Index of /php/manual/de/


../
feeds/                                             28-Sep-2020 11:09                   -
images/                                            28-Sep-2020 11:09                   -
styles/                                            28-Sep-2020 11:08                   -
toc/                                               28-Sep-2020 11:09                   -
about.formats.php                                  28-Sep-2020 11:09                4652
about.generate.php                                 28-Sep-2020 11:09                2941
about.howtohelp.php                                28-Sep-2020 11:09                3297
about.more.php                                     28-Sep-2020 11:09                1865
about.notes.php                                    28-Sep-2020 11:09                2448
about.php                                          28-Sep-2020 11:09                1819
about.phpversions.php                              28-Sep-2020 11:09                3584
about.prototypes.php                               28-Sep-2020 11:09                7536
about.translations.php                             28-Sep-2020 11:09                3198
aliases.php                                        28-Sep-2020 11:09               34188
apache.configuration.php                           28-Sep-2020 11:09                5143
apache.constants.php                               28-Sep-2020 11:09                1050
apache.installation.php                            28-Sep-2020 11:09                1175
apache.requirements.php                            28-Sep-2020 11:09                1114
apache.resources.php                               28-Sep-2020 11:09                1097
apache.setup.php                                   28-Sep-2020 11:09                1493
apcu.configuration.php                             28-Sep-2020 11:08               15100
apcu.constants.php                                 28-Sep-2020 11:08                6442
apcu.installation.php                              28-Sep-2020 11:08                2669
apcu.requirements.php                              28-Sep-2020 11:08                1102
apcu.resources.php                                 28-Sep-2020 11:08                1085
apcu.setup.php                                     28-Sep-2020 11:08                1452
apcuiterator.construct.php                         28-Sep-2020 11:08                6759
apcuiterator.current.php                           28-Sep-2020 11:08                2892
apcuiterator.gettotalcount.php                     28-Sep-2020 11:08                3088
apcuiterator.gettotalhits.php                      28-Sep-2020 11:08                3173
apcuiterator.gettotalsize.php                      28-Sep-2020 11:08                2966
apcuiterator.key.php                               28-Sep-2020 11:08                2654
apcuiterator.next.php                              28-Sep-2020 11:08                2899
apcuiterator.rewind.php                            28-Sep-2020 11:08                2670
apcuiterator.valid.php                             28-Sep-2020 11:08                2730
appendices.php                                     28-Sep-2020 11:09               16573
appenditerator.append.php                          28-Sep-2020 11:09                5429
appenditerator.construct.php                       28-Sep-2020 11:09               10710
appenditerator.current.php                         28-Sep-2020 11:09                3422
appenditerator.getarrayiterator.php                28-Sep-2020 11:09                3032
appenditerator.getinneriterator.php                28-Sep-2020 11:09                6757
appenditerator.getiteratorindex.php                28-Sep-2020 11:09                6686
appenditerator.key.php                             28-Sep-2020 11:09                8165
appenditerator.next.php                            28-Sep-2020 11:09                3348
appenditerator.rewind.php                          28-Sep-2020 11:09                3328
appenditerator.valid.php                           28-Sep-2020 11:09                3152
array.configuration.php                            28-Sep-2020 11:09                1148
array.constants.php                                28-Sep-2020 11:09                9942
array.installation.php                             28-Sep-2020 11:09                1132
array.requirements.php                             28-Sep-2020 11:09                1108
array.resources.php                                28-Sep-2020 11:09                1091
array.setup.php                                    28-Sep-2020 11:09                1460
array.sorting.php                                  28-Sep-2020 11:09                6692
arrayaccess.offsetexists.php                       28-Sep-2020 11:08                9705
arrayaccess.offsetget.php                          28-Sep-2020 11:08                4931
arrayaccess.offsetset.php                          28-Sep-2020 11:08                5008
arrayaccess.offsetunset.php                        28-Sep-2020 11:08                2803
arrayiterator.append.php                           28-Sep-2020 11:09                3412
arrayiterator.asort.php                            28-Sep-2020 11:09                3099
arrayiterator.construct.php                        28-Sep-2020 11:09                4205
arrayiterator.count.php                            28-Sep-2020 11:09                3124
arrayiterator.current.php                          28-Sep-2020 11:09                5459
arrayiterator.getarraycopy.php                     28-Sep-2020 11:09                2964
arrayiterator.getflags.php                         28-Sep-2020 11:09                2845
arrayiterator.key.php                              28-Sep-2020 11:09                3809
arrayiterator.ksort.php                            28-Sep-2020 11:09                3097
arrayiterator.natcasesort.php                      28-Sep-2020 11:09                3460
arrayiterator.natsort.php                          28-Sep-2020 11:09                3361
arrayiterator.next.php                             28-Sep-2020 11:09                4667
arrayiterator.offsetexists.php                     28-Sep-2020 11:09                3094
arrayiterator.offsetget.php                        28-Sep-2020 11:09                3326
arrayiterator.offsetset.php                        28-Sep-2020 11:09                3584
arrayiterator.offsetunset.php                      28-Sep-2020 11:09                3673
arrayiterator.rewind.php                           28-Sep-2020 11:09                4622
arrayiterator.seek.php                             28-Sep-2020 11:09                2442
arrayiterator.serialize.php                        28-Sep-2020 11:09                2729
arrayiterator.setflags.php                         28-Sep-2020 11:09                3945
arrayiterator.uasort.php                           28-Sep-2020 11:09                4341
arrayiterator.uksort.php                           28-Sep-2020 11:09                4275
arrayiterator.unserialize.php                      28-Sep-2020 11:09                2964
arrayiterator.valid.php                            28-Sep-2020 11:09                4567
arrayobject.append.php                             28-Sep-2020 11:09                5372
arrayobject.asort.php                              28-Sep-2020 11:09                6364
arrayobject.construct.php                          28-Sep-2020 11:09                6995
arrayobject.count.php                              28-Sep-2020 11:09                5324
arrayobject.exchangearray.php                      28-Sep-2020 11:09                6397
arrayobject.getarraycopy.php                       28-Sep-2020 11:09                5236
arrayobject.getflags.php                           28-Sep-2020 11:09                6129
arrayobject.getiterator.php                        28-Sep-2020 11:09                5452
arrayobject.getiteratorclass.php                   28-Sep-2020 11:09                6696
arrayobject.ksort.php                              28-Sep-2020 11:09                6117
arrayobject.natcasesort.php                        28-Sep-2020 11:09                7133
arrayobject.natsort.php                            28-Sep-2020 11:09                6878
arrayobject.offsetexists.php                       28-Sep-2020 11:09                4728
arrayobject.offsetget.php                          28-Sep-2020 11:09                5011
arrayobject.offsetset.php                          28-Sep-2020 11:09                6805
arrayobject.offsetunset.php                        28-Sep-2020 11:09                4169
arrayobject.serialize.php                          28-Sep-2020 11:09                4992
arrayobject.setflags.php                           28-Sep-2020 11:09                6744
arrayobject.setiteratorclass.php                   28-Sep-2020 11:09                5861
arrayobject.uasort.php                             28-Sep-2020 11:09                9002
arrayobject.uksort.php                             28-Sep-2020 11:09                8433
arrayobject.unserialize.php                        28-Sep-2020 11:09                3412
