009
function.trader-cdlharamicross.php                 27-Sep-2020 11:03                3046
function.trader-cdlhighwave.php                    27-Sep-2020 11:03                3023
function.trader-cdlhikkake.php                     27-Sep-2020 11:03                3013
function.trader-cdlhikkakemod.php                  27-Sep-2020 11:03                3051
function.trader-cdlhomingpigeon.php                27-Sep-2020 11:03                3070
function.trader-cdlidentical3crows.php             27-Sep-2020 11:03                3091
function.trader-cdlinneck.php                      27-Sep-2020 11:03                3026
function.trader-cdlinvertedhammer.php              27-Sep-2020 11:03                3066
function.trader-cdlkicking.php                     27-Sep-2020 11:03                3027
function.trader-cdlkickingbylength.php             27-Sep-2020 11:03                3125
function.trader-cdlladderbottom.php                27-Sep-2020 11:03                3078
function.trader-cdllongleggeddoji.php              27-Sep-2020 11:03                3081
function.trader-cdllongline.php                    27-Sep-2020 11:03                3031
function.trader-cdlmarubozu.php                    27-Sep-2020 11:03                3017
function.trader-cdlmatchinglow.php                 27-Sep-2020 11:03                3040
function.trader-cdlmathold.php                     27-Sep-2020 11:03                3324
function.trader-cdlmorningdojistar.php             27-Sep-2020 11:03                3389
function.trader-cdlmorningstar.php                 27-Sep-2020 11:03                3354
function.trader-cdlonneck.php                      27-Sep-2020 11:03                3006
function.trader-cdlpiercing.php                    27-Sep-2020 11:03                3021
function.trader-cdlrickshawman.php                 27-Sep-2020 11:03                3058
function.trader-cdlrisefall3methods.php            27-Sep-2020 11:03                3123
function.trader-cdlseparatinglines.php             27-Sep-2020 11:03                3106
function.trader-cdlshootingstar.php                27-Sep-2020 11:03                3068
function.trader-cdlshortline.php                   27-Sep-2020 11:03                3043
function.trader-cdlspinningtop.php                 27-Sep-2020 11:03                3056
function.trader-cdlstalledpattern.php              27-Sep-2020 11:03                3088
function.trader-cdlsticksandwich.php               27-Sep-2020 11:03                3070
function.trader-cdltakuri.php                      27-Sep-2020 11:03                3048
function.trader-cdltasukigap.php                   27-Sep-2020 11:03                3020
function.trader-cdlthrusting.php                   27-Sep-2020 11:03                3029
function.trader-cdltristar.php                     27-Sep-2020 11:03                3019
function.trader-cdlunique3river.php                27-Sep-2020 11:03                3065
function.trader-cdlupsidegap2crows.php             27-Sep-2020 11:03                3110
function.trader-cdlxsidegap3methods.php            27-Sep-2020 11:03                3108
function.trader-ceil.php                           27-Sep-2020 11:03                2291
function.trader-cmo.php                            27-Sep-2020 11:03                2424
function.trader-correl.php                         27-Sep-2020 11:03                2710
function.trader-cos.php                            27-Sep-2020 11:03                2258
function.trader-cosh.php                           27-Sep-2020 11:03                2273
function.trader-dema.php                           27-Sep-2020 11:03                2434
function.trader-div.php                            27-Sep-2020 11:03                2557
function.trader-dx.php                             27-Sep-2020 11:03                2939
function.trader-ema.php                            27-Sep-2020 11:03                2418
function.trader-errno.php                          27-Sep-2020 11:03                1887
function.trader-exp.php                            27-Sep-2020 11:03                2302
function.trader-floor.php                          27-Sep-2020 11:03                2282
function.trader-get-compat.php                     27-Sep-2020 11:03                2067
function.trader-get-unstable-period.php            27-Sep-2020 11:03                2490
function.trader-ht-dcperiod.php                    27-Sep-2020 11:03                2264
function.trader-ht-dcphase.php                     27-Sep-2020 11:03                2236
function.trader-ht-phasor.php                      27-Sep-2020 11:03                2218
function.trader-ht-sine.php                        27-Sep-2020 11:03                2199
function.trader-ht-trendline.php                   27-Sep-2020 11:03                2255
function.trader-ht-trendmode.php                   27-Sep-2020 11:03                2245
function.trader-kama.php                           27-Sep-2020 11:03                2472
function.trader-linearreg-angle.php                27-Sep-2020 11:03                2555
function.trader-linearreg-intercept.php            27-Sep-2020 11:03                2609
function.trader-linearreg-slope.php                27-Sep-2020 11:03                2565
function.trader-linearreg.php                      27-Sep-2020 11:03                2483
function.trader-ln.php                             27-Sep-2020 11:03                2261
function.trader-log10.php                          27-Sep-2020 11:03                2262
function.trader-ma.php                             27-Sep-2020 11:03                2755
function.trader-macd.php                           27-Sep-2020 11:03                3076
function.trader-macdext.php                        27-Sep-2020 11:03                4230
function.trader-macdfix.php                        27-Sep-2020 11:03                2515
function.trader-mama.php                           27-Sep-2020 11:03                2774
function.trader-mavp.php                           27-Sep-2020 11:03                3406
function.trader-max.php                            27-Sep-2020 11:03                2439
function.trader-maxindex.php                       27-Sep-2020 11:03                2491
function.trader-medprice.php                       27-Sep-2020 11:03                2440
function.trader-mfi.php                            27-Sep-2020 11:03                3224
function.trader-midpoint.php                       27-Sep-2020 11:03                2465
function.trader-midprice.php                       27-Sep-2020 11:03                2739
function.trader-min.php                            27-Sep-2020 11:03                2446
function.trader-minindex.php                       27-Sep-2020 11:03                2486
function.trader-minmax.php                         27-Sep-2020 11:03                2492
function.trader-minmaxindex.php                    27-Sep-2020 11:03                2538
function.trader-minus-di.php                       27-Sep-2020 11:03                3020
function.trader-minus-dm.php                       27-Sep-2020 11:03                2739
function.trader-mom.php                            27-Sep-2020 11:03                2410
function.trader-mult.php                           27-Sep-2020 11:03                2556
function.trader-natr.php                           27-Sep-2020 11:03                2962
function.trader-obv.php                            27-Sep-2020 11:03                2398
function.trader-plus-di.php                        27-Sep-2020 11:03                2992
function.trader-plus-dm.php                        27-Sep-2020 11:03                2727
function.trader-ppo.php                            27-Sep-2020 11:03                3096
function.trader-roc.php                            27-Sep-2020 11:03                2434
function.trader-rocp.php                           27-Sep-2020 11:03                2461
function.trader-rocr.php                           27-Sep-2020 11:03                2446
function.trader-rocr100.php                        27-Sep-2020 11:03                2483
function.trader-rsi.php                            27-Sep-2020 11:03                2415
function.trader-sar.php                            27-Sep-2020 11:03                3177
function.trader-sarext.php                         27-Sep-2020 11:03                5914
function.trader-set-compat.php                     27-Sep-2020 11:03                2436
function.trader-set-unstable-period.php            27-Sep-2020 11:03                2965
function.trader-sin.php                            27-Sep-2020 11:03                2282
function.trader-sinh.php                           27-Sep-2020 11:03                2269
function.trader-sma.php                            27-Sep-2020 11:03                2415
function.trader-sqrt.php                           27-Sep-2020 11:03                2262
function.trader-stddev.php                         27-Sep-2020 11:03                2671
function.trader-stoch.php                          27-Sep-2020 11:03                4380
function.trader-stochf.php                         27-Sep-2020 11:03                3710
function.trader-stochrsi.php                       27-Sep-2020 11:03                3492
function.trader-sub.php                            27-Sep-2020 11:03                2562
function.trader-sum.php                            27-Sep-2020 11:03                2397
function.trader-t3.php                             27-Sep-2020 11:03                2692
function.trader-tan.php                            27-Sep-2020 11:03                2251
function.trader-tanh.php                           27-Sep-2020 11:03                2274
function.trader-tema.php                           27-Sep-2020 11:03                2440
function.trader-trange.php                         27-Sep-2020 11:03                2680
function.trader-trima.php                          27-Sep-2020 11:03                2441
function.trader-trix.php                           27-Sep-2020 11:03                2452
function.trader-tsf.php                            27-Sep-2020 11:03                2422
function.trader-typprice.php                       27-Sep-2020 11:03                2701
function.trader-ultosc.php                         27-Sep-2020 11:03                3593
function.trader-var.php                            27-Sep-2020 11:03                2644
function.trader-wclprice.php                       27-Sep-2020 11:03                2706
function.trader-willr.php                          27-Sep-2020 11:03                2967
function.trader-wma.php                            27-Sep-2020 11:03                2429
function.trait-exists.php                          27-Sep-2020 11:03                2565
function.trigger-error.php                         27-Sep-2020 11:02                6087
function.trim.php                                  27-Sep-2020 11:03               13736
function.uasort.php                                27-Sep-2020 11:03                8169
function.ucfirst.php                               27-Sep-2020 11:03                5410
function.ucwords.php                               27-Sep-2020 11:03                9468
function.ui-draw-text-font-fontfamilies.php        27-Sep-2020 11:03                1933
function.ui-quit.php                               27-Sep-2020 11:03                1956
function.ui-run.php                                27-Sep-2020 11:03                2216
function.uksort.php                                27-Sep-2020 11:03                8165
function.umask.php                                 27-Sep-2020 11:03                4753
function.uniqid.php                                27-Sep-2020 11:03                7348
function.unixtojd.php                              27-Sep-2020 11:03                2796
function.unlink.php                                27-Sep-2020 11:03                5271
function.unpack.php                                27-Sep-2020 11:03               10153
function.unregister-tick-function.php              27-Sep-2020 11:03                3024
function.unserialize.php                           27-Sep-2020 11:03               16489
function.unset.php                                 27-Sep-2020 11:03               15066
function.untaint.php                               27-Sep-2020 11:03                2257
function.uopz-add-function.php                     27-Sep-2020 11:02                6263
function.uopz-allow-exit.php                       27-Sep-2020 11:02                4413
function.uopz-backup.php                           27-Sep-2020 11:02                4291
function.uopz-compose.php                          27-Sep-2020 11:02                6539
function.uopz-copy.php                             27-Sep-2020 11:02                5005
function.uopz-del-function.php                     27-Sep-2020 11:02                5959
function.uopz-delete.php                           27-Sep-2020 11:02                5788
function.uopz-extend.php                           27-Sep-2020 11:02                4588
function.uopz-flags.php                            27-Sep-2020 11:02               10589
function.uopz-function.php                         27-Sep-2020 11:02                6807
function.uopz-get-exit-status.php                  27-Sep-2020 11:02                4049
function.uopz-get-hook.php                         27-Sep-2020 11:02                5072
function.uopz-get-mock.php                         27-Sep-2020 11:02                5011
function.uopz-get-property.php                     27-Sep-2020 11:02                5981
function.uopz-get-return.php                       27-Sep-2020 11:02                4196
function.uopz-get-static.php                       27-Sep-2020 11:02                4744
function.uopz-implement.php                        27-Sep-2020 11:02                4610
function.uopz-overload.php                         27-Sep-2020 11:02                3779
function.uopz-redefine.php                         27-Sep-2020 11:02                4679
function.uopz-rename.php                           27-Sep-2020 11:02                6464
function.uopz-restore.php                          27-Sep-2020 11:02                4660
function.uopz-set-hook.php                         27-Sep-2020 11:02                5223
function.uopz-set-mock.php                         27-Sep-2020 11:02               12237
function.uopz-set-property.php                     27-Sep-2020 11:02                7433
function.uopz-set-return.php                       27-Sep-2020 11:02                9151
function.uopz-set-static.php                       27-Sep-2020 11:02                5407
function.uopz-undefine.php                         27-Sep-2020 11:02                4171
function.uopz-unset-hook.php                       27-Sep-2020 11:02                5105
function.uopz-unset-mock.php                       27-Sep-2020 11:02                5124
function.uopz-unset-return.php                     27-Sep-2020 11:02                4526
function.urldecode.php                             27-Sep-2020 11:03                6303
function.urlencode.php                             27-Sep-2020 11:03                7843
function.use-soap-error-handler.php                27-Sep-2020 11:03                3473
function.user-error.php                            27-Sep-2020 11:02                1578
function.usleep.php                                27-Sep-2020 11:03                5133
function.usort.php                                 27-Sep-2020 11:03               21898
function.utf8-decode.php                           27-Sep-2020 11:03                5466
function.utf8-encode.php                           27-Sep-2020 11:03                5151
function.var-dump.php                              27-Sep-2020 11:03                6742
function.var-export.php                            27-Sep-2020 11:03               17398
function.variant-abs.php                           27-Sep-2020 11:03                4016
function.variant-add.php                           27-Sep-2020 11:03                5380
function.variant-and.php                           27-Sep-2020 11:03                6084
function.variant-cast.php                          27-Sep-2020 11:03                3384
function.variant-cat.php                           27-Sep-2020 11:03                4596
function.variant-cmp.php                           27-Sep-2020 11:03                6825
function.variant-date-from-timestamp.php           27-Sep-2020 11:03                3408
function.variant-date-to-timestamp.php             27-Sep-2020 11:03                3374
function.variant-div.php                           27-Sep-2020 11:03                6114
function.variant-eqv.php                           27-Sep-2020 11:03                4205
function.variant-fix.php                           27-Sep-2020 11:03                5402
function.variant-get-type.php                      27-Sep-2020 11:03                3309
function.variant-idiv.php                          27-Sep-2020 11:03                5567
function.variant-imp.php                           27-Sep-2020 11:03                5625
function.variant-int.php                           27-Sep-2020 11:03                4900
function.variant-mod.php                           27-Sep-2020 11:03                4675
function.variant-mul.php                           27-Sep-2020 11:03                5684
function.variant-neg.php                           27-Sep-2020 11:03                3686
function.variant-not.php                           27-Sep-2020 11:03                3852
function.variant-or.php                            27-Sep-2020 11:03                6260
function.variant-pow.php                           27-Sep-2020 11:03                4505
function.variant-round.php                         27-Sep-2020 11:03                4155
function.variant-set-type.php                      27-Sep-2020 11:03                3499
function.variant-set.php                           27-Sep-2020 11:03                2788
function.variant-sub.php                           27-Sep-2020 11:03                5342
function.variant-xor.php                           27-Sep-2020 11:03                5611
function.version-compare.php                       27-Sep-2020 11:02               11599
function.vfprintf.php                              27-Sep-2020 11:03               15423
function.virtual.php                               27-Sep-2020 11:03                5095
function.vprintf.php                               27-Sep-2020 11:03               14783
function.vsprintf.php                              27-Sep-2020 11:03               14717
function.wddx-add-vars.php                         27-Sep-2020 11:03                3494
function.wddx-deserialize.php                      27-Sep-2020 11:03                3400
function.wddx-packet-end.php                       27-Sep-2020 11:03                2629
function.wddx-packet-start.php                     27-Sep-2020 11:03                2719
function.wddx-serialize-value.php                  27-Sep-2020 11:03                2980
function.wddx-serialize-vars.php                   27-Sep-2020 11:03                5879
function.win32-continue-service.php                27-Sep-2020 11:03                4594
function.win32-create-service.php                  27-Sep-2020 11:03               28928
function.win32-delete-service.php                  27-Sep-2020 11:03                4751
function.win32-get-last-control-message.php        27-Sep-2020 11:03                5137
function.win32-pause-service.php                   27-Sep-2020 11:03                4591
function.win32-query-service-status.php            27-Sep-2020 11:03                6481
function.win32-send-custom-control.php             27-Sep-2020 11:03                4667
function.win32-set-service-exit-code.php           27-Sep-2020 11:03                4224
function.win32-set-service-exit-mode.php           27-Sep-2020 11:03                4265
function.win32-set-service-status.php              27-Sep-2020 11:03                6567
function.win32-start-service-ctrl-dispatcher.php   27-Sep-2020 11:03                9501
function.win32-start-service.php                   27-Sep-2020 11:03                4599
function.win32-stop-service.php                    27-Sep-2020 11:03                4522
function.wincache-fcache-fileinfo.php              27-Sep-2020 11:02                8954
function.wincache-fcache-meminfo.php               27-Sep-2020 11:02                6702
function.wincache-lock.php                         27-Sep-2020 11:02                8445
function.wincache-ocache-fileinfo.php              27-Sep-2020 11:02                9615
function.wincache-ocache-meminfo.php               27-Sep-2020 11:02                6906
function.wincache-refresh-if-changed.php           27-Sep-2020 11:02                7703
function.wincache-rplist-fileinfo.php              27-Sep-2020 11:02                6989
function.wincache-rplist-meminfo.php               27-Sep-2020 11:02                6817
function.wincache-scache-info.php                  27-Sep-2020 11:02                9210
function.wincache-scache-meminfo.php               27-Sep-2020 11:02                6275
function.wincache-ucache-add.php                   27-Sep-2020 11:02               13107
function.wincache-ucache-cas.php                   27-Sep-2020 11:02                5964
function.wincache-ucache-clear.php                 27-Sep-2020 11:02                7273
function.wincache-ucache-dec.php                   27-Sep-2020 11:02                5963
function.wincache-ucache-delete.php                27-Sep-2020 11:02               11298
function.wincache-ucache-exists.php                27-Sep-2020 11:02                5961
function.wincache-ucache-get.php                   27-Sep-2020 11:02               10348
function.wincache-ucache-inc.php                   27-Sep-2020 11:02                5955
function.wincache-ucache-info.php                  27-Sep-2020 11:02               10935
function.wincache-ucache-meminfo.php               27-Sep-2020 11:02                6479