bc.configuration.php                               28-Sep-2020 11:09                2398
bc.constants.php                                   28-Sep-2020 11:09                1028
bc.installation.php                                28-Sep-2020 11:09                1316
bc.requirements.php                                28-Sep-2020 11:09                1090
bc.resources.php                                   28-Sep-2020 11:09                1073
bc.setup.php                                       28-Sep-2020 11:09                1455
blenc.configuration.php                            28-Sep-2020 11:08                2243
blenc.constants.php                                28-Sep-2020 11:08                1506
blenc.installation.php                             28-Sep-2020 11:08                2423
blenc.requirements.php                             28-Sep-2020 11:08                1042
blenc.resources.php                                28-Sep-2020 11:08                1045
blenc.setup.php                                    28-Sep-2020 11:08                1478
book.apache.php                                    28-Sep-2020 11:09                3292
book.apcu.php                                      28-Sep-2020 11:08                4162
book.array.php                                     28-Sep-2020 11:09               12518
book.bc.php                                        28-Sep-2020 11:09                2865
book.blenc.php                                     28-Sep-2020 11:08                1955
book.bson.php                                      28-Sep-2020 11:08               19782
book.bzip2.php                                     28-Sep-2020 11:08                2982
book.calendar.php                                  28-Sep-2020 11:09                4194
book.classkit.php                                  28-Sep-2020 11:09                2625
book.classobj.php                                  28-Sep-2020 11:09                4391
book.cmark.php                                     28-Sep-2020 11:09                8590
book.com.php                                       28-Sep-2020 11:09                7833
book.componere.php                                 28-Sep-2020 11:08                6051
book.csprng.php                                    28-Sep-2020 11:08                2062
book.ctype.php                                     28-Sep-2020 11:09                3108
book.cubrid.php                                    28-Sep-2020 11:08               13737
book.curl.php                                      28-Sep-2020 11:09                6659
book.datetime.php                                  28-Sep-2020 11:09               15762
book.dba.php                                       28-Sep-2020 11:08                3622
book.dbase.php                                     28-Sep-2020 11:08                3309
book.dbplus.php                                    28-Sep-2020 11:08                6612
book.dbx.php                                       28-Sep-2020 11:08                2812
book.dio.php                                       28-Sep-2020 11:09                2818
book.dir.php                                       28-Sep-2020 11:09                3143
book.dom.php                                       28-Sep-2020 11:09               16586
book.ds.php                                        28-Sep-2020 11:09               24988
book.eio.php                                       28-Sep-2020 11:09                7831
book.enchant.php                                   28-Sep-2020 11:09                4842
book.errorfunc.php                                 28-Sep-2020 11:08                3477
book.ev.php                                        28-Sep-2020 11:09               13261
book.event.php                                     28-Sep-2020 11:09               22811
book.exec.php                                      28-Sep-2020 11:09                3334
book.exif.php                                      28-Sep-2020 11:09                2400
book.expect.php                                    28-Sep-2020 11:09                2372
book.fann.php                                      28-Sep-2020 11:09               22985
book.fbsql.php                                     28-Sep-2020 11:08                9030
book.fdf.php                                       28-Sep-2020 11:09                5807
book.ffi.php                                       28-Sep-2020 11:08                3983
book.fileinfo.php                                  28-Sep-2020 11:09                3000
book.filepro.php                                   28-Sep-2020 11:08                2704
book.filesystem.php                                28-Sep-2020 11:09               10236
book.filter.php                                    28-Sep-2020 11:09                3366
book.fpm.php                                       28-Sep-2020 11:09                1574
book.ftp.php                                       28-Sep-2020 11:09                6100
book.funchand.php                                  28-Sep-2020 11:09                3584
book.gearman.php                                   28-Sep-2020 11:09               14567
book.gender.php                                    28-Sep-2020 11:09                2487
book.geoip.php                                     28-Sep-2020 11:09                4248
book.gettext.php                                   28-Sep-2020 11:09                2869
book.gmagick.php                                   28-Sep-2020 11:09               22479
book.gmp.php                                       28-Sep-2020 11:09                6137
book.gnupg.php                                     28-Sep-2020 11:09                4679
book.hash.php                                      28-Sep-2020 11:08                3888
book.hrtime.php                                    28-Sep-2020 11:09                3363
book.ibase.php                                     28-Sep-2020 11:08               12681
book.ibm-db2.php                                   28-Sep-2020 11:08                8517
book.iconv.php                                     28-Sep-2020 11:09                3176
book.ifx.php                                       28-Sep-2020 11:08                5743
book.iisfunc.php                                   28-Sep-2020 11:09                3777
book.image.php                                     28-Sep-2020 11:09               15229
book.imagick.php                                   28-Sep-2020 11:09               62197
book.imap.php                                      28-Sep-2020 11:09               10396
book.info.php                                      28-Sep-2020 11:08                8014
book.ingres.php                                    28-Sep-2020 11:08                6568
book.inotify.php                                   28-Sep-2020 11:09                2434
book.intl.php                                      28-Sep-2020 11:09               43798
book.json.php                                      28-Sep-2020 11:09                2767
book.judy.php                                      28-Sep-2020 11:09                3986
book.ldap.php                                      28-Sep-2020 11:09                8811
book.libxml.php                                    28-Sep-2020 11:09                2848
book.lua.php                                       28-Sep-2020 11:09                2523
book.luasandbox.php                                28-Sep-2020 11:09                5443
book.lzf.php                                       28-Sep-2020 11:08                2090
book.mail.php                                      28-Sep-2020 11:09                1982
book.mailparse.php                                 28-Sep-2020 11:09                3794
book.math.php                                      28-Sep-2020 11:09                5863
book.maxdb.php                                     28-Sep-2020 11:08               14375
book.mbstring.php                                  28-Sep-2020 11:09                9378
book.mcrypt.php                                    28-Sep-2020 11:08                6881
book.memcache.php                                  28-Sep-2020 11:09                4115
book.memcached.php                                 28-Sep-2020 11:09                7953
book.memtrack.php                                  28-Sep-2020 11:08                1917
book.mhash.php                                     28-Sep-2020 11:08                2414
book.mime-magic.php                                28-Sep-2020 11:09                1777
book.misc.php                                      28-Sep-2020 11:09                5387
book.mongo.php                                     28-Sep-2020 11:08                7036
book.mongodb.php                                   28-Sep-2020 11:08               20948
book.mqseries.php                                  28-Sep-2020 11:09                3057
book.msql.php                                      28-Sep-2020 11:09                6340
book.mysql-xdevapi.php                             28-Sep-2020 11:09               28787
book.mysql.php                                     28-Sep-2020 11:09                8014
book.mysqli.php                                    28-Sep-2020 11:09               20263
book.mysqlnd-memcache.php                          28-Sep-2020 11:09                2694
book.mysqlnd-ms.php                                28-Sep-2020 11:09                6802
book.mysqlnd-mux.php                               28-Sep-2020 11:09                2261
book.mysqlnd-qc.php                                28-Sep-2020 11:09                4585
book.mysqlnd-uh.php                                28-Sep-2020 11:09               11110
book.mysqlnd.php                                   28-Sep-2020 11:09                2341
book.ncurses.php                                   28-Sep-2020 11:08               20640
book.network.php                                   28-Sep-2020 11:09                6071
book.nsapi.php                                     28-Sep-2020 11:09                2163
book.oauth.php                                     28-Sep-2020 11:09                7068
book.oci8.php                                      28-Sep-2020 11:09               16792
book.opcache.php                                   28-Sep-2020 11:08                2561
book.openal.php                                    28-Sep-2020 11:08                4316
book.openssl.php                                   28-Sep-2020 11:08               10174
book.outcontrol.php                                28-Sep-2020 11:08                4078
book.paradox.php                                   28-Sep-2020 11:09                4415
book.parallel.php                                  28-Sep-2020 11:09                5604
book.parle.php                                     28-Sep-2020 11:09                8700
book.password.php                                  28-Sep-2020 11:08                2543
book.pcntl.php                                     28-Sep-2020 11:09                4936
book.pcre.php                                      28-Sep-2020 11:09                3760
book.pdf.php                                       28-Sep-2020 11:09               21803
book.pdo.php                                       28-Sep-2020 11:08                7814
book.pgsql.php                                     28-Sep-2020 11:09               13364
book.phar.php                                      28-Sep-2020 11:08               16496
book.phpdbg.php                                    28-Sep-2020 11:08                2796
book.pht.php                                       28-Sep-2020 11:09                6286
book.posix.php                                     28-Sep-2020 11:09                6548
book.proctitle.php                                 28-Sep-2020 11:09                2075
book.ps.php                                        28-Sep-2020 11:09                9061
book.pspell.php                                    28-Sep-2020 11:09                4452
book.pthreads.php                                  28-Sep-2020 11:09                7228
book.quickhash.php                                 28-Sep-2020 11:09                8784
book.radius.php                                    28-Sep-2020 11:08                5414
book.rar.php                                       28-Sep-2020 11:08                5154
book.readline.php                                  28-Sep-2020 11:08                3678
book.recode.php                                    28-Sep-2020 11:09                2204
book.reflection.php                                28-Sep-2020 11:09               29474
book.regex.php                                     28-Sep-2020 11:09                2979
book.rpminfo.php                                   28-Sep-2020 11:09                2283
book.rrd.php                                       28-Sep-2020 11:09                4984
book.runkit7.php                                   28-Sep-2020 11:08                4106
book.scoutapm.php                                  28-Sep-2020 11:09                2071
book.sdo-das-xml.php                               28-Sep-2020 11:09                3955
book.sdo.php                                       28-Sep-2020 11:09                8889
book.sdodasrel.php                                 28-Sep-2020 11:09                3493
book.seaslog.php                                   28-Sep-2020 11:09                5043
book.sem.php                                       28-Sep-2020 11:09                3877
book.session.php                                   28-Sep-2020 11:09                8373
book.shmop.php                                     28-Sep-2020 11:09                2752
book.simplexml.php                                 28-Sep-2020 11:09                5625
book.snmp.php                                      28-Sep-2020 11:09                5730
book.soap.php                                      28-Sep-2020 11:09                6794
book.sockets.php                                   28-Sep-2020 11:09                7148
book.sodium.php                                    28-Sep-2020 11:08               12986
book.solr.php                                      28-Sep-2020 11:09               53057
book.sphinx.php                                    28-Sep-2020 11:09                5892
book.spl-types.php                                 28-Sep-2020 11:09                2497
book.spl.php                                       28-Sep-2020 11:09                9923
book.sqlite.php                                    28-Sep-2020 11:09                6751
book.sqlite3.php                                   28-Sep-2020 11:09                6722
book.sqlsrv.php                                    28-Sep-2020 11:09                5212
book.ssdeep.php                                    28-Sep-2020 11:09                2199
book.ssh2.php                                      28-Sep-2020 11:09                4923
book.stomp.php                                     28-Sep-2020 11:09                4016
book.stream.php                                    28-Sep-2020 11:09               11448
book.strings.php                                   28-Sep-2020 11:09               13480
book.svm.php                                       28-Sep-2020 11:09                3552
book.svn.php                                       28-Sep-2020 11:09                7745
book.swoole.php                                    28-Sep-2020 11:09               36964
book.sync.php                                      28-Sep-2020 11:09                4665
book.taint.php                                     28-Sep-2020 11:09                2397
book.tcpwrap.php                                   28-Sep-2020 11:09                1921
book.tidy.php                                      28-Sep-2020 11:09                6477
book.tokenizer.php                                 28-Sep-2020 11:09                2185
book.tokyo-tyrant.php                              28-Sep-2020 11:09                7975
book.trader.php                                    28-Sep-2020 11:09               17368
book.ui.php                                        28-Sep-2020 11:09               27803
book.uodbc.php                                     28-Sep-2020 11:08                6695
book.uopz.php                                      28-Sep-2020 11:08                4977
book.url.php                                       28-Sep-2020 11:09                2894
book.v8js.php                                      28-Sep-2020 11:09                3022
book.var.php                                       28-Sep-2020 11:09                5517
book.varnish.php                                   28-Sep-2020 11:09                5239
book.wddx.php                                      28-Sep-2020 11:09                2711
book.weakref.php                                   28-Sep-2020 11:08                3551
book.win32service.php                              28-Sep-2020 11:09                4907
book.wincache.php                                  28-Sep-2020 11:08                5461
book.wkhtmltox.php                                 28-Sep-2020 11:09                3177
book.xattr.php                                     28-Sep-2020 11:09                2311
book.xdiff.php                                     28-Sep-2020 11:09                3966
book.xhprof.php                                    28-Sep-2020 11:08                2325
book.xlswriter.php                                 28-Sep-2020 11:09                4285
book.xml.php                                       28-Sep-2020 11:09                5419
book.xmldiff.php                                   28-Sep-2020 11:09                2992
book.xmlreader.php                                 28-Sep-2020 11:09                5008
book.xmlrpc.php                                    28-Sep-2020 11:09                3622
book.xmlwriter.php                                 28-Sep-2020 11:09                7001
book.xsl.php                                       28-Sep-2020 11:09                3821
book.yac.php                                       28-Sep-2020 11:08                2469
book.yaconf.php                                    28-Sep-2020 11:09                2014
book.yaf.php                                       28-Sep-2020 11:09               34526
book.yaml.php                                      28-Sep-2020 11:09                2643
book.yar.php                                       28-Sep-2020 11:09                3550