function.wincache-ucache-set.php                   27-Sep-2020 11:02               13316
function.wincache-unlock.php                       27-Sep-2020 11:02                7806
function.wordwrap.php                              27-Sep-2020 11:03                8750
function.xattr-get.php                             27-Sep-2020 11:03                5701
function.xattr-list.php                            27-Sep-2020 11:03                6312
function.xattr-remove.php                          27-Sep-2020 11:03                5871
function.xattr-set.php                             27-Sep-2020 11:03                7381
function.xattr-supported.php                       27-Sep-2020 11:03                4980
function.xdiff-file-bdiff-size.php                 27-Sep-2020 11:03                4723
function.xdiff-file-bdiff.php                      27-Sep-2020 11:03                5572
function.xdiff-file-bpatch.php                     27-Sep-2020 11:03                6233
function.xdiff-file-diff-binary.php                27-Sep-2020 11:03                5910
function.xdiff-file-diff.php                       27-Sep-2020 11:03                6675
function.xdiff-file-merge3.php                     27-Sep-2020 11:03                6437
function.xdiff-file-patch-binary.php               27-Sep-2020 11:03                6285
function.xdiff-file-patch.php                      27-Sep-2020 11:03                8524
function.xdiff-file-rabdiff.php                    27-Sep-2020 11:03                6142
function.xdiff-string-bdiff-size.php               27-Sep-2020 11:03                5046
function.xdiff-string-bdiff.php                    27-Sep-2020 11:03                3546
function.xdiff-string-bpatch.php                   27-Sep-2020 11:03                3658
function.xdiff-string-diff-binary.php              27-Sep-2020 11:03                3950
function.xdiff-string-diff.php                     27-Sep-2020 11:03                7199
function.xdiff-string-merge3.php                   27-Sep-2020 11:03                4271
function.xdiff-string-patch-binary.php             27-Sep-2020 11:03                4105
function.xdiff-string-patch.php                    27-Sep-2020 11:03                7816
function.xdiff-string-rabdiff.php                  27-Sep-2020 11:03                4146
function.xhprof-disable.php                        27-Sep-2020 11:02                3852
function.xhprof-enable.php                         27-Sep-2020 11:02                7658
function.xhprof-sample-disable.php                 27-Sep-2020 11:02                4652
function.xhprof-sample-enable.php                  27-Sep-2020 11:02                3378
function.xml-error-string.php                      27-Sep-2020 11:03                2950
function.xml-get-current-byte-index.php            27-Sep-2020 11:03                3641
function.xml-get-current-column-number.php         27-Sep-2020 11:03                3481
function.xml-get-current-line-number.php           27-Sep-2020 11:03                3287
function.xml-get-error-code.php                    27-Sep-2020 11:03                2947
function.xml-parse-into-struct.php                 27-Sep-2020 11:03               20103
function.xml-parse.php                             27-Sep-2020 11:03                7210
function.xml-parser-create-ns.php                  27-Sep-2020 11:03                4040
function.xml-parser-create.php                     27-Sep-2020 11:03                3865
function.xml-parser-free.php                       27-Sep-2020 11:03                2962
function.xml-parser-get-option.php                 27-Sep-2020 11:03                3983
function.xml-parser-set-option.php                 27-Sep-2020 11:03                5119
function.xml-set-character-data-handler.php        27-Sep-2020 11:03                4915
function.xml-set-default-handler.php               27-Sep-2020 11:03                4801
function.xml-set-element-handler.php               27-Sep-2020 11:03                7650
function.xml-set-end-namespace-decl-handler.php    27-Sep-2020 11:03                5896
function.xml-set-external-entity-ref-handler.php   27-Sep-2020 11:03                7545
function.xml-set-notation-decl-handler.php         27-Sep-2020 11:03                6555
function.xml-set-object.php                        27-Sep-2020 11:03                9740
function.xml-set-processing-instruction-handler..> 27-Sep-2020 11:03                5908
function.xml-set-start-namespace-decl-handler.php  27-Sep-2020 11:03                6094
function.xml-set-unparsed-entity-decl-handler.php  27-Sep-2020 11:03                7149
function.xmlrpc-decode-request.php                 27-Sep-2020 11:03                2499
function.xmlrpc-decode.php                         27-Sep-2020 11:03                3932
function.xmlrpc-encode-request.php                 27-Sep-2020 11:03                8617
function.xmlrpc-encode.php                         27-Sep-2020 11:03                2234
function.xmlrpc-get-type.php                       27-Sep-2020 11:03                6389
function.xmlrpc-is-fault.php                       27-Sep-2020 11:03                3588
function.xmlrpc-parse-method-descriptions.php      27-Sep-2020 11:03                2332
function.xmlrpc-server-add-introspection-data.php  27-Sep-2020 11:03                2468
function.xmlrpc-server-call-method.php             27-Sep-2020 11:03                2707
function.xmlrpc-server-create.php                  27-Sep-2020 11:03                2155
function.xmlrpc-server-destroy.php                 27-Sep-2020 11:03                2266
function.xmlrpc-server-register-introspection-c..> 27-Sep-2020 11:03                2540
function.xmlrpc-server-register-method.php         27-Sep-2020 11:03                2577
function.xmlrpc-set-type.php                       27-Sep-2020 11:03                5100
function.xmlwriter-end-attribute.php               27-Sep-2020 11:03                4247
function.xmlwriter-end-cdata.php                   27-Sep-2020 11:03                3775
function.xmlwriter-end-comment.php                 27-Sep-2020 11:03                3798
function.xmlwriter-end-document.php                27-Sep-2020 11:03                3622
function.xmlwriter-end-dtd-attlist.php             27-Sep-2020 11:03                3893
function.xmlwriter-end-dtd-element.php             27-Sep-2020 11:03                3889
function.xmlwriter-end-dtd-entity.php              27-Sep-2020 11:03                3854
function.xmlwriter-end-dtd.php                     27-Sep-2020 11:03                3733
function.xmlwriter-end-element.php                 27-Sep-2020 11:03                3785
function.xmlwriter-end-pi.php                      27-Sep-2020 11:03                3701
function.xmlwriter-flush.php                       27-Sep-2020 11:03                3915
function.xmlwriter-full-end-element.php            27-Sep-2020 11:03                3695
function.xmlwriter-open-memory.php                 27-Sep-2020 11:03                3371
function.xmlwriter-open-uri.php                    27-Sep-2020 11:03                5066
function.xmlwriter-output-memory.php               27-Sep-2020 11:03                4091
function.xmlwriter-set-indent-string.php           27-Sep-2020 11:03                5329
function.xmlwriter-set-indent.php                  27-Sep-2020 11:03                5194
function.xmlwriter-start-attribute-ns.php          27-Sep-2020 11:03                5375
function.xmlwriter-start-attribute.php             27-Sep-2020 11:03                6401
function.xmlwriter-start-cdata.php                 27-Sep-2020 11:03                3787
function.xmlwriter-start-comment.php               27-Sep-2020 11:03                3818
function.xmlwriter-start-document.php              27-Sep-2020 11:03                5094
function.xmlwriter-start-dtd-attlist.php           27-Sep-2020 11:03                4239
function.xmlwriter-start-dtd-element.php           27-Sep-2020 11:03                4288
function.xmlwriter-start-dtd-entity.php            27-Sep-2020 11:03                4540
function.xmlwriter-start-dtd.php                   27-Sep-2020 11:03                4922
function.xmlwriter-start-element-ns.php            27-Sep-2020 11:03                4935
function.xmlwriter-start-element.php               27-Sep-2020 11:03                4138
function.xmlwriter-start-pi.php                    27-Sep-2020 11:03                4068
function.xmlwriter-text.php                        27-Sep-2020 11:03                4184
function.xmlwriter-write-attribute-ns.php          27-Sep-2020 11:03                5741
function.xmlwriter-write-attribute.php             27-Sep-2020 11:03                7977
function.xmlwriter-write-cdata.php                 27-Sep-2020 11:03                8010
function.xmlwriter-write-comment.php               27-Sep-2020 11:03                4165
function.xmlwriter-write-dtd-attlist.php           27-Sep-2020 11:03                4638
function.xmlwriter-write-dtd-element.php           27-Sep-2020 11:03                4623
function.xmlwriter-write-dtd-entity.php            27-Sep-2020 11:03                5449
function.xmlwriter-write-dtd.php                   27-Sep-2020 11:03                5239
function.xmlwriter-write-element-ns.php            27-Sep-2020 11:03                5521
function.xmlwriter-write-element.php               27-Sep-2020 11:03                4739
function.xmlwriter-write-pi.php                    27-Sep-2020 11:03                4469
function.xmlwriter-write-raw.php                   27-Sep-2020 11:03                3832
function.yaml-emit-file.php                        27-Sep-2020 11:03                5697
function.yaml-emit.php                             27-Sep-2020 11:03               12787
function.yaml-parse-file.php                       27-Sep-2020 11:03                5558
function.yaml-parse-url.php                        27-Sep-2020 11:03                5887
function.yaml-parse.php                            27-Sep-2020 11:03                9889
function.yaz-addinfo.php                           27-Sep-2020 11:03                3202
function.yaz-ccl-conf.php                          27-Sep-2020 11:03                5562
function.yaz-ccl-parse.php                         27-Sep-2020 11:03                6489
function.yaz-close.php                             27-Sep-2020 11:03                3177
function.yaz-connect.php                           27-Sep-2020 11:03                8760
function.yaz-database.php                          27-Sep-2020 11:03                3047
function.yaz-element.php                           27-Sep-2020 11:03                3480
function.yaz-errno.php                             27-Sep-2020 11:03                3441
function.yaz-error.php                             27-Sep-2020 11:03                3194
function.yaz-es-result.php                         27-Sep-2020 11:03                3095
function.yaz-es.php                                27-Sep-2020 11:03                7029
function.yaz-get-option.php                        27-Sep-2020 11:03                3117
function.yaz-hits.php                              27-Sep-2020 11:03                4565
function.yaz-itemorder.php                         27-Sep-2020 11:03                6814
function.yaz-present.php                           27-Sep-2020 11:03                2676
function.yaz-range.php                             27-Sep-2020 11:03                3329
function.yaz-record.php                            27-Sep-2020 11:03               14277
function.yaz-scan-result.php                       27-Sep-2020 11:03                3709
function.yaz-scan.php                              27-Sep-2020 11:03                9483
function.yaz-schema.php                            27-Sep-2020 11:03                3212
function.yaz-search.php                            27-Sep-2020 11:03                8242
function.yaz-set-option.php                        27-Sep-2020 11:03                6591
function.yaz-sort.php                              27-Sep-2020 11:03                5384
function.yaz-syntax.php                            27-Sep-2020 11:03                3170
function.yaz-wait.php                              27-Sep-2020 11:03                3816
function.zend-thread-id.php                        27-Sep-2020 11:02                3428
function.zend-version.php                          27-Sep-2020 11:02                3720
function.zip-close.php                             27-Sep-2020 11:02                3470
function.zip-entry-close.php                       27-Sep-2020 11:02                3553
function.zip-entry-compressedsize.php              27-Sep-2020 11:02                3713
function.zip-entry-compressionmethod.php           27-Sep-2020 11:02                3805
function.zip-entry-filesize.php                    27-Sep-2020 11:02                3654
function.zip-entry-name.php                        27-Sep-2020 11:02                3593
function.zip-entry-open.php                        27-Sep-2020 11:02                5068
function.zip-entry-read.php                        27-Sep-2020 11:02                4353
function.zip-open.php                              27-Sep-2020 11:02                3701
function.zip-read.php                              27-Sep-2020 11:02                4024
function.zlib-decode.php                           27-Sep-2020 11:02                2977
function.zlib-encode.php                           27-Sep-2020 11:02                4759
function.zlib-get-coding-type.php                  27-Sep-2020 11:02                2393
function.zookeeper-dispatch.php                    27-Sep-2020 11:03                8138
functional.parallel.php                            27-Sep-2020 11:03                2436
functions.anonymous.php                            27-Sep-2020 11:02               26151
functions.arguments.php                            27-Sep-2020 11:02               50091
functions.arrow.php                                27-Sep-2020 11:02               10871
functions.internal.php                             27-Sep-2020 11:02                4599
functions.returning-values.php                     27-Sep-2020 11:02               14191
functions.user-defined.php                         27-Sep-2020 11:02                9948
functions.variable-functions.php                   27-Sep-2020 11:02               13362
gearman.configuration.php                          27-Sep-2020 11:03                1142
gearman.constants.php                              27-Sep-2020 11:03               20777
gearman.examples-reverse-bg.php                    27-Sep-2020 11:03               11600
gearman.examples-reverse-task.php                  27-Sep-2020 11:03               18779
gearman.examples-reverse.php                       27-Sep-2020 11:03               14220
gearman.examples.php                               27-Sep-2020 11:03                1474
gearman.installation.php                           27-Sep-2020 11:03                1466
gearman.requirements.php                           27-Sep-2020 11:03                1393
gearman.resources.php                              27-Sep-2020 11:03                1117
gearman.setup.php                                  27-Sep-2020 11:03                1484
gearmanclient.addoptions.php                       27-Sep-2020 11:03                2765
gearmanclient.addserver.php                        27-Sep-2020 11:03                4818
gearmanclient.addservers.php                       27-Sep-2020 11:03                4309
gearmanclient.addtask.php                          27-Sep-2020 11:03               14875
gearmanclient.addtaskbackground.php                27-Sep-2020 11:03               21152
gearmanclient.addtaskhigh.php                      27-Sep-2020 11:03               10977
gearmanclient.addtaskhighbackground.php            27-Sep-2020 11:03                5514
gearmanclient.addtasklow.php                       27-Sep-2020 11:03               10960
gearmanclient.addtasklowbackground.php             27-Sep-2020 11:03                5508
gearmanclient.addtaskstatus.php                    27-Sep-2020 11:03                9759
gearmanclient.clearcallbacks.php                   27-Sep-2020 11:03                4272
gearmanclient.clone.php                            27-Sep-2020 11:03                2427
gearmanclient.construct.php                        27-Sep-2020 11:03                2688
gearmanclient.context.php                          27-Sep-2020 11:03                2766
gearmanclient.data.php                             27-Sep-2020 11:03                3034
gearmanclient.do.php                               27-Sep-2020 11:03               23755
gearmanclient.dobackground.php                     27-Sep-2020 11:03                9586
gearmanclient.dohigh.php                           27-Sep-2020 11:03                4555
gearmanclient.dohighbackground.php                 27-Sep-2020 11:03                4434
gearmanclient.dojobhandle.php                      27-Sep-2020 11:03                2819
gearmanclient.dolow.php                            27-Sep-2020 11:03                4542
gearmanclient.dolowbackground.php                  27-Sep-2020 11:03                4417
gearmanclient.donormal.php                         27-Sep-2020 11:03               24075
gearmanclient.dostatus.php                         27-Sep-2020 11:03                8709
gearmanclient.echo.php                             27-Sep-2020 11:03                2647
gearmanclient.error.php                            27-Sep-2020 11:03                2513
gearmanclient.geterrno.php                         27-Sep-2020 11:03                2534
gearmanclient.jobstatus.php                        27-Sep-2020 11:03                8530
gearmanclient.ping.php                             27-Sep-2020 11:03                2620
gearmanclient.removeoptions.php                    27-Sep-2020 11:03                2408
gearmanclient.returncode.php                       27-Sep-2020 11:03                2165
gearmanclient.runtasks.php                         27-Sep-2020 11:03                3472
gearmanclient.setclientcallback.php                27-Sep-2020 11:03                5188
gearmanclient.setcompletecallback.php              27-Sep-2020 11:03                4992
gearmanclient.setcontext.php                       27-Sep-2020 11:03                2968
gearmanclient.setcreatedcallback.php               27-Sep-2020 11:03                4497
gearmanclient.setdata.php                          27-Sep-2020 11:03                3163
gearmanclient.setdatacallback.php                  27-Sep-2020 11:03                4551
gearmanclient.setexceptioncallback.php             27-Sep-2020 11:03                4497
gearmanclient.setfailcallback.php                  27-Sep-2020 11:03                4557
gearmanclient.setoptions.php                       27-Sep-2020 11:03                2397
gearmanclient.setstatuscallback.php                27-Sep-2020 11:03                4555
gearmanclient.settimeout.php                       27-Sep-2020 11:03                2439
gearmanclient.setwarningcallback.php               27-Sep-2020 11:03                4557
gearmanclient.setworkloadcallback.php              27-Sep-2020 11:03                4710
gearmanclient.timeout.php                          27-Sep-2020 11:03                2619
gearmanjob.complete.php                            27-Sep-2020 11:03                3270
gearmanjob.construct.php                           27-Sep-2020 11:03                2198
gearmanjob.data.php                                27-Sep-2020 11:03                3234
gearmanjob.exception.php                           27-Sep-2020 11:03                3451
gearmanjob.fail.php                                27-Sep-2020 11:03                3481
gearmanjob.functionname.php                        27-Sep-2020 11:03                2554
gearmanjob.handle.php                              27-Sep-2020 11:03                2447
gearmanjob.returncode.php                          27-Sep-2020 11:03                2490
gearmanjob.sendcomplete.php                        27-Sep-2020 11:03                2987
gearmanjob.senddata.php                            27-Sep-2020 11:03                2958
gearmanjob.sendexception.php                       27-Sep-2020 11:03                3181
gearmanjob.sendfail.php                            27-Sep-2020 11:03                3196
gearmanjob.sendstatus.php                          27-Sep-2020 11:03                3651
gearmanjob.sendwarning.php                         27-Sep-2020 11:03                3179
gearmanjob.setreturn.php                           27-Sep-2020 11:03                2336
gearmanjob.status.php                              27-Sep-2020 11:03                3936
gearmanjob.unique.php                              27-Sep-2020 11:03                2700
gearmanjob.warning.php                             27-Sep-2020 11:03                3464
gearmanjob.workload.php                            27-Sep-2020 11:03                2703
gearmanjob.workloadsize.php                        27-Sep-2020 11:03                2504
gearmantask.construct.php                          27-Sep-2020 11:03                2217
gearmantask.create.php                             27-Sep-2020 11:03                2482
gearmantask.data.php                               27-Sep-2020 11:03                2502
gearmantask.datasize.php                           27-Sep-2020 11:03                2523
gearmantask.function.php                           27-Sep-2020 11:03                2511
gearmantask.functionname.php                       27-Sep-2020 11:03                2199
gearmantask.isknown.php                            27-Sep-2020 11:03                2223
gearmantask.isrunning.php                          27-Sep-2020 11:03                2221
gearmantask.jobhandle.php                          27-Sep-2020 11:03                2593
gearmantask.recvdata.php                           27-Sep-2020 11:03                3132
gearmantask.returncode.php                         27-Sep-2020 11:03                2516