book.yaz.php                                       28-Sep-2020 11:09                4228
book.zip.php                                       28-Sep-2020 11:08               10090
book.zlib.php                                      28-Sep-2020 11:08                4871
book.zmq.php                                       28-Sep-2020 11:09                5374
book.zookeeper.php                                 28-Sep-2020 11:09                6521
bzip2.configuration.php                            28-Sep-2020 11:08                1148
bzip2.constants.php                                28-Sep-2020 11:08                1040
bzip2.examples.php                                 28-Sep-2020 11:08                4271
bzip2.installation.php                             28-Sep-2020 11:08                1253
bzip2.requirements.php                             28-Sep-2020 11:08                1271
bzip2.resources.php                                28-Sep-2020 11:08                1144
bzip2.setup.php                                    28-Sep-2020 11:08                1482
cachingiterator.construct.php                      28-Sep-2020 11:09                2648
cachingiterator.count.php                          28-Sep-2020 11:09                2376
cachingiterator.current.php                        28-Sep-2020 11:09                2786
cachingiterator.getcache.php                       28-Sep-2020 11:09                5602
cachingiterator.getflags.php                       28-Sep-2020 11:09                2385
cachingiterator.getinneriterator.php               28-Sep-2020 11:09                2516
cachingiterator.hasnext.php                        28-Sep-2020 11:09                2444
cachingiterator.key.php                            28-Sep-2020 11:09                2169
cachingiterator.next.php                           28-Sep-2020 11:09                2336
cachingiterator.offsetexists.php                   28-Sep-2020 11:09                2744
cachingiterator.offsetget.php                      28-Sep-2020 11:09                2519
cachingiterator.offsetset.php                      28-Sep-2020 11:09                3013
cachingiterator.offsetunset.php                    28-Sep-2020 11:09                2571
cachingiterator.rewind.php                         28-Sep-2020 11:09                2350
cachingiterator.setflags.php                       28-Sep-2020 11:09                2604
cachingiterator.tostring.php                       28-Sep-2020 11:09                2532
cachingiterator.valid.php                          28-Sep-2020 11:09                2481
calendar.configuration.php                         28-Sep-2020 11:09                1166
calendar.constants.php                             28-Sep-2020 11:09               11918
calendar.installation.php                          28-Sep-2020 11:09                1356
calendar.requirements.php                          28-Sep-2020 11:09                1126
calendar.resources.php                             28-Sep-2020 11:09                1109
calendar.setup.php                                 28-Sep-2020 11:09                1516
callbackfilteriterator.accept.php                  28-Sep-2020 11:09                3255
callbackfilteriterator.construct.php               28-Sep-2020 11:09                3957
cc.license.php                                     28-Sep-2020 11:09               20968
changelog.misc.php                                 28-Sep-2020 11:09                4228
changelog.mongo.php                                28-Sep-2020 11:08               32205
changelog.mysql.php                                28-Sep-2020 11:09                5173
changelog.mysqli.php                               28-Sep-2020 11:09                2138
changelog.strings.php                              28-Sep-2020 11:09               14008
class.OCI-Collection.php                           28-Sep-2020 11:09                5607
class.OCI-Lob.php                                  28-Sep-2020 11:09               10599
class.apcuiterator.php                             28-Sep-2020 11:08                6687
class.appenditerator.php                           28-Sep-2020 11:09                9204
class.argumentcounterror.php                       28-Sep-2020 11:08                5703
class.arithmeticerror.php                          28-Sep-2020 11:08                6027
class.arrayaccess.php                              28-Sep-2020 11:08               13083
class.arrayiterator.php                            28-Sep-2020 11:09               15814
class.arrayobject.php                              28-Sep-2020 11:09               15744
class.assertionerror.php                           28-Sep-2020 11:08                5718
class.badfunctioncallexception.php                 28-Sep-2020 11:09                6535
class.badmethodcallexception.php                   28-Sep-2020 11:09                6555
class.cachingiterator.php                          28-Sep-2020 11:09               13874
class.callbackfilteriterator.php                   28-Sep-2020 11:09               11201
class.closure.php                                  28-Sep-2020 11:08                6091
class.collator.php                                 28-Sep-2020 11:09               25171
class.collectable.php                              28-Sep-2020 11:09                3111
class.com-exception.php                            28-Sep-2020 11:09                5707
class.com.php                                      28-Sep-2020 11:09               12529
class.commonmark-cql.php                           28-Sep-2020 11:09                7452
class.commonmark-interfaces-ivisitable.php         28-Sep-2020 11:09                2764
class.commonmark-interfaces-ivisitor.php           28-Sep-2020 11:09                3905
class.commonmark-node-blockquote.php               28-Sep-2020 11:09                7764
class.commonmark-node-bulletlist.php               28-Sep-2020 11:09                9699
class.commonmark-node-code.php                     28-Sep-2020 11:09                8643
class.commonmark-node-codeblock.php                28-Sep-2020 11:09                9807
class.commonmark-node-customblock.php              28-Sep-2020 11:09                8270
class.commonmark-node-custominline.php             28-Sep-2020 11:09                8249
class.commonmark-node-document.php                 28-Sep-2020 11:09                7718
class.commonmark-node-heading.php                  28-Sep-2020 11:09                9058
class.commonmark-node-htmlblock.php                28-Sep-2020 11:09                8700
class.commonmark-node-htmlinline.php               28-Sep-2020 11:09                8675
class.commonmark-node-image.php                    28-Sep-2020 11:09                9696
class.commonmark-node-item.php                     28-Sep-2020 11:09                7737
class.commonmark-node-linebreak.php                28-Sep-2020 11:09                7746
class.commonmark-node-link.php                     28-Sep-2020 11:09                9690
class.commonmark-node-orderedlist.php              28-Sep-2020 11:09               10436
class.commonmark-node-paragraph.php                28-Sep-2020 11:09                7771
class.commonmark-node-softbreak.php                28-Sep-2020 11:09                7764
class.commonmark-node-text-emphasis.php            28-Sep-2020 11:09                7789
class.commonmark-node-text-strong.php              28-Sep-2020 11:09                7780
class.commonmark-node-text.php                     28-Sep-2020 11:09                9051
class.commonmark-node-thematicbreak.php            28-Sep-2020 11:09                7789
class.commonmark-node.php                          28-Sep-2020 11:09                8701
class.commonmark-parser.php                        28-Sep-2020 11:09                3545
class.compersisthelper.php                         28-Sep-2020 11:09                6453
class.compileerror.php                             28-Sep-2020 11:08                5638
class.componere-abstract-definition.php            28-Sep-2020 11:08                4507
class.componere-definition.php                     28-Sep-2020 11:08                9514
class.componere-method.php                         28-Sep-2020 11:08                4409
class.componere-patch.php                          28-Sep-2020 11:08                7944
class.componere-value.php                          28-Sep-2020 11:08                5438
class.cond.php                                     28-Sep-2020 11:09                4802
class.countable.php                                28-Sep-2020 11:09                2459
class.curlfile.php                                 28-Sep-2020 11:09                7158
class.dateinterval.php                             28-Sep-2020 11:09                8779
class.dateperiod.php                               28-Sep-2020 11:09               11054
class.datetime.php                                 28-Sep-2020 11:09               18072
class.datetimeimmutable.php                        28-Sep-2020 11:09               16596
class.datetimeinterface.php                        28-Sep-2020 11:09               13460
class.datetimezone.php                             28-Sep-2020 11:09               11535
class.directory.php                                28-Sep-2020 11:09                4852
class.directoryiterator.php                        28-Sep-2020 11:09               15533
class.divisionbyzeroerror.php                      28-Sep-2020 11:08                5690
class.domainexception.php                          28-Sep-2020 11:09                6477
class.domattr.php                                  28-Sep-2020 11:09               17023
class.domcdatasection.php                          28-Sep-2020 11:09               18210
class.domcharacterdata.php                         28-Sep-2020 11:09               18024
class.domcomment.php                               28-Sep-2020 11:09               17230
class.domdocument.php                              28-Sep-2020 11:09               43409
class.domdocumentfragment.php                      28-Sep-2020 11:09               13984
class.domdocumenttype.php                          28-Sep-2020 11:09               16678
class.domelement.php                               28-Sep-2020 11:09               26331
class.domentity.php                                28-Sep-2020 11:09               16671
class.domentityreference.php                       28-Sep-2020 11:09               13865
class.domexception.php                             28-Sep-2020 11:09                6446
class.domimplementation.php                        28-Sep-2020 11:09                5374
class.domnamednodemap.php                          28-Sep-2020 11:09                4856
class.domnode.php                                  28-Sep-2020 11:09               21047
class.domnodelist.php                              28-Sep-2020 11:09                4579
class.domnotation.php                              28-Sep-2020 11:09               13940
class.domprocessinginstruction.php                 28-Sep-2020 11:09               14933
class.domtext.php                                  28-Sep-2020 11:09               19240
class.domxpath.php                                 28-Sep-2020 11:09                5940
class.dotnet.php                                   28-Sep-2020 11:09                6194
class.ds-collection.php                            28-Sep-2020 11:09                4485
class.ds-deque.php                                 28-Sep-2020 11:09               20967
class.ds-hashable.php                              28-Sep-2020 11:09                3999
class.ds-map.php                                   28-Sep-2020 11:09               22334
class.ds-pair.php                                  28-Sep-2020 11:09                4458
class.ds-priorityqueue.php                         28-Sep-2020 11:09                8049
class.ds-queue.php                                 28-Sep-2020 11:09                6986
class.ds-sequence.php                              28-Sep-2020 11:09               18543
class.ds-set.php                                   28-Sep-2020 11:09               17567
class.ds-stack.php                                 28-Sep-2020 11:09                6480
class.ds-vector.php                                28-Sep-2020 11:09               20588
class.emptyiterator.php                            28-Sep-2020 11:09                4132
class.error.php                                    28-Sep-2020 11:08                8425
class.errorexception.php                           28-Sep-2020 11:08               11516
class.ev.php                                       28-Sep-2020 11:09               35392
class.evcheck.php                                  28-Sep-2020 11:09                9718
class.evchild.php                                  28-Sep-2020 11:09               11088
class.evembed.php                                  28-Sep-2020 11:09                9267
class.event.php                                    28-Sep-2020 11:09               17320
class.eventbase.php                                28-Sep-2020 11:09               13059
class.eventbuffer.php                              28-Sep-2020 11:09               19850
class.eventbufferevent.php                         28-Sep-2020 11:09               31515
class.eventconfig.php                              28-Sep-2020 11:09                6034
class.eventdnsbase.php                             28-Sep-2020 11:09                9826
class.eventhttp.php                                28-Sep-2020 11:09                8512
class.eventhttpconnection.php                      28-Sep-2020 11:09                9418
class.eventhttprequest.php                         28-Sep-2020 11:09               19610
class.eventlistener.php                            28-Sep-2020 11:09               10863
class.eventsslcontext.php                          28-Sep-2020 11:09               14400
class.eventutil.php                                28-Sep-2020 11:09               20021
class.evfork.php                                   28-Sep-2020 11:09                8279
class.evidle.php                                   28-Sep-2020 11:09                9063
class.evio.php                                     28-Sep-2020 11:09               11549
class.evloop.php                                   28-Sep-2020 11:09               27567
class.evperiodic.php                               28-Sep-2020 11:09               13566
class.evprepare.php                                28-Sep-2020 11:09                9938
class.evsignal.php                                 28-Sep-2020 11:09               10732
class.evstat.php                                   28-Sep-2020 11:09               13215
class.evtimer.php                                  28-Sep-2020 11:09               13074
class.evwatcher.php                                28-Sep-2020 11:09                8961
class.exception.php                                28-Sep-2020 11:08                8887
class.fannconnection.php                           28-Sep-2020 11:09                5858
class.ffi-cdata.php                                28-Sep-2020 11:08                5244
class.ffi-ctype.php                                28-Sep-2020 11:08                1503
class.ffi-exception.php                            28-Sep-2020 11:08                5638
class.ffi-parserexception.php                      28-Sep-2020 11:08                2649
class.ffi.php                                      28-Sep-2020 11:08               16674
class.filesystemiterator.php                       28-Sep-2020 11:09               21204
class.filteriterator.php                           28-Sep-2020 11:09                6130
class.finfo.php                                    28-Sep-2020 11:09                4286
class.gearmanclient.php                            28-Sep-2020 11:09               28987
class.gearmanexception.php                         28-Sep-2020 11:09                5664
class.gearmanjob.php                               28-Sep-2020 11:09               10375
class.gearmantask.php                              28-Sep-2020 11:09                8726
class.gearmanworker.php                            28-Sep-2020 11:09               11694
class.gender.php                                   28-Sep-2020 11:09               27942
class.generator.php                                28-Sep-2020 11:08                6572
class.globiterator.php                             28-Sep-2020 11:09                8946
class.gmagick.php                                  28-Sep-2020 11:09               78244
class.gmagickdraw.php                              28-Sep-2020 11:09               21562
class.gmagickpixel.php                             28-Sep-2020 11:09                5240
class.gmp.php                                      28-Sep-2020 11:09                2157
class.hashcontext.php                              28-Sep-2020 11:08                2257
class.hrtime-performancecounter.php                28-Sep-2020 11:09                3514
class.hrtime-stopwatch.php                         28-Sep-2020 11:09                6502
class.hrtime-unit.php                              28-Sep-2020 11:09                3381
class.imagick.php                                  28-Sep-2020 11:09              232357
class.imagickdraw.php                              28-Sep-2020 11:09               63391
class.imagickkernel.php                            28-Sep-2020 11:09                5632
class.imagickpixel.php                             28-Sep-2020 11:09               11131
class.imagickpixeliterator.php                     28-Sep-2020 11:09                8269
class.infiniteiterator.php                         28-Sep-2020 11:09                5949
class.intlbreakiterator.php                        28-Sep-2020 11:09               22276
class.intlcalendar.php                             28-Sep-2020 11:09               72416
class.intlchar.php                                 28-Sep-2020 11:09              283157
class.intlcodepointbreakiterator.php               28-Sep-2020 11:09               16082
class.intldateformatter.php                        28-Sep-2020 11:09               18582
class.intlexception.php                            28-Sep-2020 11:09                5840
class.intlgregoriancalendar.php                    28-Sep-2020 11:09               52202
class.intliterator.php                             28-Sep-2020 11:09                5070