gearmantask.senddata.php                           27-Sep-2020 11:03                3059
gearmantask.sendworkload.php                       27-Sep-2020 11:03                3088
gearmantask.taskdenominator.php                    27-Sep-2020 11:03                2709
gearmantask.tasknumerator.php                      27-Sep-2020 11:03                2683
gearmantask.unique.php                             27-Sep-2020 11:03                2917
gearmantask.uuid.php                               27-Sep-2020 11:03                3208
gearmanworker.addfunction.php                      27-Sep-2020 11:03                7517
gearmanworker.addoptions.php                       27-Sep-2020 11:03                3154
gearmanworker.addserver.php                        27-Sep-2020 11:03                4475
gearmanworker.addservers.php                       27-Sep-2020 11:03                3959
gearmanworker.clone.php                            27-Sep-2020 11:03                2187
gearmanworker.construct.php                        27-Sep-2020 11:03                2661
gearmanworker.echo.php                             27-Sep-2020 11:03                2813
gearmanworker.error.php                            27-Sep-2020 11:03                2466
gearmanworker.geterrno.php                         27-Sep-2020 11:03                2501
gearmanworker.options.php                          27-Sep-2020 11:03                2509
gearmanworker.register.php                         27-Sep-2020 11:03                3496
gearmanworker.removeoptions.php                    27-Sep-2020 11:03                3173
gearmanworker.returncode.php                       27-Sep-2020 11:03                2709
gearmanworker.setid.php                            27-Sep-2020 11:03                3743
gearmanworker.setoptions.php                       27-Sep-2020 11:03                3324
gearmanworker.settimeout.php                       27-Sep-2020 11:03                7989
gearmanworker.timeout.php                          27-Sep-2020 11:03                2609
gearmanworker.unregister.php                       27-Sep-2020 11:03                3143
gearmanworker.unregisterall.php                    27-Sep-2020 11:03                2881
gearmanworker.wait.php                             27-Sep-2020 11:03                8359
gearmanworker.work.php                             27-Sep-2020 11:03                5291
gender-gender.connect.php                          27-Sep-2020 11:03                2339
gender-gender.construct.php                        27-Sep-2020 11:03                2374
gender-gender.country.php                          27-Sep-2020 11:03                3383
gender-gender.get.php                              27-Sep-2020 11:03                2575
gender-gender.isnick.php                           27-Sep-2020 11:03                3008
gender-gender.similarnames.php                     27-Sep-2020 11:03                2679
gender.example.admin.php                           27-Sep-2020 11:03                9221
gender.examples.php                                27-Sep-2020 11:03                1252
gender.installation.php                            27-Sep-2020 11:03                1851
gender.setup.php                                   27-Sep-2020 11:03                1269
generator.current.php                              27-Sep-2020 11:02                2043
generator.getreturn.php                            27-Sep-2020 11:02                3891
generator.key.php                                  27-Sep-2020 11:02                3874
generator.next.php                                 27-Sep-2020 11:02                2276
generator.rewind.php                               27-Sep-2020 11:02                2077
generator.send.php                                 27-Sep-2020 11:02                5643
generator.throw.php                                27-Sep-2020 11:02                5807
generator.valid.php                                27-Sep-2020 11:02                2067
generator.wakeup.php                               27-Sep-2020 11:02                2086
geoip.configuration.php                            27-Sep-2020 11:03                2331
geoip.constants.php                                27-Sep-2020 11:03                5366
geoip.installation.php                             27-Sep-2020 11:03                1600
geoip.requirements.php                             27-Sep-2020 11:03                1598
geoip.resources.php                                27-Sep-2020 11:03                1075
geoip.setup.php                                    27-Sep-2020 11:03                1447
gettext.configuration.php                          27-Sep-2020 11:03                1142
gettext.constants.php                              27-Sep-2020 11:03                1043
gettext.installation.php                           27-Sep-2020 11:03                1275
gettext.requirements.php                           27-Sep-2020 11:03                1270
gettext.resources.php                              27-Sep-2020 11:03                1087
gettext.setup.php                                  27-Sep-2020 11:03                1488
getting-started.php                                27-Sep-2020 11:02                1901
globiterator.construct.php                         27-Sep-2020 11:03                6352
globiterator.count.php                             27-Sep-2020 11:03                4356
gmagick.addimage.php                               27-Sep-2020 11:03                2718
gmagick.addnoiseimage.php                          27-Sep-2020 11:03                2710
gmagick.annotateimage.php                          27-Sep-2020 11:03                3795
gmagick.blurimage.php                              27-Sep-2020 11:03                2890
gmagick.borderimage.php                            27-Sep-2020 11:03                3261
gmagick.charcoalimage.php                          27-Sep-2020 11:03                2922
gmagick.chopimage.php                              27-Sep-2020 11:03                3363
gmagick.clear.php                                  27-Sep-2020 11:03                2331
gmagick.commentimage.php                           27-Sep-2020 11:03                2574
gmagick.compositeimage.php                         27-Sep-2020 11:03                3506
gmagick.configuration.php                          27-Sep-2020 11:03                1148
gmagick.constants.php                              27-Sep-2020 11:03               83812
gmagick.construct.php                              27-Sep-2020 11:03                2495
gmagick.cropimage.php                              27-Sep-2020 11:03                3501
gmagick.cropthumbnailimage.php                     27-Sep-2020 11:03                2955
gmagick.current.php                                27-Sep-2020 11:03                2393
gmagick.cyclecolormapimage.php                     27-Sep-2020 11:03                2778
gmagick.deconstructimages.php                      27-Sep-2020 11:03                2611
gmagick.despeckleimage.php                         27-Sep-2020 11:03                3534
gmagick.destroy.php                                27-Sep-2020 11:03                2191
gmagick.drawimage.php                              27-Sep-2020 11:03                2673
gmagick.edgeimage.php                              27-Sep-2020 11:03                2649
gmagick.embossimage.php                            27-Sep-2020 11:03                3103
gmagick.enhanceimage.php                           27-Sep-2020 11:03                2236
gmagick.equalizeimage.php                          27-Sep-2020 11:03                2193
gmagick.examples.php                               27-Sep-2020 11:03                3589
gmagick.flipimage.php                              27-Sep-2020 11:03                2546
gmagick.flopimage.php                              27-Sep-2020 11:03                2532
gmagick.frameimage.php                             27-Sep-2020 11:03                3929
gmagick.gammaimage.php                             27-Sep-2020 11:03                2859
gmagick.getcopyright.php                           27-Sep-2020 11:03                2238
gmagick.getfilename.php                            27-Sep-2020 11:03                2188
gmagick.getimagebackgroundcolor.php                27-Sep-2020 11:03                2555
gmagick.getimageblueprimary.php                    27-Sep-2020 11:03                2820
gmagick.getimagebordercolor.php                    27-Sep-2020 11:03                2516
gmagick.getimagechanneldepth.php                   27-Sep-2020 11:03                2510
gmagick.getimagecolors.php                         27-Sep-2020 11:03                2405
gmagick.getimagecolorspace.php                     27-Sep-2020 11:03                2359
gmagick.getimagecompose.php                        27-Sep-2020 11:03                2442
gmagick.getimagedelay.php                          27-Sep-2020 11:03                2341
gmagick.getimagedepth.php                          27-Sep-2020 11:03                2311
gmagick.getimagedispose.php                        27-Sep-2020 11:03                2363
gmagick.getimageextrema.php                        27-Sep-2020 11:03                2538
gmagick.getimagefilename.php                       27-Sep-2020 11:03                2444
gmagick.getimageformat.php                         27-Sep-2020 11:03                2429
gmagick.getimagegamma.php                          27-Sep-2020 11:03                2337
gmagick.getimagegreenprimary.php                   27-Sep-2020 11:03                2544
gmagick.getimageheight.php                         27-Sep-2020 11:03                2362
gmagick.getimagehistogram.php                      27-Sep-2020 11:03                2478
gmagick.getimageindex.php                          27-Sep-2020 11:03                2417
gmagick.getimageinterlacescheme.php                27-Sep-2020 11:03                2472
gmagick.getimageiterations.php                     27-Sep-2020 11:03                2404
gmagick.getimagematte.php                          27-Sep-2020 11:03                2543
gmagick.getimagemattecolor.php                     27-Sep-2020 11:03                2510
gmagick.getimageprofile.php                        27-Sep-2020 11:03                2463
gmagick.getimageredprimary.php                     27-Sep-2020 11:03                2567
gmagick.getimagerenderingintent.php                27-Sep-2020 11:03                2483
gmagick.getimageresolution.php                     27-Sep-2020 11:03                2420
gmagick.getimagescene.php                          27-Sep-2020 11:03                2328
gmagick.getimagesignature.php                      27-Sep-2020 11:03                2437
gmagick.getimagetype.php                           27-Sep-2020 11:03                2336
gmagick.getimageunits.php                          27-Sep-2020 11:03                2133
gmagick.getimagewhitepoint.php                     27-Sep-2020 11:03                2547
gmagick.getimagewidth.php                          27-Sep-2020 11:03                2342
gmagick.getpackagename.php                         27-Sep-2020 11:03                2393
gmagick.getquantumdepth.php                        27-Sep-2020 11:03                2409
gmagick.getreleasedate.php                         27-Sep-2020 11:03                2427
gmagick.getsamplingfactors.php                     27-Sep-2020 11:03                2478
gmagick.getsize.php                                27-Sep-2020 11:03                2482
gmagick.getversion.php                             27-Sep-2020 11:03                2376
gmagick.hasnextimage.php                           27-Sep-2020 11:03                2573
gmagick.haspreviousimage.php                       27-Sep-2020 11:03                2613
gmagick.implodeimage.php                           27-Sep-2020 11:03                2714
gmagick.installation.php                           27-Sep-2020 11:03                1842
gmagick.labelimage.php                             27-Sep-2020 11:03                2558
gmagick.levelimage.php                             27-Sep-2020 11:03                4176
gmagick.magnifyimage.php                           27-Sep-2020 11:03                2430
gmagick.mapimage.php                               27-Sep-2020 11:03                3001
gmagick.medianfilterimage.php                      27-Sep-2020 11:03                2751
gmagick.minifyimage.php                            27-Sep-2020 11:03                2452
gmagick.modulateimage.php                          27-Sep-2020 11:03                3513
gmagick.motionblurimage.php                        27-Sep-2020 11:03                3483
gmagick.newimage.php                               27-Sep-2020 11:03                3370
gmagick.nextimage.php                              27-Sep-2020 11:03                2393
gmagick.normalizeimage.php                         27-Sep-2020 11:03                2708
gmagick.oilpaintimage.php                          27-Sep-2020 11:03                2828
gmagick.previousimage.php                          27-Sep-2020 11:03                2459
gmagick.profileimage.php                           27-Sep-2020 11:03                3084
gmagick.quantizeimage.php                          27-Sep-2020 11:03                4812
gmagick.quantizeimages.php                         27-Sep-2020 11:03                4814
gmagick.queryfontmetrics.php                       27-Sep-2020 11:03                2655
gmagick.queryfonts.php                             27-Sep-2020 11:03                2435
gmagick.queryformats.php                           27-Sep-2020 11:03                2702
gmagick.radialblurimage.php                        27-Sep-2020 11:03                2915
gmagick.raiseimage.php                             27-Sep-2020 11:03                3817
gmagick.read.php                                   27-Sep-2020 11:03                2491
gmagick.readimage.php                              27-Sep-2020 11:03                2537
gmagick.readimageblob.php                          27-Sep-2020 11:03                2872
gmagick.readimagefile.php                          27-Sep-2020 11:03                2738
gmagick.reducenoiseimage.php                       27-Sep-2020 11:03                2883
gmagick.removeimage.php                            27-Sep-2020 11:03                2402
gmagick.removeimageprofile.php                     27-Sep-2020 11:03                2645
gmagick.requirements.php                           27-Sep-2020 11:03                1571
gmagick.resampleimage.php                          27-Sep-2020 11:03                3471
gmagick.resizeimage.php                            27-Sep-2020 11:03                3607
gmagick.rollimage.php                              27-Sep-2020 11:03                2764
gmagick.rotateimage.php                            27-Sep-2020 11:03                3017
gmagick.scaleimage.php                             27-Sep-2020 11:03                3137
gmagick.separateimagechannel.php                   27-Sep-2020 11:03                2912
gmagick.setcompressionquality.php                  27-Sep-2020 11:03                3955
gmagick.setfilename.php                            27-Sep-2020 11:03                2664
gmagick.setimagebackgroundcolor.php                27-Sep-2020 11:03                2781
gmagick.setimageblueprimary.php                    27-Sep-2020 11:03                2971
gmagick.setimagebordercolor.php                    27-Sep-2020 11:03                2747
gmagick.setimagechanneldepth.php                   27-Sep-2020 11:03                3104
gmagick.setimagecolorspace.php                     27-Sep-2020 11:03                2930
gmagick.setimagecompose.php                        27-Sep-2020 11:03                2646
gmagick.setimagedelay.php                          27-Sep-2020 11:03                2597
gmagick.setimagedepth.php                          27-Sep-2020 11:03                2595
gmagick.setimagedispose.php                        27-Sep-2020 11:03                2636
gmagick.setimagefilename.php                       27-Sep-2020 11:03                2684
gmagick.setimageformat.php                         27-Sep-2020 11:03                2650
gmagick.setimagegamma.php                          27-Sep-2020 11:03                2588
gmagick.setimagegreenprimary.php                   27-Sep-2020 11:03                2979
gmagick.setimageindex.php                          27-Sep-2020 11:03                2736
gmagick.setimageinterlacescheme.php                27-Sep-2020 11:03                2796
gmagick.setimageiterations.php                     27-Sep-2020 11:03                2688
gmagick.setimageprofile.php                        27-Sep-2020 11:03                3134
gmagick.setimageredprimary.php                     27-Sep-2020 11:03                2949
gmagick.setimagerenderingintent.php                27-Sep-2020 11:03                2834
gmagick.setimageresolution.php                     27-Sep-2020 11:03                2943
gmagick.setimagescene.php                          27-Sep-2020 11:03                2586
gmagick.setimagetype.php                           27-Sep-2020 11:03                2757
gmagick.setimageunits.php                          27-Sep-2020 11:03                2712
gmagick.setimagewhitepoint.php                     27-Sep-2020 11:03                2911
gmagick.setsamplingfactors.php                     27-Sep-2020 11:03                2727
gmagick.setsize.php                                27-Sep-2020 11:03                2877
gmagick.setup.php                                  27-Sep-2020 11:03                1412
gmagick.shearimage.php                             27-Sep-2020 11:03                3645
gmagick.solarizeimage.php                          27-Sep-2020 11:03                2843
gmagick.spreadimage.php                            27-Sep-2020 11:03                2688
gmagick.stripimage.php                             27-Sep-2020 11:03                2382
gmagick.swirlimage.php                             27-Sep-2020 11:03                2770
gmagick.thumbnailimage.php                         27-Sep-2020 11:03                3363
gmagick.trimimage.php                              27-Sep-2020 11:03                2824
gmagick.write.php                                  27-Sep-2020 11:03                1604
gmagick.writeimage.php                             27-Sep-2020 11:03                2871
gmagickdraw.annotate.php                           27-Sep-2020 11:03                2851
gmagickdraw.arc.php                                27-Sep-2020 11:03                3697
gmagickdraw.bezier.php                             27-Sep-2020 11:03                2389
gmagickdraw.ellipse.php                            27-Sep-2020 11:03                3613
gmagickdraw.getfillcolor.php                       27-Sep-2020 11:03                2327
gmagickdraw.getfillopacity.php                     27-Sep-2020 11:03                2249
gmagickdraw.getfont.php                            27-Sep-2020 11:03                2279
gmagickdraw.getfontsize.php                        27-Sep-2020 11:03                2206
gmagickdraw.getfontstyle.php                       27-Sep-2020 11:03                2250
gmagickdraw.getfontweight.php                      27-Sep-2020 11:03                2213
gmagickdraw.getstrokecolor.php                     27-Sep-2020 11:03                2384
gmagickdraw.getstrokeopacity.php                   27-Sep-2020 11:03                2248
gmagickdraw.getstrokewidth.php                     27-Sep-2020 11:03                2274
gmagickdraw.gettextdecoration.php                  27-Sep-2020 11:03                2280
gmagickdraw.gettextencoding.php                    27-Sep-2020 11:03                2399
gmagickdraw.line.php                               27-Sep-2020 11:03                3137
gmagickdraw.point.php                              27-Sep-2020 11:03                2632
gmagickdraw.polygon.php                            27-Sep-2020 11:03                2455
gmagickdraw.polyline.php                           27-Sep-2020 11:03                2489
gmagickdraw.rectangle.php                          27-Sep-2020 11:03                3232
gmagickdraw.rotate.php                             27-Sep-2020 11:03                2447
gmagickdraw.roundrectangle.php                     27-Sep-2020 11:03                3850
gmagickdraw.scale.php                              27-Sep-2020 11:03                2696
gmagickdraw.setfillcolor.php                       27-Sep-2020 11:03                2794
gmagickdraw.setfillopacity.php                     27-Sep-2020 11:03                2537
gmagickdraw.setfont.php                            27-Sep-2020 11:03                2442
gmagickdraw.setfontsize.php                        27-Sep-2020 11:03                2470
gmagickdraw.setfontstyle.php                       27-Sep-2020 11:03                2600
gmagickdraw.setfontweight.php                      27-Sep-2020 11:03                2470
gmagickdraw.setstrokecolor.php                     27-Sep-2020 11:03                2816
gmagickdraw.setstrokeopacity.php                   27-Sep-2020 11:03                2553
gmagickdraw.setstrokewidth.php                     27-Sep-2020 11:03                2515
gmagickdraw.settextdecoration.php                  27-Sep-2020 11:03                2598
gmagickdraw.settextencoding.php                    27-Sep-2020 11:03                2806
gmagickpixel.construct.php                         27-Sep-2020 11:03                2470
gmagickpixel.getcolor.php                          27-Sep-2020 11:03                3787
gmagickpixel.getcolorcount.php                     27-Sep-2020 11:03                2279
gmagickpixel.getcolorvalue.php                     27-Sep-2020 11:03                2601
gmagickpixel.setcolor.php                          27-Sep-2020 11:03                2612
gmagickpixel.setcolorvalue.php                     27-Sep-2020 11:03                2922
gmp.configuration.php                              27-Sep-2020 11:03                1118