class.intlpartsiterator.php                        28-Sep-2020 11:09                6589
class.intlrulebasedbreakiterator.php               28-Sep-2020 11:09               18364
class.intltimezone.php                             28-Sep-2020 11:09               16692
class.invalidargumentexception.php                 28-Sep-2020 11:09                6491
class.iterator.php                                 28-Sep-2020 11:08               12291
class.iteratoraggregate.php                        28-Sep-2020 11:08                6458
class.iteratoriterator.php                         28-Sep-2020 11:09                5984
class.jsonexception.php                            28-Sep-2020 11:09                6056
class.jsonserializable.php                         28-Sep-2020 11:09                2805
class.judy.php                                     28-Sep-2020 11:09               17370
class.lengthexception.php                          28-Sep-2020 11:09                6426
class.libxmlerror.php                              28-Sep-2020 11:09                4535
class.limititerator.php                            28-Sep-2020 11:09               10111
class.locale.php                                   28-Sep-2020 11:09               19540
class.logicexception.php                           28-Sep-2020 11:09                6487
class.lua.php                                      28-Sep-2020 11:09                6982
class.luaclosure.php                               28-Sep-2020 11:09                2505
class.luasandbox.php                               28-Sep-2020 11:09               12503
class.luasandboxerror.php                          28-Sep-2020 11:09                7337
class.luasandboxerrorerror.php                     28-Sep-2020 11:09                5734
class.luasandboxfatalerror.php                     28-Sep-2020 11:09                5856
class.luasandboxfunction.php                       28-Sep-2020 11:09                3552
class.luasandboxmemoryerror.php                    28-Sep-2020 11:09                6059
class.luasandboxruntimeerror.php                   28-Sep-2020 11:09                5874
class.luasandboxsyntaxerror.php                    28-Sep-2020 11:09                5737
class.luasandboxtimeouterror.php                   28-Sep-2020 11:09                6042
class.memcache.php                                 28-Sep-2020 11:09               13736
class.memcached.php                                28-Sep-2020 11:09               34020
class.memcachedexception.php                       28-Sep-2020 11:09                5620
class.messageformatter.php                         28-Sep-2020 11:09               10471
class.mongo.php                                    28-Sep-2020 11:08               12370
class.mongobindata.php                             28-Sep-2020 11:08               10427
class.mongoclient.php                              28-Sep-2020 11:08               19553
class.mongocode.php                                28-Sep-2020 11:08                3509
class.mongocollection.php                          28-Sep-2020 11:08               26510
class.mongocommandcursor.php                       28-Sep-2020 11:08               13312
class.mongoconnectionexception.php                 28-Sep-2020 11:08                5410
class.mongocursor.php                              28-Sep-2020 11:08               27511
class.mongocursorexception.php                     28-Sep-2020 11:08               19086
class.mongocursorinterface.php                     28-Sep-2020 11:08                7998
class.mongocursortimeoutexception.php              28-Sep-2020 11:08                2458
class.mongodate.php                                28-Sep-2020 11:08                7027
class.mongodb-bson-binary.php                      28-Sep-2020 11:08               11909
class.mongodb-bson-binaryinterface.php             28-Sep-2020 11:08                3701
class.mongodb-bson-dbpointer.php                   28-Sep-2020 11:08                5370
class.mongodb-bson-decimal128.php                  28-Sep-2020 11:08                7375
class.mongodb-bson-decimal128interface.php         28-Sep-2020 11:08                2839
class.mongodb-bson-int64.php                       28-Sep-2020 11:08                6103
class.mongodb-bson-javascript.php                  28-Sep-2020 11:08                7988
class.mongodb-bson-javascriptinterface.php         28-Sep-2020 11:08                3859
class.mongodb-bson-maxkey.php                      28-Sep-2020 11:08                5889
class.mongodb-bson-maxkeyinterface.php             28-Sep-2020 11:08                1977
class.mongodb-bson-minkey.php                      28-Sep-2020 11:08                5880
class.mongodb-bson-minkeyinterface.php             28-Sep-2020 11:08                1958
class.mongodb-bson-objectid.php                    28-Sep-2020 11:08                8577
class.mongodb-bson-objectidinterface.php           28-Sep-2020 11:08                3324
class.mongodb-bson-persistable.php                 28-Sep-2020 11:08                4570
class.mongodb-bson-regex.php                       28-Sep-2020 11:08                7709
class.mongodb-bson-regexinterface.php              28-Sep-2020 11:08                3719
class.mongodb-bson-serializable.php                28-Sep-2020 11:08                3000
class.mongodb-bson-symbol.php                      28-Sep-2020 11:08                5261
class.mongodb-bson-timestamp.php                   28-Sep-2020 11:08                7931
class.mongodb-bson-timestampinterface.php          28-Sep-2020 11:08                3877
class.mongodb-bson-type.php                        28-Sep-2020 11:08                1859
class.mongodb-bson-undefined.php                   28-Sep-2020 11:08                5346
class.mongodb-bson-unserializable.php              28-Sep-2020 11:08                2964
class.mongodb-bson-utcdatetime.php                 28-Sep-2020 11:08                7319
class.mongodb-bson-utcdatetimeinterface.php        28-Sep-2020 11:08                3452
class.mongodb-driver-bulkwrite.php                 28-Sep-2020 11:08               25506
class.mongodb-driver-clientencryption.php          28-Sep-2020 11:08                6367
class.mongodb-driver-command.php                   28-Sep-2020 11:08               15703
class.mongodb-driver-cursor.php                    28-Sep-2020 11:08               25214
class.mongodb-driver-cursorid.php                  28-Sep-2020 11:08                4979
class.mongodb-driver-cursorinterface.php           28-Sep-2020 11:08                5233
class.mongodb-driver-exception-authenticationex..> 28-Sep-2020 11:08                6935
class.mongodb-driver-exception-bulkwriteexcepti..> 28-Sep-2020 11:08                7706
class.mongodb-driver-exception-commandexception..> 28-Sep-2020 11:08                8495
class.mongodb-driver-exception-connectionexcept..> 28-Sep-2020 11:08                7008
class.mongodb-driver-exception-connectiontimeou..> 28-Sep-2020 11:08                7389
class.mongodb-driver-exception-encryptionexcept..> 28-Sep-2020 11:08                6942
class.mongodb-driver-exception-exception.php       28-Sep-2020 11:08                2002
class.mongodb-driver-exception-executiontimeout..> 28-Sep-2020 11:08                7962
class.mongodb-driver-exception-invalidargumente..> 28-Sep-2020 11:08                6306
class.mongodb-driver-exception-logicexception.php  28-Sep-2020 11:08                6200
class.mongodb-driver-exception-runtimeexception..> 28-Sep-2020 11:08                9446
class.mongodb-driver-exception-serverexception.php 28-Sep-2020 11:08                7023
class.mongodb-driver-exception-sslconnectionexc..> 28-Sep-2020 11:08                7283
class.mongodb-driver-exception-unexpectedvaluee..> 28-Sep-2020 11:08                6323
class.mongodb-driver-exception-writeexception.php  28-Sep-2020 11:09                9754
class.mongodb-driver-manager.php                   28-Sep-2020 11:08               16987
class.mongodb-driver-monitoring-commandfailedev..> 28-Sep-2020 11:08                6475
class.mongodb-driver-monitoring-commandstartede..> 28-Sep-2020 11:08                5911
class.mongodb-driver-monitoring-commandsubscrib..> 28-Sep-2020 11:08                5288
class.mongodb-driver-monitoring-commandsucceede..> 28-Sep-2020 11:08                5977
class.mongodb-driver-monitoring-subscriber.php     28-Sep-2020 11:08                2435
class.mongodb-driver-query.php                     28-Sep-2020 11:08                2877
class.mongodb-driver-readconcern.php               28-Sep-2020 11:08               13215
class.mongodb-driver-readpreference.php            28-Sep-2020 11:08               16677
class.mongodb-driver-server.php                    28-Sep-2020 11:08               20214
class.mongodb-driver-session.php                   28-Sep-2020 11:08               12847
class.mongodb-driver-writeconcern.php              28-Sep-2020 11:08                8934
class.mongodb-driver-writeconcernerror.php         28-Sep-2020 11:08                4041
class.mongodb-driver-writeerror.php                28-Sep-2020 11:08                4404
class.mongodb-driver-writeresult.php               28-Sep-2020 11:08                8051
class.mongodb.php                                  28-Sep-2020 11:08               23966
class.mongodbref.php                               28-Sep-2020 11:08               12573
class.mongodeletebatch.php                         28-Sep-2020 11:08                3717
class.mongoduplicatekeyexception.php               28-Sep-2020 11:08                5822
class.mongoexception.php                           28-Sep-2020 11:08                7740
class.mongoexecutiontimeoutexception.php           28-Sep-2020 11:08                2977
class.mongogridfs.php                              28-Sep-2020 11:08               27375
class.mongogridfscursor.php                        28-Sep-2020 11:08                4754
class.mongogridfsexception.php                     28-Sep-2020 11:08                5262
class.mongogridfsfile.php                          28-Sep-2020 11:08                5380
class.mongoid.php                                  28-Sep-2020 11:08                8686
class.mongoinsertbatch.php                         28-Sep-2020 11:08                3709
class.mongoint32.php                               28-Sep-2020 11:08                3838
class.mongoint64.php                               28-Sep-2020 11:08                3834
class.mongolog.php                                 28-Sep-2020 11:08               17006
class.mongomaxkey.php                              28-Sep-2020 11:08                5521
class.mongominkey.php                              28-Sep-2020 11:08                5516
class.mongopool.php                                28-Sep-2020 11:08                4152
class.mongoprotocolexception.php                   28-Sep-2020 11:08                5298
class.mongoregex.php                               28-Sep-2020 11:08                5137
class.mongoresultexception.php                     28-Sep-2020 11:08                4288
class.mongotimestamp.php                           28-Sep-2020 11:08                4566
class.mongoupdatebatch.php                         28-Sep-2020 11:08                3717
class.mongowritebatch.php                          28-Sep-2020 11:08               11858
class.mongowriteconcernexception.php               28-Sep-2020 11:08                4229
class.multipleiterator.php                         28-Sep-2020 11:09               10011
class.mutex.php                                    28-Sep-2020 11:09                4707
class.mysql-xdevapi-baseresult.php                 28-Sep-2020 11:09                2857
class.mysql-xdevapi-client.php                     28-Sep-2020 11:09                2996
class.mysql-xdevapi-collection.php                 28-Sep-2020 11:09               10085
class.mysql-xdevapi-collectionadd.php              28-Sep-2020 11:09                2830
class.mysql-xdevapi-collectionfind.php             28-Sep-2020 11:09                8430
class.mysql-xdevapi-collectionmodify.php           28-Sep-2020 11:09                9732
class.mysql-xdevapi-collectionremove.php           28-Sep-2020 11:09                5136
class.mysql-xdevapi-columnresult.php               28-Sep-2020 11:09                6522
class.mysql-xdevapi-crudoperationbindable.php      28-Sep-2020 11:09                2748
class.mysql-xdevapi-crudoperationlimitable.php     28-Sep-2020 11:09                2757
class.mysql-xdevapi-crudoperationskippable.php     28-Sep-2020 11:09                2768
class.mysql-xdevapi-crudoperationsortable.php      28-Sep-2020 11:09                2743
class.mysql-xdevapi-databaseobject.php             28-Sep-2020 11:09                3399
class.mysql-xdevapi-docresult.php                  28-Sep-2020 11:09                3918
class.mysql-xdevapi-exception.php                  28-Sep-2020 11:09                2037
class.mysql-xdevapi-executable.php                 28-Sep-2020 11:09                2496
class.mysql-xdevapi-executionstatus.php            28-Sep-2020 11:09                4139
class.mysql-xdevapi-expression.php                 28-Sep-2020 11:09                2931
class.mysql-xdevapi-result.php                     28-Sep-2020 11:09                4299
class.mysql-xdevapi-rowresult.php                  28-Sep-2020 11:09                5001
class.mysql-xdevapi-schema.php                     28-Sep-2020 11:09                7145
class.mysql-xdevapi-schemaobject.php               28-Sep-2020 11:09                2694
class.mysql-xdevapi-session.php                    28-Sep-2020 11:09                8918
class.mysql-xdevapi-sqlstatement.php               28-Sep-2020 11:09                5944
class.mysql-xdevapi-sqlstatementresult.php         28-Sep-2020 11:09                7203
class.mysql-xdevapi-statement.php                  28-Sep-2020 11:09                4425
class.mysql-xdevapi-table.php                      28-Sep-2020 11:09                7470
class.mysql-xdevapi-tabledelete.php                28-Sep-2020 11:09                4899
class.mysql-xdevapi-tableinsert.php                28-Sep-2020 11:09                3349
class.mysql-xdevapi-tableselect.php                28-Sep-2020 11:09                7949
class.mysql-xdevapi-tableupdate.php                28-Sep-2020 11:09                5830
class.mysql-xdevapi-warning.php                    28-Sep-2020 11:09                3342
class.mysqli-driver.php                            28-Sep-2020 11:09                6532
class.mysqli-result.php                            28-Sep-2020 11:09                9977
class.mysqli-sql-exception.php                     28-Sep-2020 11:09                3126
class.mysqli-stmt.php                              28-Sep-2020 11:09               14372
class.mysqli-warning.php                           28-Sep-2020 11:09                3742
class.mysqli.php                                   28-Sep-2020 11:09               30998
class.mysqlnduhconnection.php                      28-Sep-2020 11:09               35858
class.mysqlnduhpreparedstatement.php               28-Sep-2020 11:09                3716
class.norewinditerator.php                         28-Sep-2020 11:09                7886
class.normalizer.php                               28-Sep-2020 11:09                8313
class.numberformatter.php                          28-Sep-2020 11:09               43168
class.oauth.php                                    28-Sep-2020 11:09               16585
class.oauthexception.php                           28-Sep-2020 11:09                6508
class.oauthprovider.php                            28-Sep-2020 11:09               11638
class.outeriterator.php                            28-Sep-2020 11:09                4515
class.outofboundsexception.php                     28-Sep-2020 11:09                6530
class.outofrangeexception.php                      28-Sep-2020 11:09                6533
class.overflowexception.php                        28-Sep-2020 11:09                6454
class.parallel-channel.php                         28-Sep-2020 11:09                8031
class.parallel-events-event-type.php               28-Sep-2020 11:09                2994
class.parallel-events-event.php                    28-Sep-2020 11:09                3026
class.parallel-events-input.php                    28-Sep-2020 11:09                4367
class.parallel-events.php                          28-Sep-2020 11:09                6642
class.parallel-future.php                          28-Sep-2020 11:09                8303
class.parallel-runtime.php                         28-Sep-2020 11:09                6120
class.parallel-sync.php                            28-Sep-2020 11:09                5242
class.parentiterator.php                           28-Sep-2020 11:09                5844
class.parle-errorinfo.php                          28-Sep-2020 11:09                3270
class.parle-lexer.php                              28-Sep-2020 11:09               11018
class.parle-lexerexception.php                     28-Sep-2020 11:09                5891
class.parle-parser.php                             28-Sep-2020 11:09               14050
class.parle-parserexception.php                    28-Sep-2020 11:09                5872
class.parle-rlexer.php                             28-Sep-2020 11:09               12622
class.parle-rparser.php                            28-Sep-2020 11:09               14145
class.parle-stack.php                              28-Sep-2020 11:09                4315
class.parle-token.php                              28-Sep-2020 11:09                3897
class.parseerror.php                               28-Sep-2020 11:08                6067
class.pdo.php                                      28-Sep-2020 11:08                9281
class.pdoexception.php                             28-Sep-2020 11:08                7138
class.pdostatement.php                             28-Sep-2020 11:08               14762
class.phar.php                                     28-Sep-2020 11:08               36426
class.phardata.php                                 28-Sep-2020 11:08               42702
class.pharexception.php                            28-Sep-2020 11:08                5672
class.pharfileinfo.php                             28-Sep-2020 11:08               10781