gmp.constants.php                                  27-Sep-2020 11:03                3611
gmp.examples.php                                   27-Sep-2020 11:03                3149
gmp.installation.php                               27-Sep-2020 11:03                1224
gmp.requirements.php                               27-Sep-2020 11:03                1550
gmp.resources.php                                  27-Sep-2020 11:03                1223
gmp.setup.php                                      27-Sep-2020 11:03                1440
gnupg.configuration.php                            27-Sep-2020 11:03                1130
gnupg.constants.php                                27-Sep-2020 11:03                7917
gnupg.examples-clearsign.php                       27-Sep-2020 11:03                6627
gnupg.examples.php                                 27-Sep-2020 11:03                1258
gnupg.installation.php                             27-Sep-2020 11:03                1449
gnupg.requirements.php                             27-Sep-2020 11:03                1162
gnupg.resources.php                                27-Sep-2020 11:03                1075
gnupg.setup.php                                    27-Sep-2020 11:03                1465
hash.configuration.php                             27-Sep-2020 11:02                1124
hash.constants.php                                 27-Sep-2020 11:02                1650
hash.installation.php                              27-Sep-2020 11:02                1518
hash.requirements.php                              27-Sep-2020 11:02                1100
hash.resources.php                                 27-Sep-2020 11:02                1192
hash.setup.php                                     27-Sep-2020 11:02                1447
hashcontext.construct.php                          27-Sep-2020 11:02                1804
history.php                                        27-Sep-2020 11:03                2052
history.php.books.php                              27-Sep-2020 11:03                2490
history.php.php                                    27-Sep-2020 11:03               10727
history.php.publications.php                       27-Sep-2020 11:03                1716
history.php.related.php                            27-Sep-2020 11:03                5872
hrtime-performancecounter.getfrequency.php         27-Sep-2020 11:03                2593
hrtime-performancecounter.getticks.php             27-Sep-2020 11:03                2474
hrtime-performancecounter.gettickssince.php        27-Sep-2020 11:03                2691
hrtime-stopwatch.getelapsedticks.php               27-Sep-2020 11:03                2374
hrtime-stopwatch.getelapsedtime.php                27-Sep-2020 11:03                2651
hrtime-stopwatch.getlastelapsedticks.php           27-Sep-2020 11:03                2442
hrtime-stopwatch.getlastelapsedtime.php            27-Sep-2020 11:03                2671
hrtime-stopwatch.isrunning.php                     27-Sep-2020 11:03                2342
hrtime-stopwatch.start.php                         27-Sep-2020 11:03                2275
hrtime-stopwatch.stop.php                          27-Sep-2020 11:03                2155
hrtime.example.basic.php                           27-Sep-2020 11:03                5877
hrtime.examples.php                                27-Sep-2020 11:03                1246
hrtime.installation.php                            27-Sep-2020 11:03                1851
hrtime.setup.php                                   27-Sep-2020 11:03                1266
ibase.configuration.php                            27-Sep-2020 11:03                7638
ibase.constants.php                                27-Sep-2020 11:03               18042
ibase.installation.php                             27-Sep-2020 11:03                3232
ibase.requirements.php                             27-Sep-2020 11:03                1077
ibase.resources.php                                27-Sep-2020 11:03                1075
ibase.setup.php                                    27-Sep-2020 11:03                1483
ibm-db2.configuration.php                          27-Sep-2020 11:03                9575
ibm-db2.constants.php                              27-Sep-2020 11:03                7969
ibm-db2.installation.php                           27-Sep-2020 11:03                3431
ibm-db2.requirements.php                           27-Sep-2020 11:03                3099
ibm-db2.resources.php                              27-Sep-2020 11:03                1150
ibm-db2.setup.php                                  27-Sep-2020 11:03                1493
iconv.configuration.php                            27-Sep-2020 11:03                4613
iconv.constants.php                                27-Sep-2020 11:03                3303
iconv.installation.php                             27-Sep-2020 11:03                1449
iconv.requirements.php                             27-Sep-2020 11:03                1378
iconv.resources.php                                27-Sep-2020 11:03                1075
iconv.setup.php                                    27-Sep-2020 11:03                1471
ifx.configuration.php                              27-Sep-2020 11:03               15588
ifx.constants.php                                  27-Sep-2020 11:03                3237
ifx.installation.php                               27-Sep-2020 11:03                1929
ifx.requirements.php                               27-Sep-2020 11:03                1535
ifx.resources.php                                  27-Sep-2020 11:03                1063
ifx.setup.php                                      27-Sep-2020 11:03                1451
iisfunc.configuration.php                          27-Sep-2020 11:03                1142
iisfunc.constants.php                              27-Sep-2020 11:03                3999
iisfunc.installation.php                           27-Sep-2020 11:03                1403
iisfunc.requirements.php                           27-Sep-2020 11:03                1089
iisfunc.resources.php                              27-Sep-2020 11:03                1087
iisfunc.setup.php                                  27-Sep-2020 11:03                1479
image.configuration.php                            27-Sep-2020 11:03                3210
image.constants.php                                27-Sep-2020 11:03               46144
image.examples-png.php                             27-Sep-2020 11:03                4780
image.examples-watermark.php                       27-Sep-2020 11:03                6098
image.examples.merged-watermark.php                27-Sep-2020 11:03                8978
image.examples.php                                 27-Sep-2020 11:03                1474
image.installation.php                             27-Sep-2020 11:03                6000
image.requirements.php                             27-Sep-2020 11:03                5206
image.resources.php                                27-Sep-2020 11:03                2464
image.setup.php                                    27-Sep-2020 11:03                1468
imagick.adaptiveblurimage.php                      27-Sep-2020 11:03                6505
imagick.adaptiveresizeimage.php                    27-Sep-2020 11:03                8488
imagick.adaptivesharpenimage.php                   27-Sep-2020 11:03                6114
imagick.adaptivethresholdimage.php                 27-Sep-2020 11:03                5988
imagick.addimage.php                               27-Sep-2020 11:03                2641
imagick.addnoiseimage.php                          27-Sep-2020 11:03                5271
imagick.affinetransformimage.php                   27-Sep-2020 11:03                6744
imagick.animateimages.php                          27-Sep-2020 11:03                2872
imagick.annotateimage.php                          27-Sep-2020 11:03                8376
imagick.appendimages.php                           27-Sep-2020 11:03                6555
imagick.autolevelimage.php                         27-Sep-2020 11:03                4300
imagick.averageimages.php                          27-Sep-2020 11:03                2411
imagick.blackthresholdimage.php                    27-Sep-2020 11:03                5159
imagick.blueshiftimage.php                         27-Sep-2020 11:03                4369
imagick.blurimage.php                              27-Sep-2020 11:03                5368
imagick.borderimage.php                            27-Sep-2020 11:03                5833
imagick.brightnesscontrastimage.php                27-Sep-2020 11:03                5420
imagick.charcoalimage.php                          27-Sep-2020 11:03                4762
imagick.chopimage.php                              27-Sep-2020 11:03                6620
imagick.clampimage.php                             27-Sep-2020 11:03                2372
imagick.clear.php                                  27-Sep-2020 11:03                1858
imagick.clipimage.php                              27-Sep-2020 11:03                2085
imagick.clipimagepath.php                          27-Sep-2020 11:03                2855
imagick.clippathimage.php                          27-Sep-2020 11:03                3076
imagick.clone.php                                  27-Sep-2020 11:03                3954
imagick.clutimage.php                              27-Sep-2020 11:03                5814
imagick.coalesceimages.php                         27-Sep-2020 11:03                2485
imagick.colorfloodfillimage.php                    27-Sep-2020 11:03                4912
imagick.colorizeimage.php                          27-Sep-2020 11:03                6754
imagick.colormatriximage.php                       27-Sep-2020 11:03                8324
imagick.combineimages.php                          27-Sep-2020 11:03                3081
imagick.commentimage.php                           27-Sep-2020 11:03                4788
imagick.compareimagechannels.php                   27-Sep-2020 11:03                3620
imagick.compareimagelayers.php                     27-Sep-2020 11:03                5343
imagick.compareimages.php                          27-Sep-2020 11:03                5442
imagick.compositeimage.php                         27-Sep-2020 11:03                7542
imagick.configuration.php                          27-Sep-2020 11:03                4103
imagick.constants.php                              27-Sep-2020 11:03              132547
imagick.construct.php                              27-Sep-2020 11:03                2608
imagick.contrastimage.php                          27-Sep-2020 11:03                4909
imagick.contraststretchimage.php                   27-Sep-2020 11:03                3456
imagick.convolveimage.php                          27-Sep-2020 11:03                5823
imagick.count.php                                  27-Sep-2020 11:03                2526
imagick.cropimage.php                              27-Sep-2020 11:03                5718
imagick.cropthumbnailimage.php                     27-Sep-2020 11:03                3032
imagick.current.php                                27-Sep-2020 11:03                2160
imagick.cyclecolormapimage.php                     27-Sep-2020 11:03                2660
imagick.decipherimage.php                          27-Sep-2020 11:03                2964
imagick.deconstructimages.php                      27-Sep-2020 11:03                2295
imagick.deleteimageartifact.php                    27-Sep-2020 11:03                3401
imagick.deleteimageproperty.php                    27-Sep-2020 11:03                2376
imagick.deskewimage.php                            27-Sep-2020 11:03               11562
imagick.despeckleimage.php                         27-Sep-2020 11:03                3948
imagick.destroy.php                                27-Sep-2020 11:03                1992
imagick.displayimage.php                           27-Sep-2020 11:03                2461
imagick.displayimages.php                          27-Sep-2020 11:03                2504
imagick.distortimage.php                           27-Sep-2020 11:03               12745
imagick.drawimage.php                              27-Sep-2020 11:03                2371
imagick.edgeimage.php                              27-Sep-2020 11:03                4472
imagick.embossimage.php                            27-Sep-2020 11:03                5127
imagick.encipherimage.php                          27-Sep-2020 11:03                2960
imagick.enhanceimage.php                           27-Sep-2020 11:03                3919
imagick.equalizeimage.php                          27-Sep-2020 11:03                3884
imagick.evaluateimage.php                          27-Sep-2020 11:03                5610
imagick.examples-1.php                             27-Sep-2020 11:03               32475
imagick.examples.php                               27-Sep-2020 11:03                1258
imagick.exportimagepixels.php                      27-Sep-2020 11:03                7414
imagick.extentimage.php                            27-Sep-2020 11:03                4743
imagick.filter.php                                 27-Sep-2020 11:03                7778
imagick.flattenimages.php                          27-Sep-2020 11:03                2465
imagick.flipimage.php                              27-Sep-2020 11:03                3901
imagick.floodfillpaintimage.php                    27-Sep-2020 11:03               11245
imagick.flopimage.php                              27-Sep-2020 11:03                3931
imagick.forwardfouriertransformimage.php           27-Sep-2020 11:03               12906
imagick.frameimage.php                             27-Sep-2020 11:03                8184
imagick.functionimage.php                          27-Sep-2020 11:03               13623
imagick.fximage.php                                27-Sep-2020 11:03                5961
imagick.gammaimage.php                             27-Sep-2020 11:03                5472
imagick.gaussianblurimage.php                      27-Sep-2020 11:03                5961
imagick.getcolorspace.php                          27-Sep-2020 11:03                2101
imagick.getcompression.php                         27-Sep-2020 11:03                1905
imagick.getcompressionquality.php                  27-Sep-2020 11:03                1969
imagick.getcopyright.php                           27-Sep-2020 11:03                1977
imagick.getfilename.php                            27-Sep-2020 11:03                2073
imagick.getfont.php                                27-Sep-2020 11:03                2701
imagick.getformat.php                              27-Sep-2020 11:03                2035
imagick.getgravity.php                             27-Sep-2020 11:03                2103
imagick.gethomeurl.php                             27-Sep-2020 11:03                1854
imagick.getimage.php                               27-Sep-2020 11:03                2143
imagick.getimagealphachannel.php                   27-Sep-2020 11:03                2565
imagick.getimageartifact.php                       27-Sep-2020 11:03                3349
imagick.getimageattribute.php                      27-Sep-2020 11:03                2604
imagick.getimagebackgroundcolor.php                27-Sep-2020 11:03                2275
imagick.getimageblob.php                           27-Sep-2020 11:03                2327
imagick.getimageblueprimary.php                    27-Sep-2020 11:03                2712
imagick.getimagebordercolor.php                    27-Sep-2020 11:03                2240
imagick.getimagechanneldepth.php                   27-Sep-2020 11:03                2805
imagick.getimagechanneldistortion.php              27-Sep-2020 11:03                3699
imagick.getimagechanneldistortions.php             27-Sep-2020 11:03                4019
imagick.getimagechannelextrema.php                 27-Sep-2020 11:03                3308
imagick.getimagechannelkurtosis.php                27-Sep-2020 11:03                3314
imagick.getimagechannelmean.php                    27-Sep-2020 11:03                2996
imagick.getimagechannelrange.php                   27-Sep-2020 11:03                3095
imagick.getimagechannelstatistics.php              27-Sep-2020 11:03                2224
imagick.getimageclipmask.php                       27-Sep-2020 11:03                2678
imagick.getimagecolormapcolor.php                  27-Sep-2020 11:03                2684
imagick.getimagecolors.php                         27-Sep-2020 11:03                2057
imagick.getimagecolorspace.php                     27-Sep-2020 11:03                2028
imagick.getimagecompose.php                        27-Sep-2020 11:03                1988
imagick.getimagecompression.php                    27-Sep-2020 11:03                1987
imagick.getimagecompressionquality.php             27-Sep-2020 11:03                2055
imagick.getimagedelay.php                          27-Sep-2020 11:03                2064
imagick.getimagedepth.php                          27-Sep-2020 11:03                1850
imagick.getimagedispose.php                        27-Sep-2020 11:03                2100
imagick.getimagedistortion.php                     27-Sep-2020 11:03                3030
imagick.getimageextrema.php                        27-Sep-2020 11:03                2512
imagick.getimagefilename.php                       27-Sep-2020 11:03                2170
imagick.getimageformat.php                         27-Sep-2020 11:03                2156
imagick.getimagegamma.php                          27-Sep-2020 11:03                2059
imagick.getimagegeometry.php                       27-Sep-2020 11:03                3765
imagick.getimagegravity.php                        27-Sep-2020 11:03                2370
imagick.getimagegreenprimary.php                   27-Sep-2020 11:03                2311
imagick.getimageheight.php                         27-Sep-2020 11:03                2088
imagick.getimagehistogram.php                      27-Sep-2020 11:03               19413
imagick.getimageindex.php                          27-Sep-2020 11:03                2623
imagick.getimageinterlacescheme.php                27-Sep-2020 11:03                2081
imagick.getimageinterpolatemethod.php              27-Sep-2020 11:03                2335
imagick.getimageiterations.php                     27-Sep-2020 11:03                2138
imagick.getimagelength.php                         27-Sep-2020 11:03                3079
imagick.getimagemagicklicense.php                  27-Sep-2020 11:03                2006
imagick.getimagematte.php                          27-Sep-2020 11:03                2377
imagick.getimagemattecolor.php                     27-Sep-2020 11:03                2479
imagick.getimagemimetype.php                       27-Sep-2020 11:03                2132
imagick.getimageorientation.php                    27-Sep-2020 11:03                2244
imagick.getimagepage.php                           27-Sep-2020 11:03                2319
imagick.getimagepixelcolor.php                     27-Sep-2020 11:03                2888
imagick.getimageprofile.php                        27-Sep-2020 11:03                2519
imagick.getimageprofiles.php                       27-Sep-2020 11:03                3072
imagick.getimageproperties.php                     27-Sep-2020 11:03                5499
imagick.getimageproperty.php                       27-Sep-2020 11:03                4726
imagick.getimageredprimary.php                     27-Sep-2020 11:03                2352
imagick.getimageregion.php                         27-Sep-2020 11:03                3475
imagick.getimagerenderingintent.php                27-Sep-2020 11:03                2256
imagick.getimageresolution.php                     27-Sep-2020 11:03                2142
imagick.getimagesblob.php                          27-Sep-2020 11:03                2167
imagick.getimagescene.php                          27-Sep-2020 11:03                2046
imagick.getimagesignature.php                      27-Sep-2020 11:03                2165
imagick.getimagesize.php                           27-Sep-2020 11:03                2303
imagick.getimagetickspersecond.php                 27-Sep-2020 11:03                2170
imagick.getimagetotalinkdensity.php                27-Sep-2020 11:03                2071
imagick.getimagetype.php                           27-Sep-2020 11:03                3686
imagick.getimageunits.php                          27-Sep-2020 11:03                2104
imagick.getimagevirtualpixelmethod.php             27-Sep-2020 11:03                2233
imagick.getimagewhitepoint.php                     27-Sep-2020 11:03                2299
imagick.getimagewidth.php                          27-Sep-2020 11:03                2064
imagick.getinterlacescheme.php                     27-Sep-2020 11:03                2200
imagick.getiteratorindex.php                       27-Sep-2020 11:03                5822
imagick.getnumberimages.php                        27-Sep-2020 11:03                2151
imagick.getoption.php                              27-Sep-2020 11:03                2503
imagick.getpackagename.php                         27-Sep-2020 11:03                2087
imagick.getpage.php                                27-Sep-2020 11:03                2157
imagick.getpixeliterator.php                       27-Sep-2020 11:03                6509
imagick.getpixelregioniterator.php                 27-Sep-2020 11:03                6507
imagick.getpointsize.php                           27-Sep-2020 11:03                2463
imagick.getquantum.php                             27-Sep-2020 11:03                2117
imagick.getquantumdepth.php                        27-Sep-2020 11:03                2105
imagick.getquantumrange.php                        27-Sep-2020 11:03                2468
imagick.getregistry.php                            27-Sep-2020 11:03                2308
imagick.getreleasedate.php                         27-Sep-2020 11:03                2111
imagick.getresource.php                            27-Sep-2020 11:03                2625
imagick.getresourcelimit.php                       27-Sep-2020 11:03                3044
imagick.getsamplingfactors.php                     27-Sep-2020 11:03                2206
imagick.getsize.php                                27-Sep-2020 11:03                5550
imagick.getsizeoffset.php                          27-Sep-2020 11:03                2198
imagick.getversion.php                             27-Sep-2020 11:03                2111
imagick.haldclutimage.php                          27-Sep-2020 11:03                5977
imagick.hasnextimage.php                           27-Sep-2020 11:03                2130
imagick.haspreviousimage.php                       27-Sep-2020 11:03                2160
imagick.identifyformat.php                         27-Sep-2020 11:03                4329
imagick.identifyimage.php                          27-Sep-2020 11:03                3697
imagick.implodeimage.php                           27-Sep-2020 11:03                4454
imagick.importimagepixels.php                      27-Sep-2020 11:03               11425
imagick.installation.php                           27-Sep-2020 11:03                2007
imagick.inversefouriertransformimage.php           27-Sep-2020 11:03                3188
imagick.labelimage.php                             27-Sep-2020 11:03                2266
imagick.levelimage.php                             27-Sep-2020 11:03                7445
imagick.linearstretchimage.php                     27-Sep-2020 11:03                5500
imagick.liquidrescaleimage.php                     27-Sep-2020 11:03                3957
imagick.listregistry.php                           27-Sep-2020 11:03                2234
imagick.magnifyimage.php                           27-Sep-2020 11:03                3922
imagick.mapimage.php                               27-Sep-2020 11:03                2937
imagick.mattefloodfillimage.php                    27-Sep-2020 11:03                5107
imagick.medianfilterimage.php                      27-Sep-2020 11:03                4944
imagick.mergeimagelayers.php                       27-Sep-2020 11:03                6447
imagick.minifyimage.php                            27-Sep-2020 11:03                1964
imagick.modulateimage.php                          27-Sep-2020 11:03                5353
imagick.montageimage.php                           27-Sep-2020 11:03                3977
imagick.morphimages.php                            27-Sep-2020 11:03                2555
imagick.morphology.php                             27-Sep-2020 11:03               76305
imagick.mosaicimages.php                           27-Sep-2020 11:03                2372
imagick.motionblurimage.php                        27-Sep-2020 11:03                6374
imagick.negateimage.php                            27-Sep-2020 11:03                5320
imagick.newimage.php                               27-Sep-2020 11:03                5774
imagick.newpseudoimage.php                         27-Sep-2020 11:03                5552
imagick.nextimage.php                              27-Sep-2020 11:03                1900
imagick.normalizeimage.php                         27-Sep-2020 11:03                6322
imagick.oilpaintimage.php                          27-Sep-2020 11:03                4411
imagick.opaquepaintimage.php                       27-Sep-2020 11:03                4403
imagick.optimizeimagelayers.php                    27-Sep-2020 11:03                5018
imagick.orderedposterizeimage.php                  27-Sep-2020 11:03                6633
imagick.paintfloodfillimage.php                    27-Sep-2020 11:03                5101
imagick.paintopaqueimage.php                       27-Sep-2020 11:03                4942
imagick.painttransparentimage.php                  27-Sep-2020 11:03                4283
imagick.pingimage.php                              27-Sep-2020 11:03                2389
imagick.pingimageblob.php                          27-Sep-2020 11:03                5880
imagick.pingimagefile.php                          27-Sep-2020 11:03                5561
imagick.polaroidimage.php                          27-Sep-2020 11:03                4538
imagick.posterizeimage.php                         27-Sep-2020 11:03                5432
imagick.previewimages.php                          27-Sep-2020 11:03                2784
imagick.previousimage.php                          27-Sep-2020 11:03                1946
imagick.profileimage.php                           27-Sep-2020 11:03                2878
imagick.quantizeimage.php                          27-Sep-2020 11:03                6215
imagick.quantizeimages.php                         27-Sep-2020 11:03                3363
imagick.queryfontmetrics.php                       27-Sep-2020 11:03                5384
imagick.queryfonts.php                             27-Sep-2020 11:03                4824
imagick.queryformats.php                           27-Sep-2020 11:03                8047
imagick.radialblurimage.php                        27-Sep-2020 11:03                5385
imagick.raiseimage.php                             27-Sep-2020 11:03                6070
imagick.randomthresholdimage.php                   27-Sep-2020 11:03                6302
imagick.readimage.php                              27-Sep-2020 11:03                2237
imagick.readimageblob.php                          27-Sep-2020 11:03                5243
imagick.readimagefile.php                          27-Sep-2020 11:03                2763
imagick.readimages.php                             27-Sep-2020 11:03                2325
imagick.recolorimage.php                           27-Sep-2020 11:03                6506
imagick.reducenoiseimage.php                       27-Sep-2020 11:03                4995
imagick.remapimage.php                             27-Sep-2020 11:03                3185
imagick.removeimage.php                            27-Sep-2020 11:03                2087
imagick.removeimageprofile.php                     27-Sep-2020 11:03                2511
imagick.render.php                                 27-Sep-2020 11:03                1869
imagick.requirements.php                           27-Sep-2020 11:03                1845
imagick.resampleimage.php                          27-Sep-2020 11:03                5184
imagick.resetimagepage.php                         27-Sep-2020 11:03                2502
imagick.resizeimage.php                            27-Sep-2020 11:03               11476
imagick.resources.php                              27-Sep-2020 11:03                1087
imagick.rollimage.php                              27-Sep-2020 11:03                4573
imagick.rotateimage.php                            27-Sep-2020 11:03                5513
imagick.rotationalblurimage.php                    27-Sep-2020 11:03                5523
imagick.roundcorners.php                           27-Sep-2020 11:03                6006
imagick.sampleimage.php                            27-Sep-2020 11:03                2604
imagick.scaleimage.php                             27-Sep-2020 11:03                6368
imagick.segmentimage.php                           27-Sep-2020 11:03                6410
imagick.selectiveblurimage.php                     27-Sep-2020 11:03                6141
imagick.separateimagechannel.php                   27-Sep-2020 11:03                5191
imagick.sepiatoneimage.php                         27-Sep-2020 11:03                4688
imagick.setbackgroundcolor.php                     27-Sep-2020 11:03                2993
imagick.setcolorspace.php                          27-Sep-2020 11:03                2722
imagick.setcompression.php                         27-Sep-2020 11:03                2445
imagick.setcompressionquality.php                  27-Sep-2020 11:03                7192
imagick.setfilename.php                            27-Sep-2020 11:03                2316
imagick.setfirstiterator.php                       27-Sep-2020 11:03                1935
imagick.setfont.php                                27-Sep-2020 11:03                5378
imagick.setformat.php                              27-Sep-2020 11:03                2220
imagick.setgravity.php                             27-Sep-2020 11:03                2482
imagick.setimage.php                               27-Sep-2020 11:03                4553
imagick.setimagealphachannel.php                   27-Sep-2020 11:03                3377
imagick.setimageartifact.php                       27-Sep-2020 11:03                7273
imagick.setimageattribute.php                      27-Sep-2020 11:03                2997
imagick.setimagebackgroundcolor.php                27-Sep-2020 11:03                3217
imagick.setimagebias.php                           27-Sep-2020 11:03                6877
imagick.setimagebiasquantum.php                    27-Sep-2020 11:03                2751
imagick.setimageblueprimary.php                    27-Sep-2020 11:03                2775
imagick.setimagebordercolor.php                    27-Sep-2020 11:03                3199
imagick.setimagechanneldepth.php                   27-Sep-2020 11:03                2791
imagick.setimageclipmask.php                       27-Sep-2020 11:03                9261
imagick.setimagecolormapcolor.php                  27-Sep-2020 11:03                2871
imagick.setimagecolorspace.php                     27-Sep-2020 11:03                2887
imagick.setimagecompose.php                        27-Sep-2020 11:03                2609
imagick.setimagecompression.php                    27-Sep-2020 11:03                2577
imagick.setimagecompressionquality.php             27-Sep-2020 11:03                4704
imagick.setimagedelay.php                          27-Sep-2020 11:03                6142
imagick.setimagedepth.php                          27-Sep-2020 11:03                2429
imagick.setimagedispose.php                        27-Sep-2020 11:03                2471
imagick.setimageextent.php                         27-Sep-2020 11:03                2697
imagick.setimagefilename.php                       27-Sep-2020 11:03                2520
imagick.setimageformat.php                         27-Sep-2020 11:03                2414
imagick.setimagegamma.php                          27-Sep-2020 11:03                2433
imagick.setimagegravity.php                        27-Sep-2020 11:03                2642
imagick.setimagegreenprimary.php                   27-Sep-2020 11:03                2767
imagick.setimageindex.php                          27-Sep-2020 11:03                3043
imagick.setimageinterlacescheme.php                27-Sep-2020 11:03                2583
imagick.setimageinterpolatemethod.php              27-Sep-2020 11:03                2508
imagick.setimageiterations.php                     27-Sep-2020 11:03                4723
imagick.setimagematte.php                          27-Sep-2020 11:03                2438
imagick.setimagemattecolor.php                     27-Sep-2020 11:03                3425
imagick.setimageopacity.php                        27-Sep-2020 11:03                4808
imagick.setimageorientation.php                    27-Sep-2020 11:03                4534
imagick.setimagepage.php                           27-Sep-2020 11:03                3125
imagick.setimageprofile.php                        27-Sep-2020 11:03                2911
imagick.setimageproperty.php                       27-Sep-2020 11:03                4841
imagick.setimageredprimary.php                     27-Sep-2020 11:03                2765
imagick.setimagerenderingintent.php                27-Sep-2020 11:03                2589
imagick.setimageresolution.php                     27-Sep-2020 11:03                4767
imagick.setimagescene.php                          27-Sep-2020 11:03                2453
imagick.setimagetickspersecond.php                 27-Sep-2020 11:03                8124
imagick.setimagetype.php                           27-Sep-2020 11:03                2252
imagick.setimageunits.php                          27-Sep-2020 11:03                2287
imagick.setimagevirtualpixelmethod.php             27-Sep-2020 11:03                2394
imagick.setimagewhitepoint.php                     27-Sep-2020 11:03                2763
imagick.setinterlacescheme.php                     27-Sep-2020 11:03                2330
imagick.setiteratorindex.php                       27-Sep-2020 11:03                6032
imagick.setlastiterator.php                        27-Sep-2020 11:03                1939
imagick.setoption.php                              27-Sep-2020 11:03               12749
imagick.setpage.php                                27-Sep-2020 11:03                2883
imagick.setpointsize.php                           27-Sep-2020 11:03                5068
imagick.setprogressmonitor.php                     27-Sep-2020 11:03               12654
imagick.setregistry.php                            27-Sep-2020 11:03                2715
imagick.setresolution.php                          27-Sep-2020 11:03                3408
imagick.setresourcelimit.php                       27-Sep-2020 11:03                3273
imagick.setsamplingfactors.php                     27-Sep-2020 11:03                6969
imagick.setsize.php                                27-Sep-2020 11:03                2522
imagick.setsizeoffset.php                          27-Sep-2020 11:03                2975
imagick.settype.php                                27-Sep-2020 11:03                2203
imagick.setup.php                                  27-Sep-2020 11:03                1488
imagick.shadeimage.php                             27-Sep-2020 11:03                5357
imagick.shadowimage.php                            27-Sep-2020 11:03                4997
imagick.sharpenimage.php                           27-Sep-2020 11:03                5341
imagick.shaveimage.php                             27-Sep-2020 11:03                4504
imagick.shearimage.php                             27-Sep-2020 11:03                6254
imagick.sigmoidalcontrastimage.php                 27-Sep-2020 11:03                7535
imagick.sketchimage.php                            27-Sep-2020 11:03                5574
imagick.smushimages.php                            27-Sep-2020 11:03                5748
imagick.solarizeimage.php                          27-Sep-2020 11:03                4664
imagick.sparsecolorimage.php                       27-Sep-2020 11:03               31192
imagick.spliceimage.php                            27-Sep-2020 11:03                5385
imagick.spreadimage.php                            27-Sep-2020 11:03                4466
imagick.statisticimage.php                         27-Sep-2020 11:03                6537
imagick.steganoimage.php                           27-Sep-2020 11:03                2786
imagick.stereoimage.php                            27-Sep-2020 11:03                2564
imagick.stripimage.php                             27-Sep-2020 11:03                2086
imagick.subimagematch.php                          27-Sep-2020 11:03                7526
imagick.swirlimage.php                             27-Sep-2020 11:03                4555
imagick.textureimage.php                           27-Sep-2020 11:03                6275
imagick.thresholdimage.php                         27-Sep-2020 11:03                5041
imagick.thumbnailimage.php                         27-Sep-2020 11:03                6803
imagick.tintimage.php                              27-Sep-2020 11:03                7797
imagick.tostring.php                               27-Sep-2020 11:03                2813
imagick.transformimage.php                         27-Sep-2020 11:03                5855
imagick.transformimagecolorspace.php               27-Sep-2020 11:03                8070
imagick.transparentpaintimage.php                  27-Sep-2020 11:03                7069
imagick.transposeimage.php                         27-Sep-2020 11:03                4301
imagick.transverseimage.php                        27-Sep-2020 11:03                4289
imagick.trimimage.php                              27-Sep-2020 11:03                5561
imagick.uniqueimagecolors.php                      27-Sep-2020 11:03                5342
imagick.unsharpmaskimage.php                       27-Sep-2020 11:03                6195
imagick.valid.php                                  27-Sep-2020 11:03                1851
imagick.vignetteimage.php                          27-Sep-2020 11:03                6197
imagick.waveimage.php                              27-Sep-2020 11:03                6161
imagick.whitethresholdimage.php                    27-Sep-2020 11:03                5067
imagick.writeimage.php                             27-Sep-2020 11:03                2693
imagick.writeimagefile.php                         27-Sep-2020 11:03                2630
imagick.writeimages.php                            27-Sep-2020 11:03                2493
imagick.writeimagesfile.php                        27-Sep-2020 11:03                2678
imagickdraw.affine.php                             27-Sep-2020 11:03               18543
imagickdraw.annotation.php                         27-Sep-2020 11:03                2937
imagickdraw.arc.php                                27-Sep-2020 11:03                9583
imagickdraw.bezier.php                             27-Sep-2020 11:03               19465
imagickdraw.circle.php                             27-Sep-2020 11:03                8989
imagickdraw.clear.php                              27-Sep-2020 11:03                2078
imagickdraw.clone.php                              27-Sep-2020 11:03                2192
imagickdraw.color.php                              27-Sep-2020 11:03                2977
imagickdraw.comment.php                            27-Sep-2020 11:03                2426
imagickdraw.composite.php                          27-Sep-2020 11:03               11741
imagickdraw.construct.php                          27-Sep-2020 11:03                2002
imagickdraw.destroy.php                            27-Sep-2020 11:03                2048
imagickdraw.ellipse.php                            27-Sep-2020 11:03               12175
imagickdraw.getclippath.php                        27-Sep-2020 11:03                2124
imagickdraw.getcliprule.php                        27-Sep-2020 11:03                2127
imagickdraw.getclipunits.php                       27-Sep-2020 11:03                2106
imagickdraw.getfillcolor.php                       27-Sep-2020 11:03                2175
imagickdraw.getfillopacity.php                     27-Sep-2020 11:03                2157
imagickdraw.getfillrule.php                        27-Sep-2020 11:03                2079
imagickdraw.getfont.php                            27-Sep-2020 11:03                2095
imagickdraw.getfontfamily.php                      27-Sep-2020 11:03                2149
imagickdraw.getfontsize.php                        27-Sep-2020 11:03                2144
imagickdraw.getfontstretch.php                     27-Sep-2020 11:03                2197
imagickdraw.getfontstyle.php                       27-Sep-2020 11:03                2181
imagickdraw.getfontweight.php                      27-Sep-2020 11:03                2125
imagickdraw.getgravity.php                         27-Sep-2020 11:03                2155
imagickdraw.getstrokeantialias.php                 27-Sep-2020 11:03                2409
imagickdraw.getstrokecolor.php                     27-Sep-2020 11:03                2568
imagickdraw.getstrokedasharray.php                 27-Sep-2020 11:03                2280
imagickdraw.getstrokedashoffset.php                27-Sep-2020 11:03                2253
imagickdraw.getstrokelinecap.php                   27-Sep-2020 11:03                2279
imagickdraw.getstrokelinejoin.php                  27-Sep-2020 11:03                2305
imagickdraw.getstrokemiterlimit.php                27-Sep-2020 11:03                2515
imagickdraw.getstrokeopacity.php                   27-Sep-2020 11:03                2176
imagickdraw.getstrokewidth.php                     27-Sep-2020 11:03                2191
imagickdraw.gettextalignment.php                   27-Sep-2020 11:03                2178
imagickdraw.gettextantialias.php                   27-Sep-2020 11:03                2292
imagickdraw.gettextdecoration.php                  27-Sep-2020 11:03                2203
imagickdraw.gettextencoding.php                    27-Sep-2020 11:03                2249
imagickdraw.gettextinterlinespacing.php            27-Sep-2020 11:03                2263
imagickdraw.gettextinterwordspacing.php            27-Sep-2020 11:03                2263
imagickdraw.gettextkerning.php                     27-Sep-2020 11:03                2177
imagickdraw.gettextundercolor.php                  27-Sep-2020 11:03                2273
imagickdraw.getvectorgraphics.php                  27-Sep-2020 11:03                2260
imagickdraw.line.php                               27-Sep-2020 11:03                8165
imagickdraw.matte.php                              27-Sep-2020 11:03                8117
imagickdraw.pathclose.php                          27-Sep-2020 11:03                2254
imagickdraw.pathcurvetoabsolute.php                27-Sep-2020 11:03                4197
imagickdraw.pathcurvetoquadraticbezierabsolute.php 27-Sep-2020 11:03               11950
imagickdraw.pathcurvetoquadraticbezierrelative.php 27-Sep-2020 11:03                3717
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 27-Sep-2020 11:03               10633
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 27-Sep-2020 11:03               10765
imagickdraw.pathcurvetorelative.php                27-Sep-2020 11:03                4213
imagickdraw.pathcurvetosmoothabsolute.php          27-Sep-2020 11:03                4098
imagickdraw.pathcurvetosmoothrelative.php          27-Sep-2020 11:03                4105
imagickdraw.pathellipticarcabsolute.php            27-Sep-2020 11:03                4771
imagickdraw.pathellipticarcrelative.php            27-Sep-2020 11:03                4741
imagickdraw.pathfinish.php                         27-Sep-2020 11:03                2086
imagickdraw.pathlinetoabsolute.php                 27-Sep-2020 11:03                2887
imagickdraw.pathlinetohorizontalabsolute.php       27-Sep-2020 11:03                2761
imagickdraw.pathlinetohorizontalrelative.php       27-Sep-2020 11:03                2756
imagickdraw.pathlinetorelative.php                 27-Sep-2020 11:03                2921
imagickdraw.pathlinetoverticalabsolute.php         27-Sep-2020 11:03                2727
imagickdraw.pathlinetoverticalrelative.php         27-Sep-2020 11:03                2732
imagickdraw.pathmovetoabsolute.php                 27-Sep-2020 11:03                2918
imagickdraw.pathmovetorelative.php                 27-Sep-2020 11:03                2854
imagickdraw.pathstart.php                          27-Sep-2020 11:03               12347
imagickdraw.point.php                              27-Sep-2020 11:03                6911
imagickdraw.polygon.php                            27-Sep-2020 11:03                9339
imagickdraw.polyline.php                           27-Sep-2020 11:03                9332
imagickdraw.pop.php                                27-Sep-2020 11:03                2362
imagickdraw.popclippath.php                        27-Sep-2020 11:03                2044
imagickdraw.popdefs.php                            27-Sep-2020 11:03                7979
imagickdraw.poppattern.php                         27-Sep-2020 11:03                2117
imagickdraw.push.php                               27-Sep-2020 11:03                8501
imagickdraw.pushclippath.php                       27-Sep-2020 11:03                2555
imagickdraw.pushdefs.php                           27-Sep-2020 11:03                2257
imagickdraw.pushpattern.php                        27-Sep-2020 11:03               14920
imagickdraw.rectangle.php                          27-Sep-2020 11:03                8401
imagickdraw.render.php                             27-Sep-2020 11:03                2163
imagickdraw.resetvectorgraphics.php                27-Sep-2020 11:03                2224
imagickdraw.rotate.php                             27-Sep-2020 11:03                7851
imagickdraw.roundrectangle.php                     27-Sep-2020 11:03                9062
imagickdraw.scale.php                              27-Sep-2020 11:03                8154
imagickdraw.setclippath.php                        27-Sep-2020 11:03                8587
imagickdraw.setcliprule.php                        27-Sep-2020 11:03                9550
imagickdraw.setclipunits.php                       27-Sep-2020 11:03                9036
imagickdraw.setfillalpha.php                       27-Sep-2020 11:03                7862
imagickdraw.setfillcolor.php                       27-Sep-2020 11:03                7937
imagickdraw.setfillopacity.php                     27-Sep-2020 11:03                7923
imagickdraw.setfillpatternurl.php                  27-Sep-2020 11:03                2852
imagickdraw.setfillrule.php                        27-Sep-2020 11:03               14497
imagickdraw.setfont.php                            27-Sep-2020 11:03                9452
imagickdraw.setfontfamily.php                      27-Sep-2020 11:03               10148
imagickdraw.setfontsize.php                        27-Sep-2020 11:03                8524
imagickdraw.setfontstretch.php                     27-Sep-2020 11:03               10210
imagickdraw.setfontstyle.php                       27-Sep-2020 11:03                9024
imagickdraw.setfontweight.php                      27-Sep-2020 11:03                9362
imagickdraw.setgravity.php                         27-Sep-2020 11:03               11121
imagickdraw.setresolution.php                      27-Sep-2020 11:03                2590
imagickdraw.setstrokealpha.php                     27-Sep-2020 11:03                8570
imagickdraw.setstrokeantialias.php                 27-Sep-2020 11:03                9124
imagickdraw.setstrokecolor.php                     27-Sep-2020 11:03                8687
imagickdraw.setstrokedasharray.php                 27-Sep-2020 11:03               13788
imagickdraw.setstrokedashoffset.php                27-Sep-2020 11:03               10196
imagickdraw.setstrokelinecap.php                   27-Sep-2020 11:03                8707
imagickdraw.setstrokelinejoin.php                  27-Sep-2020 11:03               12285
imagickdraw.setstrokemiterlimit.php                27-Sep-2020 11:03               12020
imagickdraw.setstrokeopacity.php                   27-Sep-2020 11:03               10494
imagickdraw.setstrokepatternurl.php                27-Sep-2020 11:03                2593
imagickdraw.setstrokewidth.php                     27-Sep-2020 11:03                8601
imagickdraw.settextalignment.php                   27-Sep-2020 11:03                9501
imagickdraw.settextantialias.php                   27-Sep-2020 11:03                9103
imagickdraw.settextdecoration.php                  27-Sep-2020 11:03                7386
imagickdraw.settextencoding.php                    27-Sep-2020 11:03                2852
imagickdraw.settextinterlinespacing.php            27-Sep-2020 11:03                2642
imagickdraw.settextinterwordspacing.php            27-Sep-2020 11:03                2466
imagickdraw.settextkerning.php                     27-Sep-2020 11:03                2554
imagickdraw.settextundercolor.php                  27-Sep-2020 11:03                7944
imagickdraw.setvectorgraphics.php                  27-Sep-2020 11:03                9220
imagickdraw.setviewbox.php                         27-Sep-2020 11:03               10640
imagickdraw.skewx.php                              27-Sep-2020 11:03                8364
imagickdraw.skewy.php                              27-Sep-2020 11:03                8353
imagickdraw.translate.php                          27-Sep-2020 11:03                8647
imagickkernel.addkernel.php                        27-Sep-2020 11:03                7529
imagickkernel.addunitykernel.php                   27-Sep-2020 11:03               15870
imagickkernel.frombuiltin.php                      27-Sep-2020 11:03               29585
imagickkernel.frommatrix.php                       27-Sep-2020 11:03               25923
imagickkernel.getmatrix.php                        27-Sep-2020 11:03                8156
imagickkernel.scale.php                            27-Sep-2020 11:03               15049
imagickkernel.separate.php                         27-Sep-2020 11:03               11682
imagickpixel.clear.php                             27-Sep-2020 11:03                2142
imagickpixel.construct.php                         27-Sep-2020 11:03               13645
imagickpixel.destroy.php                           27-Sep-2020 11:03                2229
imagickpixel.getcolor.php                          27-Sep-2020 11:03                5950
imagickpixel.getcolorasstring.php                  27-Sep-2020 11:03                4695
imagickpixel.getcolorcount.php                     27-Sep-2020 11:03                4689
imagickpixel.getcolorquantum.php                   27-Sep-2020 11:03                2686
imagickpixel.getcolorvalue.php                     27-Sep-2020 11:03                8565
imagickpixel.getcolorvaluequantum.php              27-Sep-2020 11:03                6487
imagickpixel.gethsl.php                            27-Sep-2020 11:03                4001
imagickpixel.getindex.php                          27-Sep-2020 11:03                2117
imagickpixel.ispixelsimilar.php                    27-Sep-2020 11:03                3342
imagickpixel.ispixelsimilarquantum.php             27-Sep-2020 11:03                2869
imagickpixel.issimilar.php                         27-Sep-2020 11:03               22671
imagickpixel.setcolor.php                          27-Sep-2020 11:03                7518
imagickpixel.setcolorcount.php                     27-Sep-2020 11:03                2380
imagickpixel.setcolorvalue.php                     27-Sep-2020 11:03                4787
imagickpixel.setcolorvaluequantum.php              27-Sep-2020 11:03                8456
imagickpixel.sethsl.php                            27-Sep-2020 11:03                7342
imagickpixel.setindex.php                          27-Sep-2020 11:03                2308
imagickpixeliterator.clear.php                     27-Sep-2020 11:03                7078
imagickpixeliterator.construct.php                 27-Sep-2020 11:03                6753
imagickpixeliterator.destroy.php                   27-Sep-2020 11:03                2262
imagickpixeliterator.getcurrentiteratorrow.php     27-Sep-2020 11:03                2407
imagickpixeliterator.getiteratorrow.php            27-Sep-2020 11:03                2339
imagickpixeliterator.getnextiteratorrow.php        27-Sep-2020 11:03                7873
imagickpixeliterator.getpreviousiteratorrow.php    27-Sep-2020 11:03                2475
imagickpixeliterator.newpixeliterator.php          27-Sep-2020 11:03                2469
imagickpixeliterator.newpixelregioniterator.php    27-Sep-2020 11:03                3696
imagickpixeliterator.resetiterator.php             27-Sep-2020 11:03               10363
imagickpixeliterator.setiteratorfirstrow.php       27-Sep-2020 11:03                2344
imagickpixeliterator.setiteratorlastrow.php        27-Sep-2020 11:03                2338
imagickpixeliterator.setiteratorrow.php            27-Sep-2020 11:03                7710
imagickpixeliterator.synciterator.php              27-Sep-2020 11:03                2199
imap.configuration.php                             27-Sep-2020 11:03                3119
imap.constants.php                                 27-Sep-2020 11:03               21874
imap.installation.php                              27-Sep-2020 11:03                2529
imap.requirements.php                              27-Sep-2020 11:03                2917
imap.resources.php                                 27-Sep-2020 11:03                1225
imap.setup.php                                     27-Sep-2020 11:03                1460
index.php                                          27-Sep-2020 11:03               13471
indexes.examples.php                               27-Sep-2020 11:03              784966
indexes.functions.php                              27-Sep-2020 11:03             1250357
indexes.php                                        27-Sep-2020 11:03                1334
infiniteiterator.construct.php                     27-Sep-2020 11:03                5508
infiniteiterator.next.php                          27-Sep-2020 11:03                3063
info.configuration.php                             27-Sep-2020 11:02               19856
info.constants.php                                 27-Sep-2020 11:02               15417
info.installation.php                              27-Sep-2020 11:02                1107
info.requirements.php                              27-Sep-2020 11:02                1071
info.resources.php                                 27-Sep-2020 11:02                1069
info.setup.php                                     27-Sep-2020 11:02                1448
ingres.configuration.php                           27-Sep-2020 11:03               14828
ingres.constants.php                               27-Sep-2020 11:03               23270
ingres.examples-basic.php                          27-Sep-2020 11:03                6029
ingres.examples.php                                27-Sep-2020 11:03                1253
ingres.installation.php                            27-Sep-2020 11:03                4228
ingres.requirements.php                            27-Sep-2020 11:03                1284
ingres.resources.php                               27-Sep-2020 11:03                1592
ingres.setup.php                                   27-Sep-2020 11:03                1482
ini.core.php                                       27-Sep-2020 11:03               88014
ini.list.php                                       27-Sep-2020 11:03              134714
ini.php                                            27-Sep-2020 11:03                1450
ini.sect.safe-mode.php                             27-Sep-2020 11:02               12786
ini.sections.php                                   27-Sep-2020 11:03                3891
inotify.configuration.php                          27-Sep-2020 11:03                1147
inotify.constants.php                              27-Sep-2020 11:03                9178
inotify.install.php                                27-Sep-2020 11:03                1626
inotify.requirements.php                           27-Sep-2020 11:03                1109
inotify.resources.php                              27-Sep-2020 11:03                1207
inotify.setup.php                                  27-Sep-2020 11:03                1488
install.cloud.azure.php                            27-Sep-2020 11:02                3839
install.cloud.ec2.php                              27-Sep-2020 11:02                1312
install.cloud.php                                  27-Sep-2020 11:02                1504
install.fpm.configuration.php                      27-Sep-2020 11:02               30112
install.fpm.install.php                            27-Sep-2020 11:02                2171
install.fpm.php                                    27-Sep-2020 11:02                3379
install.general.php                                27-Sep-2020 11:02                4254
install.macosx.bundled.php                         27-Sep-2020 11:02                9934
install.macosx.compile.php                         27-Sep-2020 11:02                1190
install.macosx.packages.php                        27-Sep-2020 11:02                2569
install.macosx.php                                 27-Sep-2020 11:02                1716
install.pecl.downloads.php                         27-Sep-2020 11:02                3291
install.pecl.intro.php                             27-Sep-2020 11:02                2949
install.pecl.pear.php                              27-Sep-2020 11:02                2824
install.pecl.php                                   27-Sep-2020 11:02                1874
install.pecl.php-config.php                        27-Sep-2020 11:02                3694
install.pecl.phpize.php                            27-Sep-2020 11:02                2904
install.pecl.static.php                            27-Sep-2020 11:02                2965
install.pecl.windows.php                           27-Sep-2020 11:02                8976
install.php                                        27-Sep-2020 11:02                5400
install.problems.bugs.php                          27-Sep-2020 11:02                1729
install.problems.faq.php                           27-Sep-2020 11:02                1195
install.problems.php                               27-Sep-2020 11:02                1445
install.problems.support.php                       27-Sep-2020 11:02                2257
install.unix.apache.php                            27-Sep-2020 11:02               12002
install.unix.apache2.php                           27-Sep-2020 11:02               12524
install.unix.commandline.php                       27-Sep-2020 11:02                3650
install.unix.debian.php                            27-Sep-2020 11:02                6672
install.unix.hpux.php                              27-Sep-2020 11:02                1884
install.unix.lighttpd-14.php                       27-Sep-2020 11:02                5891
install.unix.litespeed.php                         27-Sep-2020 11:02                8897
install.unix.nginx.php                             27-Sep-2020 11:02                8235
install.unix.openbsd.php                           27-Sep-2020 11:02                5939
install.unix.php                                   27-Sep-2020 11:02                7893
install.unix.solaris.php                           27-Sep-2020 11:02                3760
install.unix.sun.php                               27-Sep-2020 11:02               17146
install.windows.legacy.index.php                   27-Sep-2020 11:02               98648
install.windows.manual.php                         27-Sep-2020 11:02                5553
install.windows.pecl.php                           27-Sep-2020 11:02                1455
install.windows.php                                27-Sep-2020 11:02                3216
install.windows.recommended.php                    27-Sep-2020 11:02                4529
install.windows.requirements.php                   27-Sep-2020 11:02                3126
install.windows.tools.php                          27-Sep-2020 11:02                1888
install.windows.troubleshooting.php                27-Sep-2020 11:02                1572
internals2.apiref.php                              27-Sep-2020 11:03                1047
internals2.buildsys.configunix.php                 27-Sep-2020 11:03               20179
internals2.buildsys.configwin.php                  27-Sep-2020 11:03                4484
internals2.buildsys.environment.php                27-Sep-2020 11:03                2459
internals2.buildsys.php                            27-Sep-2020 11:03                2218
internals2.buildsys.skeleton.php                   27-Sep-2020 11:03                4238
internals2.classes.php                             27-Sep-2020 11:03                1039
internals2.counter.basic-interface.php             27-Sep-2020 11:03                1803
internals2.counter.constants.php                   27-Sep-2020 11:03                4139
internals2.counter.counter-class.bumpvalue.php     27-Sep-2020 11:03                2949
internals2.counter.counter-class.construct.php     27-Sep-2020 11:03                3438
internals2.counter.counter-class.getmeta.php       27-Sep-2020 11:03                2756
internals2.counter.counter-class.getnamed.php      27-Sep-2020 11:03                2871
internals2.counter.counter-class.getvalue.php      27-Sep-2020 11:03                2797
internals2.counter.counter-class.php               27-Sep-2020 11:03                5638
internals2.counter.counter-class.resetvalue.php    27-Sep-2020 11:03                2575
internals2.counter.counter-class.setcounterclas..> 27-Sep-2020 11:03                2898
internals2.counter.examples.basic.php              27-Sep-2020 11:03                3178
internals2.counter.examples.extended.php           27-Sep-2020 11:03                8800
internals2.counter.examples.objective.php          27-Sep-2020 11:03                8024
internals2.counter.examples.php                    27-Sep-2020 11:03                1590
internals2.counter.extended-interface.php          27-Sep-2020 11:03                2303
internals2.counter.function.counter-bump-value.php 27-Sep-2020 11:03                3403
internals2.counter.function.counter-bump.php       27-Sep-2020 11:03                2992
internals2.counter.function.counter-create.php     27-Sep-2020 11:03                3110
internals2.counter.function.counter-get-meta.php   27-Sep-2020 11:03                3120
internals2.counter.function.counter-get-named.php  27-Sep-2020 11:03                2847
internals2.counter.function.counter-get-value.php  27-Sep-2020 11:03                3314
internals2.counter.function.counter-get.php        27-Sep-2020 11:03                2755
internals2.counter.function.counter-reset-value..> 27-Sep-2020 11:03                3100
internals2.counter.function.counter-reset.php      27-Sep-2020 11:03                2553
internals2.counter.ini.php                         27-Sep-2020 11:03                3799
internals2.counter.intro.php                       27-Sep-2020 11:03                1770
internals2.counter.php                             27-Sep-2020 11:03                2571
internals2.counter.resources.php                   27-Sep-2020 11:03                1193
internals2.counter.setup.php                       27-Sep-2020 11:03                1579
internals2.faq.php                                 27-Sep-2020 11:03                1041
internals2.funcs.php                               27-Sep-2020 11:03               13712
internals2.ini.php                                 27-Sep-2020 11:03                1056
internals2.memory.management.php                   27-Sep-2020 11:03                8359
internals2.memory.persistence.php                  27-Sep-2020 11:03                5065
internals2.memory.php                              27-Sep-2020 11:03                1707
internals2.memory.tsrm.php                         27-Sep-2020 11:03                8743
internals2.opcodes.add-array-element.php           27-Sep-2020 11:03                3889
internals2.opcodes.add-char.php                    27-Sep-2020 11:03                3046
internals2.opcodes.add-interface.php               27-Sep-2020 11:03                3510
internals2.opcodes.add-string.php                  27-Sep-2020 11:03                3255
internals2.opcodes.add-var.php                     27-Sep-2020 11:03                3261
internals2.opcodes.add.php                         27-Sep-2020 11:03                2828
internals2.opcodes.assign-add.php                  27-Sep-2020 11:03                2615
internals2.opcodes.assign-bw-and.php               27-Sep-2020 11:03                2697
internals2.opcodes.assign-bw-or.php                27-Sep-2020 11:03                2693
internals2.opcodes.assign-bw-xor.php               27-Sep-2020 11:03                2693
internals2.opcodes.assign-concat.php               27-Sep-2020 11:03                2699
internals2.opcodes.assign-dim.php                  27-Sep-2020 11:03                3441
internals2.opcodes.assign-div.php                  27-Sep-2020 11:03                2615
internals2.opcodes.assign-mod.php                  27-Sep-2020 11:03                2634
internals2.opcodes.assign-mul.php                  27-Sep-2020 11:03                2622
internals2.opcodes.assign-obj.php                  27-Sep-2020 11:03                2847
internals2.opcodes.assign-ref.php                  27-Sep-2020 11:03                2883
internals2.opcodes.assign-sl.php                   27-Sep-2020 11:03                2657
internals2.opcodes.assign-sr.php                   27-Sep-2020 11:03                2658
internals2.opcodes.assign-sub.php                  27-Sep-2020 11:03                2628
internals2.opcodes.assign.php                      27-Sep-2020 11:03                3812
internals2.opcodes.begin-silence.php               27-Sep-2020 11:03                5199
internals2.opcodes.bool-not.php                    27-Sep-2020 11:03                2676
internals2.opcodes.bool-xor.php                    27-Sep-2020 11:03                2762
internals2.opcodes.bool.php                        27-Sep-2020 11:03                4059
internals2.opcodes.brk.php                         27-Sep-2020 11:03                4064
internals2.opcodes.bw-and.php                      27-Sep-2020 11:03                2741
internals2.opcodes.bw-not.php                      27-Sep-2020 11:03                2648
internals2.opcodes.bw-or.php                       27-Sep-2020 11:03                2734
internals2.opcodes.bw-xor.php                      27-Sep-2020 11:03                2737
internals2.opcodes.case.php                        27-Sep-2020 11:03                6525
internals2.opcodes.cast.php                        27-Sep-2020 11:03                2662
internals2.opcodes.catch.php                       27-Sep-2020 11:03                6981
internals2.opcodes.clone.php                       27-Sep-2020 11:03                3647
internals2.opcodes.concat.php                      27-Sep-2020 11:03                2800
internals2.opcodes.cont.php                        27-Sep-2020 11:03                3835
internals2.opcodes.declare-class.php               27-Sep-2020 11:03                3717
internals2.opcodes.declare-const.php               27-Sep-2020 11:03                1592
internals2.opcodes.declare-function.php            27-Sep-2020 11:03                3223
internals2.opcodes.declare-inherited-class-dela..> 27-Sep-2020 11:03                1676
internals2.opcodes.declare-inherited-class.php     27-Sep-2020 11:03                7224
internals2.opcodes.div.php                         27-Sep-2020 11:03                2827
internals2.opcodes.do-fcall-by-name.php            27-Sep-2020 11:03                3511
internals2.opcodes.do-fcall.php                    27-Sep-2020 11:03                2822
internals2.opcodes.echo.php                        27-Sep-2020 11:03                2496
internals2.opcodes.end-silence.php                 27-Sep-2020 11:03                5068
internals2.opcodes.exit.php                        27-Sep-2020 11:03                2517
internals2.opcodes.ext-fcall-begin.php             27-Sep-2020 11:03                1578
internals2.opcodes.ext-fcall-end.php               27-Sep-2020 11:03                1578
internals2.opcodes.ext-nop.php                     27-Sep-2020 11:03                1546
internals2.opcodes.ext-stmt.php                    27-Sep-2020 11:03                2348
internals2.opcodes.fe-fetch.php                    27-Sep-2020 11:03                5281
internals2.opcodes.fe-reset.php                    27-Sep-2020 11:03                5290
internals2.opcodes.fetch-class.php                 27-Sep-2020 11:03                3136
internals2.opcodes.fetch-constant.php              27-Sep-2020 11:03                3734
internals2.opcodes.fetch-dim-func-arg.php          27-Sep-2020 11:03                7198
internals2.opcodes.fetch-dim-is.php                27-Sep-2020 11:03                1586
internals2.opcodes.fetch-dim-r.php                 27-Sep-2020 11:03                4515
internals2.opcodes.fetch-dim-rw.php                27-Sep-2020 11:03                4686
internals2.opcodes.fetch-dim-tmp-var.php           27-Sep-2020 11:03                3313
internals2.opcodes.fetch-dim-unset.php             27-Sep-2020 11:03                1732
internals2.opcodes.fetch-dim-w.php                 27-Sep-2020 11:03                4214
internals2.opcodes.fetch-func-arg.php              27-Sep-2020 11:03                5395
internals2.opcodes.fetch-is.php                    27-Sep-2020 11:03                5309
internals2.opcodes.fetch-obj-func-arg.php          27-Sep-2020 11:03                8419
internals2.opcodes.fetch-obj-is.php                27-Sep-2020 11:03                1586
internals2.opcodes.fetch-obj-r.php                 27-Sep-2020 11:03                4346
internals2.opcodes.fetch-obj-rw.php                27-Sep-2020 11:03                4333
internals2.opcodes.fetch-obj-unset.php             27-Sep-2020 11:03                1725
internals2.opcodes.fetch-obj-w.php                 27-Sep-2020 11:03                5625
internals2.opcodes.fetch-r.php                     27-Sep-2020 11:03                3464
internals2.opcodes.fetch-rw.php                    27-Sep-2020 11:03                3625
internals2.opcodes.fetch-unset.php                 27-Sep-2020 11:03                1647
internals2.opcodes.fetch-w.php                     27-Sep-2020 11:03                3537
internals2.opcodes.free.php                        27-Sep-2020 11:03                2711
internals2.opcodes.goto.php                        27-Sep-2020 11:03                1529
internals2.opcodes.handle-exception.php            27-Sep-2020 11:03                2194
internals2.opcodes.include-or-eval.php             27-Sep-2020 11:03                3678
internals2.opcodes.init-array.php                  27-Sep-2020 11:03                4001
internals2.opcodes.init-fcall-by-name.php          27-Sep-2020 11:03                3468
internals2.opcodes.init-method-call.php            27-Sep-2020 11:03                5534
internals2.opcodes.init-ns-fcall-by-name.php       27-Sep-2020 11:03                1651
internals2.opcodes.init-static-method-call.php     27-Sep-2020 11:03                4606
internals2.opcodes.init-string.php                 27-Sep-2020 11:03                3268
internals2.opcodes.instanceof.php                  27-Sep-2020 11:03                4408
internals2.opcodes.is-equal.php                    27-Sep-2020 11:03                3364
internals2.opcodes.is-identical.php                27-Sep-2020 11:03                3445
internals2.opcodes.is-not-equal.php                27-Sep-2020 11:03                2852
internals2.opcodes.is-not-identical.php            27-Sep-2020 11:03                2931
internals2.opcodes.is-smaller-or-equal.php         27-Sep-2020 11:03                2927
internals2.opcodes.is-smaller.php                  27-Sep-2020 11:03                2844
internals2.opcodes.isset-isempty-dim-obj.php       27-Sep-2020 11:03                3437
internals2.opcodes.isset-isempty-prop-obj.php      27-Sep-2020 11:03                4312
internals2.opcodes.isset-isempty-var.php           27-Sep-2020 11:03                3304
internals2.opcodes.jmp.php                         27-Sep-2020 11:03                3594
internals2.opcodes.jmpnz-ex.php                    27-Sep-2020 11:03                3247
internals2.opcodes.jmpnz.php                       27-Sep-2020 11:03                4299
internals2.opcodes.jmpz-ex.php                     27-Sep-2020 11:03                2269
internals2.opcodes.jmpz.php                        27-Sep-2020 11:03                3291
internals2.opcodes.jmpznz.php                      27-Sep-2020 11:03                4455
internals2.opcodes.list.php                        27-Sep-2020 11:03               11293
internals2.opcodes.mod.php                         27-Sep-2020 11:03                2780
internals2.opcodes.mul.php                         27-Sep-2020 11:03                2763
internals2.opcodes.new.php                         27-Sep-2020 11:03                3204
internals2.opcodes.nop.php                         27-Sep-2020 11:03                2992
internals2.opcodes.php                             27-Sep-2020 11:03               23264
internals2.opcodes.post-dec-obj.php                27-Sep-2020 11:03                3687
internals2.opcodes.post-dec.php                    27-Sep-2020 11:03                2759
internals2.opcodes.post-inc-obj.php                27-Sep-2020 11:03                3843
internals2.opcodes.post-inc.php                    27-Sep-2020 11:03                2777
internals2.opcodes.pre-dec-obj.php                 27-Sep-2020 11:03                3494
internals2.opcodes.pre-dec.php                     27-Sep-2020 11:03                2624
internals2.opcodes.pre-inc-obj.php                 27-Sep-2020 11:03                3490
internals2.opcodes.pre-inc.php                     27-Sep-2020 11:03                2621
internals2.opcodes.print.php                       27-Sep-2020 11:03                2658
internals2.opcodes.qm-assign.php                   27-Sep-2020 11:03                7322
internals2.opcodes.raise-abstract-error.php        27-Sep-2020 11:03                8749
internals2.opcodes.recv-init.php                   27-Sep-2020 11:03                3538
internals2.opcodes.recv.php                        27-Sep-2020 11:03                3525
internals2.opcodes.return-by-ref.php               27-Sep-2020 11:03                1562
internals2.opcodes.return.php                      27-Sep-2020 11:03                2498
internals2.opcodes.send-ref.php                    27-Sep-2020 11:03                3480
internals2.opcodes.send-val.php                    27-Sep-2020 11:03                5064
internals2.opcodes.send-var-no-ref.php             27-Sep-2020 11:03                1564
internals2.opcodes.send-var.php                    27-Sep-2020 11:03                4647
internals2.opcodes.sl.php                          27-Sep-2020 11:03                2836
internals2.opcodes.sr.php                          27-Sep-2020 11:03                2811
internals2.opcodes.sub.php                         27-Sep-2020 11:03                2779
internals2.opcodes.switch-free.php                 27-Sep-2020 11:03                5163
internals2.opcodes.throw.php                       27-Sep-2020 11:03                6995
internals2.opcodes.ticks.php                       27-Sep-2020 11:03                7775
internals2.opcodes.unset-dim.php                   27-Sep-2020 11:03                3755
internals2.opcodes.unset-obj.php                   27-Sep-2020 11:03                3630
internals2.opcodes.unset-var.php                   27-Sep-2020 11:03                3232
internals2.opcodes.user-opcode.php                 27-Sep-2020 11:03                1584
internals2.opcodes.verify-abstract-class.php       27-Sep-2020 11:03                1652
internals2.opcodes.zend-declare-lambda-function..> 27-Sep-2020 11:03                1675
internals2.opcodes.zend-jmp-set.php                27-Sep-2020 11:03                1593
internals2.pdo.building.php                        27-Sep-2020 11:03                2245
internals2.pdo.constants.php                       27-Sep-2020 11:03                4786
internals2.pdo.error-handling.php                  27-Sep-2020 11:03                3285
internals2.pdo.implementing.php                    27-Sep-2020 11:03               47271
internals2.pdo.packaging.php                       27-Sep-2020 11:03                2925
internals2.pdo.pdo-dbh-t.php                       27-Sep-2020 11:03                9564
internals2.pdo.pdo-stmt-t.php                      27-Sep-2020 11:03                6606
internals2.pdo.php                                 27-Sep-2020 11:03                2497
internals2.pdo.preparation.php                     27-Sep-2020 11:03                7514
internals2.pdo.prerequisites.php                   27-Sep-2020 11:03                2969
internals2.pdo.testing.php                         27-Sep-2020 11:03                3964
internals2.php                                     27-Sep-2020 11:03                5871
internals2.preface.php                             27-Sep-2020 11:03                2684
internals2.resources.php                           27-Sep-2020 11:03                1203
internals2.streams.php                             27-Sep-2020 11:03                1395
internals2.structure.basics.php                    27-Sep-2020 11:03                6772
internals2.structure.files.php                     27-Sep-2020 11:03                5977
internals2.structure.globals.php                   27-Sep-2020 11:03                8966
internals2.structure.lifecycle.php                 27-Sep-2020 11:03                8281
internals2.structure.modstruct.php                 27-Sep-2020 11:03               24746
internals2.structure.php                           27-Sep-2020 11:03                2359
internals2.structure.tests.php                     27-Sep-2020 11:03                1654
internals2.variables.arrays.php                    27-Sep-2020 11:03                8323
internals2.variables.intro.php                     27-Sep-2020 11:03               16714
internals2.variables.objects.php                   27-Sep-2020 11:03                1100
internals2.variables.php                           27-Sep-2020 11:03                1615
internals2.variables.tables.php                    27-Sep-2020 11:03               15721
internals2.ze1.intro.php                           27-Sep-2020 11:03                1647
internals2.ze1.php                                 27-Sep-2020 11:03                1800
internals2.ze1.streams.php                         27-Sep-2020 11:03               16127
internals2.ze1.tsrm.php                            27-Sep-2020 11:03                1006
internals2.ze1.zendapi.php                         27-Sep-2020 11:03              215943
intl.configuration.php                             27-Sep-2020 11:03                5085
intl.constants.php                                 27-Sep-2020 11:03                8786
intl.examples.basic.php                            27-Sep-2020 11:03                4352
intl.examples.php                                  27-Sep-2020 11:03                1273
intl.installation.php                              27-Sep-2020 11:03                2271
intl.requirements.php                              27-Sep-2020 11:03                1469
intl.resources.php                                 27-Sep-2020 11:03                1069
intl.setup.php                                     27-Sep-2020 11:03                1459
intlbreakiterator.construct.php                    27-Sep-2020 11:03                2329
intlbreakiterator.createcharacterinstance.php      27-Sep-2020 11:03                2798
intlbreakiterator.createcodepointinstance.php      27-Sep-2020 11:03                2637
intlbreakiterator.createlineinstance.php           27-Sep-2020 11:03                2764
intlbreakiterator.createsentenceinstance.php       27-Sep-2020 11:03                2762
intlbreakiterator.createtitleinstance.php          27-Sep-2020 11:03                2745
intlbreakiterator.createwordinstance.php           27-Sep-2020 11:03                2700
intlbreakiterator.current.php                      27-Sep-2020 11:03                2311
intlbreakiterator.first.php                        27-Sep-2020 11:03                2297
intlbreakiterator.following.php                    27-Sep-2020 11:03                2511
intlbreakiterator.geterrorcode.php                 27-Sep-2020 11:03                2828
intlbreakiterator.geterrormessage.php              27-Sep-2020 11:03                2870
intlbreakiterator.getlocale.php                    27-Sep-2020 11:03                2520
intlbreakiterator.getpartsiterator.php             27-Sep-2020 11:03                3305
intlbreakiterator.gettext.php                      27-Sep-2020 11:03                2317
intlbreakiterator.isboundary.php                   27-Sep-2020 11:03                2479
intlbreakiterator.last.php                         27-Sep-2020 11:03                2297
intlbreakiterator.next.php                         27-Sep-2020 11:03                2422
intlbreakiterator.preceding.php                    27-Sep-2020 11:03                2489
intlbreakiterator.previous.php                     27-Sep-2020 11:03                2349
intlbreakiterator.settext.php                      27-Sep-2020 11:03                2446
intlcalendar.add.php                               27-Sep-2020 11:03                8170
intlcalendar.after.php                             27-Sep-2020 11:03                6486
intlcalendar.before.php                            27-Sep-2020 11:03                3725
intlcalendar.clear.php                             27-Sep-2020 11:03               20415
intlcalendar.construct.php                         27-Sep-2020 11:03                2425
intlcalendar.createinstance.php                    27-Sep-2020 11:03               11940
intlcalendar.equals.php                            27-Sep-2020 11:03               10698
intlcalendar.fielddifference.php                   27-Sep-2020 11:03               10900
intlcalendar.fromdatetime.php                      27-Sep-2020 11:03                6566
intlcalendar.get.php                               27-Sep-2020 11:03                8482
intlcalendar.getactualmaximum.php                  27-Sep-2020 11:03                8063
intlcalendar.getactualminimum.php                  27-Sep-2020 11:03                5232
intlcalendar.getavailablelocales.php               27-Sep-2020 11:03                4264
intlcalendar.getdayofweektype.php                  27-Sep-2020 11:03                9476
intlcalendar.geterrorcode.php                      27-Sep-2020 11:03                8706
intlcalendar.geterrormessage.php                   27-Sep-2020 11:03                5651
intlcalendar.getfirstdayofweek.php                 27-Sep-2020 11:03                8137
intlcalendar.getgreatestminimum.php                27-Sep-2020 11:03                4078
intlcalendar.getkeywordvaluesforlocale.php         27-Sep-2020 11:03                7229
intlcalendar.getleastmaximum.php                   27-Sep-2020 11:03                7867
intlcalendar.getlocale.php                         27-Sep-2020 11:03                5580
intlcalendar.getmaximum.php                        27-Sep-2020 11:03                4777
intlcalendar.getminimaldaysinfirstweek.php         27-Sep-2020 11:03                8731
intlcalendar.getminimum.php                        27-Sep-2020 11:03                4030
intlcalendar.getnow.php                            27-Sep-2020 11:03                5354
intlcalendar.getrepeatedwalltimeoption.php         27-Sep-2020 11:03               10149
intlcalendar.getskippedwalltimeoption.php          27-Sep-2020 11:03               12559
intlcalendar.gettime.php                           27-Sep-2020 11:03                6121
intlcalendar.gettimezone.php                       27-Sep-2020 11:03                7092
intlcalendar.gettype.php                           27-Sep-2020 11:03                5516
intlcalendar.getweekendtransition.php              27-Sep-2020 11:03                4339
intlcalendar.indaylighttime.php                    27-Sep-2020 11:03                8650
intlcalendar.isequivalentto.php                    27-Sep-2020 11:03                8312
intlcalendar.islenient.php                         27-Sep-2020 11:03                8247
intlcalendar.isset.php                             27-Sep-2020 11:03                4403
intlcalendar.isweekend.php                         27-Sep-2020 11:03                8407
intlcalendar.roll.php                              27-Sep-2020 11:03                8917
intlcalendar.set.php                               27-Sep-2020 11:03               13671
intlcalendar.setfirstdayofweek.php                 27-Sep-2020 11:03                7752
intlcalendar.setlenient.php                        27-Sep-2020 11:03                3963
intlcalendar.setminimaldaysinfirstweek.php         27-Sep-2020 11:03                3910
intlcalendar.setrepeatedwalltimeoption.php         27-Sep-2020 11:03                5266
intlcalendar.setskippedwalltimeoption.php          27-Sep-2020 11:03                5976
intlcalendar.settime.php                           27-Sep-2020 11:03                8453
intlcalendar.settimezone.php                       27-Sep-2020 11:03               10322
intlcalendar.todatetime.php                        27-Sep-2020 11:03                6621
intlchar.charage.php                               27-Sep-2020 11:03                5478
intlchar.chardigitvalue.php                        27-Sep-2020 11:03                5088
intlchar.chardirection.php                         27-Sep-2020 11:03                8554
intlchar.charfromname.php                          27-Sep-2020 11:03                6669
intlchar.charmirror.php                            27-Sep-2020 11:03                6110
intlchar.charname.php                              27-Sep-2020 11:03                6996
intlchar.chartype.php                              27-Sep-2020 11:03                8687
intlchar.chr.php                                   27-Sep-2020 11:03                5103
intlchar.digit.php                                 27-Sep-2020 11:03                7636
intlchar.enumcharnames.php                         27-Sep-2020 11:03                7637
intlchar.enumchartypes.php                         27-Sep-2020 11:03                5827
intlchar.foldcase.php                              27-Sep-2020 11:03                3459
intlchar.fordigit.php                              27-Sep-2020 11:03                6808
intlchar.getbidipairedbracket.php                  27-Sep-2020 11:03                5640
intlchar.getblockcode.php                          27-Sep-2020 11:03                5168
intlchar.getcombiningclass.php                     27-Sep-2020 11:03                4477
intlchar.getfc-nfkc-closure.php                    27-Sep-2020 11:03                4307
intlchar.getintpropertymaxvalue.php                27-Sep-2020 11:03                6201
intlchar.getintpropertyminvalue.php                27-Sep-2020 11:03                6194
intlchar.getintpropertyvalue.php                   27-Sep-2020 11:03                7553
intlchar.getnumericvalue.php                       27-Sep-2020 11:03                5047
intlchar.getpropertyenum.php                       27-Sep-2020 11:03                6381
intlchar.getpropertyname.php                       27-Sep-2020 11:03                8025
intlchar.getpropertyvalueenum.php                  27-Sep-2020 11:03                7712
intlchar.getpropertyvaluename.php                  27-Sep-2020 11:03                9711
intlchar.getunicodeversion.php                     27-Sep-2020 11:03                3813
intlchar.hasbinaryproperty.php                     27-Sep-2020 11:03                8418
intlchar.isalnum.php                               27-Sep-2020 11:03                5217
intlchar.isalpha.php                               27-Sep-2020 11:03                5105
intlchar.isbase.php                                27-Sep-2020 11:03                5583
intlchar.isblank.php                               27-Sep-2020 11:03                6294
intlchar.iscntrl.php                               27-Sep-2020 11:03                5894
intlchar.isdefined.php                             27-Sep-2020 11:03                6322
intlchar.isdigit.php                               27-Sep-2020 11:03                5443
intlchar.isgraph.php                               27-Sep-2020 11:03                5137
intlchar.isidignorable.php                         27-Sep-2020 11:03                5715
intlchar.isidpart.php                              27-Sep-2020 11:03                6300
intlchar.isidstart.php                             27-Sep-2020 11:03                5806
intlchar.isisocontrol.php                          27-Sep-2020 11:03                5055
intlchar.isjavaidpart.php                          27-Sep-2020 11:03                6395
intlchar.isjavaidstart.php                         27-Sep-2020 11:03                6094
intlchar.isjavaspacechar.php                       27-Sep-2020 11:03                6330
intlchar.islower.php                               27-Sep-2020 11:03                6604
intlchar.ismirrored.php                            27-Sep-2020 11:03                5167
intlchar.isprint.php                               27-Sep-2020 11:03                5414
intlchar.ispunct.php                               27-Sep-2020 11:03                4884
intlchar.isspace.php                               27-Sep-2020 11:03                5981
intlchar.istitle.php                               27-Sep-2020 11:03                6042
intlchar.isualphabetic.php                         27-Sep-2020 11:03                5395
intlchar.isulowercase.php                          27-Sep-2020 11:03                6376
intlchar.isupper.php                               27-Sep-2020 11:03                6602
intlchar.isuuppercase.php                          27-Sep-2020 11:03                6414
intlchar.isuwhitespace.php                         27-Sep-2020 11:03                6919
intlchar.iswhitespace.php                          27-Sep-2020 11:03                7048
intlchar.isxdigit.php                              27-Sep-2020 11:03                6483
intlchar.ord.php                                   27-Sep-2020 11:03                5034
intlchar.tolower.php                               27-Sep-2020 11:03                7234
intlchar.totitle.php                               27-Sep-2020 11:03                7255
intlchar.toupper.php                               27-Sep-2020 11:03                7232
intlcodepointbreakiterator.getlastcodepoint.php    27-Sep-2020 11:03                2521
intldateformatter.create.php                       27-Sep-2020 11:03               24594
intldateformatter.format.php                       27-Sep-2020 11:03               26590
intldateformatter.formatobject.php                 27-Sep-2020 11:03               12958
intldateformatter.getcalendar.php                  27-Sep-2020 11:03                9134
intldateformatter.getcalendarobject.php            27-Sep-2020 11:03                6979
intldateformatter.getdatetype.php                  27-Sep-2020 11:03               11893
intldateformatter.geterrorcode.php                 27-Sep-2020 11:03                9170
intldateformatter.geterrormessage.php              27-Sep-2020 11:03                9073
intldateformatter.getlocale.php                    27-Sep-2020 11:03               10631
intldateformatter.getpattern.php                   27-Sep-2020 11:03               10453
intldateformatter.gettimetype.php                  27-Sep-2020 11:03               11885
intldateformatter.gettimezone.php                  27-Sep-2020 11:03                8146
intldateformatter.gettimezoneid.php                27-Sep-2020 11:03                8605
intldateformatter.islenient.php                    27-Sep-2020 11:03               15808
intldateformatter.localtime.php                    27-Sep-2020 11:03               11248
intldateformatter.parse.php                        27-Sep-2020 11:03               11774
intldateformatter.setcalendar.php                  27-Sep-2020 11:03               14088
intldateformatter.setlenient.php                   27-Sep-2020 11:03               16452
intldateformatter.setpattern.php                   27-Sep-2020 11:03               11119
intldateformatter.settimezone.php                  27-Sep-2020 11:03               10971
intldateformatter.settimezoneid.php                27-Sep-2020 11:03               10222
intlgregoriancalendar.construct.php                27-Sep-2020 11:03                4763
intlgregoriancalendar.getgregorianchange.php       27-Sep-2020 11:03                2552
intlgregoriancalendar.isleapyear.php               27-Sep-2020 11:03                2704
intlgregoriancalendar.setgregorianchange.php       27-Sep-2020 11:03                2695
intliterator.current.php                           27-Sep-2020 11:03                2270
intliterator.key.php                               27-Sep-2020 11:03                2164
intliterator.next.php                              27-Sep-2020 11:03                2211
intliterator.rewind.php                            27-Sep-2020 11:03                2237
intliterator.valid.php                             27-Sep-2020 11:03                2180
intlpartsiterator.getbreakiterator.php             27-Sep-2020 11:03                2445
intlrulebasedbreakiterator.construct.php           27-Sep-2020 11:03                2824
intlrulebasedbreakiterator.getbinaryrules.php      27-Sep-2020 11:03                2519
intlrulebasedbreakiterator.getrules.php            27-Sep-2020 11:03                2489
intlrulebasedbreakiterator.getrulestatus.php       27-Sep-2020 11:03                2574
intlrulebasedbreakiterator.getrulestatusvec.php    27-Sep-2020 11:03                2577
intltimezone.countequivalentids.php                27-Sep-2020 11:03                2564
intltimezone.createdefault.php                     27-Sep-2020 11:03                2464
intltimezone.createenumeration.php                 27-Sep-2020 11:03                2767
intltimezone.createtimezone.php                    27-Sep-2020 11:03                2627
intltimezone.createtimezoneidenumeration.php       27-Sep-2020 11:03                3327
intltimezone.fromdatetimezone.php                  27-Sep-2020 11:03                2798
intltimezone.getcanonicalid.php                    27-Sep-2020 11:03                2840
intltimezone.getdisplayname.php                    27-Sep-2020 11:03                2981
intltimezone.getdstsavings.php                     27-Sep-2020 11:03                2374
intltimezone.getequivalentid.php                   27-Sep-2020 11:03                2775
intltimezone.geterrorcode.php                      27-Sep-2020 11:03                2737
intltimezone.geterrormessage.php                   27-Sep-2020 11:03                2758
intltimezone.getgmt.php                            27-Sep-2020 11:03                2341
intltimezone.getid.php                             27-Sep-2020 11:03                2222
intltimezone.getidforwindowsid.php                 27-Sep-2020 11:03                3545
intltimezone.getoffset.php                         27-Sep-2020 11:03                3179
intltimezone.getrawoffset.php                      27-Sep-2020 11:03                2329
intltimezone.getregion.php                         27-Sep-2020 11:03                2548
intltimezone.gettzdataversion.php                  27-Sep-2020 11:03                2386
intltimezone.getunknown.php                        27-Sep-2020 11:03                2509
intltimezone.getwindowsid.php                      27-Sep-2020 11:03                3289
intltimezone.hassamerules.php                      27-Sep-2020 11:03                2571
intltimezone.todatetimezone.php                    27-Sep-2020 11:03                2484
intltimezone.usedaylighttime.php                   27-Sep-2020 11:03                2340
intro-whatcando.php                                27-Sep-2020 11:02                7384
intro-whatis.php                                   27-Sep-2020 11:02                4189
intro.apache.php                                   27-Sep-2020 11:03                1059
intro.apcu.php                                     27-Sep-2020 11:02                1372
intro.array.php                                    27-Sep-2020 11:03                1766
intro.bc.php                                       27-Sep-2020 11:03                4388
intro.blenc.php                                    27-Sep-2020 11:02                3322
intro.bzip2.php                                    27-Sep-2020 11:02                1073
intro.calendar.php                                 27-Sep-2020 11:03                1921
intro.classkit.php                                 27-Sep-2020 11:03                1375
intro.classobj.php                                 27-Sep-2020 11:03                1603
intro.cmark.php                                    27-Sep-2020 11:03                6091
intro.com.php                                      27-Sep-2020 11:03                2969
intro.componere.php                                27-Sep-2020 11:02                5966
intro.csprng.php                                   27-Sep-2020 11:02                1544
intro.ctype.php                                    27-Sep-2020 11:03                3083
intro.cubrid.php                                   27-Sep-2020 11:03                1354
intro.curl.php                                     27-Sep-2020 11:03                1474
intro.datetime.php                                 27-Sep-2020 11:03                2216
intro.dba.php                                      27-Sep-2020 11:03                1391
intro.dbase.php                                    27-Sep-2020 11:03                6261
intro.dbplus.php                                   27-Sep-2020 11:03                2331
intro.dbx.php                                      27-Sep-2020 11:03                1624
intro.dio.php                                      27-Sep-2020 11:03                1870
intro.dom.php                                      27-Sep-2020 11:03                1515
intro.ds.php                                       27-Sep-2020 11:03                1338
intro.eio.php                                      27-Sep-2020 11:03               15476
intro.enchant.php                                  27-Sep-2020 11:03                2486
intro.errorfunc.php                                27-Sep-2020 11:02                1766
intro.ev.php                                       27-Sep-2020 11:03                2167
intro.event.php                                    27-Sep-2020 11:03                1855
intro.exec.php                                     27-Sep-2020 11:03                1608
intro.exif.php                                     27-Sep-2020 11:03                1363
intro.expect.php                                   27-Sep-2020 11:03                1308
intro.fann.php                                     27-Sep-2020 11:03                1289
intro.fbsql.php                                    27-Sep-2020 11:03                1743
intro.fdf.php                                      27-Sep-2020 11:03                3706
intro.ffi.php                                      27-Sep-2020 11:02                3071
intro.fileinfo.php                                 27-Sep-2020 11:03                1288
intro.filepro.php                                  27-Sep-2020 11:03                1604
intro.filesystem.php                               27-Sep-2020 11:03                1314
intro.filter.php                                   27-Sep-2020 11:03                2552
intro.fpm.php                                      27-Sep-2020 11:03                1226
intro.ftp.php                                      27-Sep-2020 11:03                1655
intro.funchand.php                                 27-Sep-2020 11:03                1105
intro.gearman.php                                  27-Sep-2020 11:03                1537
intro.gender.php                                   27-Sep-2020 11:03                1206
intro.geoip.php                                    27-Sep-2020 11:03                1447
intro.gettext.php                                  27-Sep-2020 11:03                1420
intro.gmagick.php                                  27-Sep-2020 11:03                1567
intro.gmp.php                                      27-Sep-2020 11:03                3009
intro.gnupg.php                                    27-Sep-2020 11:03                1096
intro.hash.php                                     27-Sep-2020 11:02                1112
intro.hrtime.php                                   27-Sep-2020 11:03                1539
intro.ibase.php                                    27-Sep-2020 11:03                3026
intro.ibm-db2.php                                  27-Sep-2020 11:03                1154
intro.iconv.php                                    27-Sep-2020 11:03                1832
intro.ifx.php                                      27-Sep-2020 11:03                1681
intro.iisfunc.php                                  27-Sep-2020 11:03                1250
intro.image.php                                    27-Sep-2020 11:03                6177
intro.imagick.php                                  27-Sep-2020 11:03                1586
intro.imap.php                                     27-Sep-2020 11:03                1398
intro.info.php                                     27-Sep-2020 11:02                1372
intro.ingres.php                                   27-Sep-2020 11:03                1400
intro.inotify.php                                  27-Sep-2020 11:03                2216
intro.intl.php                                     27-Sep-2020 11:03                4888
intro.json.php                                     27-Sep-2020 11:03                1637
intro.judy.php                                     27-Sep-2020 11:03                1912
intro.ldap.php                                     27-Sep-2020 11:03                3958
intro.libxml.php                                   27-Sep-2020 11:03                1646
intro.lua.php                                      27-Sep-2020 11:03                1146
intro.luasandbox.php                               27-Sep-2020 11:03                2243
intro.lzf.php                                      27-Sep-2020 11:02                1299
intro.mail.php                                     27-Sep-2020 11:03                1094
intro.mailparse.php                                27-Sep-2020 11:03                1809
intro.math.php                                     27-Sep-2020 11:03                1607
intro.maxdb.php                                    27-Sep-2020 11:03                4335
intro.mbstring.php                                 27-Sep-2020 11:03                2646
intro.mcrypt.php                                   27-Sep-2020 11:03                2176
intro.memcache.php                                 27-Sep-2020 11:03                1557
intro.memcached.php                                27-Sep-2020 11:03                1749
intro.memtrack.php                                 27-Sep-2020 11:02                2310
intro.mhash.php                                    27-Sep-2020 11:03                2659
intro.mime-magic.php                               27-Sep-2020 11:03                1851
intro.misc.php                                     27-Sep-2020 11:03                1060
intro.mqseries.php                                 27-Sep-2020 11:03                1617
intro.msql.php                                     27-Sep-2020 11:03                1360
intro.mysql-xdevapi.php                            27-Sep-2020 11:03                1748
intro.mysql.php                                    27-Sep-2020 11:03                1787
intro.mysqli.php                                   27-Sep-2020 11:03                2043
intro.mysqlnd-memcache.php                         27-Sep-2020 11:03                5764
intro.mysqlnd-ms.php                               27-Sep-2020 11:03               12383
intro.mysqlnd-mux.php                              27-Sep-2020 11:03                6126
intro.mysqlnd-qc.php                               27-Sep-2020 11:03                5281
intro.mysqlnd-uh.php                               27-Sep-2020 11:03                5812
intro.mysqlnd.php                                  27-Sep-2020 11:03                1820
intro.ncurses.php                                  27-Sep-2020 11:02                3367
intro.network.php                                  27-Sep-2020 11:03                1033
intro.nsapi.php                                    27-Sep-2020 11:03                1084
intro.oauth.php                                    27-Sep-2020 11:03                1210
intro.oci8.php                                     27-Sep-2020 11:03                1524
intro.opcache.php                                  27-Sep-2020 11:02                1404
intro.openal.php                                   27-Sep-2020 11:02                1156
intro.openssl.php                                  27-Sep-2020 11:03                1454
intro.outcontrol.php                               27-Sep-2020 11:02                1681
intro.paradox.php                                  27-Sep-2020 11:03                1952
intro.parallel.php                                 27-Sep-2020 11:03                6289
intro.parle.php                                    27-Sep-2020 11:03                3315
intro.password.php                                 27-Sep-2020 11:03                1526
intro.pcntl.php                                    27-Sep-2020 11:03                2490
intro.pcre.php                                     27-Sep-2020 11:03                2724
intro.pdf.php                                      27-Sep-2020 11:03                2095
intro.pdo.php                                      27-Sep-2020 11:03                2154
intro.pgsql.php                                    27-Sep-2020 11:03                1454
intro.phar.php                                     27-Sep-2020 11:02                9930
intro.phpdbg.php                                   27-Sep-2020 11:02                5916
intro.pht.php                                      27-Sep-2020 11:03                3554
intro.posix.php                                    27-Sep-2020 11:03                2000
intro.proctitle.php                                27-Sep-2020 11:03                1288
intro.ps.php                                       27-Sep-2020 11:03                1641
intro.pspell.php                                   27-Sep-2020 11:03                1070
intro.pthreads.php                                 27-Sep-2020 11:03                8441
intro.quickhash.php                                27-Sep-2020 11:03                1139
intro.radius.php                                   27-Sep-2020 11:02                2040
intro.rar.php                                      27-Sep-2020 11:02                1419
intro.readline.php                                 27-Sep-2020 11:02                1836
intro.recode.php                                   27-Sep-2020 11:03                2137
intro.reflection.php                               27-Sep-2020 11:03                1652
intro.regex.php                                    27-Sep-2020 11:03                2831
intro.rpminfo.php                                  27-Sep-2020 11:03                1100
intro.rrd.php                                      27-Sep-2020 11:03                1314
intro.runkit7.php                                  27-Sep-2020 11:02                1353
intro.scoutapm.php                                 27-Sep-2020 11:03                1338
intro.sdo-das-xml.php                              27-Sep-2020 11:03                2255
intro.sdo.php                                      27-Sep-2020 11:03                3944
intro.sdodasrel.php                                27-Sep-2020 11:03                6610
intro.seaslog.php                                  27-Sep-2020 11:03                4158
intro.sem.php                                      27-Sep-2020 11:03                2892
intro.session.php                                  27-Sep-2020 11:03                5267
intro.shmop.php                                    27-Sep-2020 11:03                1117
intro.simplexml.php                                27-Sep-2020 11:03                1191
intro.snmp.php                                     27-Sep-2020 11:03                1644
intro.soap.php                                     27-Sep-2020 11:03                1341
intro.sockets.php                                  27-Sep-2020 11:03                2462
intro.sodium.php                                   27-Sep-2020 11:03                 984
intro.solr.php                                     27-Sep-2020 11:03                1662
intro.sphinx.php                                   27-Sep-2020 11:03                1450
intro.spl-types.php                                27-Sep-2020