class.php-user-filter.php                          28-Sep-2020 11:09                4646
class.pht-atomicinteger.php                        28-Sep-2020 11:09                6067
class.pht-hashtable.php                            28-Sep-2020 11:09                4193
class.pht-queue.php                                28-Sep-2020 11:09                5003
class.pht-runnable.php                             28-Sep-2020 11:09                2526
class.pht-thread.php                               28-Sep-2020 11:09                5948
class.pht-threaded.php                             28-Sep-2020 11:09                3558
class.pht-vector.php                               28-Sep-2020 11:09                9325
class.pool.php                                     28-Sep-2020 11:09                6818
class.quickhashinthash.php                         28-Sep-2020 11:09               11843
class.quickhashintset.php                          28-Sep-2020 11:09               10064
class.quickhashintstringhash.php                   28-Sep-2020 11:09               12703
class.quickhashstringinthash.php                   28-Sep-2020 11:09               11171
class.rangeexception.php                           28-Sep-2020 11:09                6635
class.rararchive.php                               28-Sep-2020 11:08                6954
class.rarentry.php                                 28-Sep-2020 11:08               38212
class.rarexception.php                             28-Sep-2020 11:08                8082
class.recursivearrayiterator.php                   28-Sep-2020 11:09               14886
class.recursivecachingiterator.php                 28-Sep-2020 11:09               12549
class.recursivecallbackfilteriterator.php          28-Sep-2020 11:09               10405
class.recursivedirectoryiterator.php               28-Sep-2020 11:09               13168
class.recursivefilteriterator.php                  28-Sep-2020 11:09                7381
class.recursiveiterator.php                        28-Sep-2020 11:09                5043
class.recursiveiteratoriterator.php                28-Sep-2020 11:09               13637
class.recursiveregexiterator.php                   28-Sep-2020 11:09                9287
class.recursivetreeiterator.php                    28-Sep-2020 11:09               22840
class.reflection.php                               28-Sep-2020 11:09                3088
class.reflectionclass.php                          28-Sep-2020 11:09               29432
class.reflectionclassconstant.php                  28-Sep-2020 11:09                8912
class.reflectionexception.php                      28-Sep-2020 11:09                5623
class.reflectionextension.php                      28-Sep-2020 11:09                9523
class.reflectionfunction.php                       28-Sep-2020 11:09               16752
class.reflectionfunctionabstract.php               28-Sep-2020 11:09               15395
class.reflectiongenerator.php                      28-Sep-2020 11:09                5544
class.reflectionmethod.php                         28-Sep-2020 11:09               24323
class.reflectionnamedtype.php                      28-Sep-2020 11:09                3532
class.reflectionobject.php                         28-Sep-2020 11:09               23590
class.reflectionparameter.php                      28-Sep-2020 11:09               13889
class.reflectionproperty.php                       28-Sep-2020 11:09               14852
class.reflectionreference.php                      28-Sep-2020 11:09                3460
class.reflectiontype.php                           28-Sep-2020 11:09                3212
class.reflectionzendextension.php                  28-Sep-2020 11:09                6796
class.reflector.php                                28-Sep-2020 11:09                2737
class.regexiterator.php                            28-Sep-2020 11:09               13162
class.resourcebundle.php                           28-Sep-2020 11:09                7518
class.rrdcreator.php                               28-Sep-2020 11:09                3976
class.rrdgraph.php                                 28-Sep-2020 11:09                3610
class.rrdupdater.php                               28-Sep-2020 11:09                2922
class.runtimeexception.php                         28-Sep-2020 11:09                6442
class.seaslog.php                                  28-Sep-2020 11:09               17340
class.seekableiterator.php                         28-Sep-2020 11:09               12995
class.serializable.php                             28-Sep-2020 11:08                8008
class.sessionhandler.php                           28-Sep-2020 11:09               26916
class.sessionhandlerinterface.php                  28-Sep-2020 11:09               15776
class.sessionidinterface.php                       28-Sep-2020 11:09                3046
class.sessionupdatetimestamphandlerinterface.php   28-Sep-2020 11:09                4060
class.simplexmlelement.php                         28-Sep-2020 11:09               10882
class.simplexmliterator.php                        28-Sep-2020 11:09               12725
class.snmp.php                                     28-Sep-2020 11:09               21670
class.snmpexception.php                            28-Sep-2020 11:09                6498
class.soapclient.php                               28-Sep-2020 11:09               10700
class.soapfault.php                                28-Sep-2020 11:09                8185
class.soapheader.php                               28-Sep-2020 11:09                3770
class.soapparam.php                                28-Sep-2020 11:09                3005
class.soapserver.php                               28-Sep-2020 11:09                7920
class.soapvar.php                                  28-Sep-2020 11:09                3939
class.solrclient.php                               28-Sep-2020 11:09               20500
class.solrclientexception.php                      28-Sep-2020 11:09                7380
class.solrcollapsefunction.php                     28-Sep-2020 11:09               10381
class.solrdismaxquery.php                          28-Sep-2020 11:09               98848
class.solrdocument.php                             28-Sep-2020 11:09               20743
class.solrdocumentfield.php                        28-Sep-2020 11:09                4177
class.solrexception.php                            28-Sep-2020 11:09                7795
class.solrgenericresponse.php                      28-Sep-2020 11:09               10171
class.solrillegalargumentexception.php             28-Sep-2020 11:09                7495
class.solrillegaloperationexception.php            28-Sep-2020 11:09                7532
class.solrinputdocument.php                        28-Sep-2020 11:09               16610
class.solrmissingmandatoryparameterexception.php   28-Sep-2020 11:09                6619
class.solrmodifiableparams.php                     28-Sep-2020 11:09                8190
class.solrobject.php                               28-Sep-2020 11:09                5492
class.solrparams.php                               28-Sep-2020 11:09                8232
class.solrpingresponse.php                         28-Sep-2020 11:09               10507
class.solrquery.php                                28-Sep-2020 11:09              107357
class.solrqueryresponse.php                        28-Sep-2020 11:09               10108
class.solrresponse.php                             28-Sep-2020 11:09               12097
class.solrserverexception.php                      28-Sep-2020 11:09                7386
class.solrupdateresponse.php                       28-Sep-2020 11:09               10147
class.solrutils.php                                28-Sep-2020 11:09                4330
class.sphinxclient.php                             28-Sep-2020 11:09               22083
class.splbool.php                                  28-Sep-2020 11:09                5232
class.spldoublylinkedlist.php                      28-Sep-2020 11:09               17441
class.splenum.php                                  28-Sep-2020 11:09                8631
class.splfileinfo.php                              28-Sep-2020 11:09               14539
class.splfileobject.php                            28-Sep-2020 11:09               30027
class.splfixedarray.php                            28-Sep-2020 11:09               16582
class.splfloat.php                                 28-Sep-2020 11:09                5209
class.splheap.php                                  28-Sep-2020 11:09                8559
class.splint.php                                   28-Sep-2020 11:09                4740
class.splmaxheap.php                               28-Sep-2020 11:09                7851
class.splminheap.php                               28-Sep-2020 11:09                7861
class.splobjectstorage.php                         28-Sep-2020 11:09               20610
class.splobserver.php                              28-Sep-2020 11:09                2678
class.splpriorityqueue.php                         28-Sep-2020 11:09               10406
class.splqueue.php                                 28-Sep-2020 11:09               13739
class.splstack.php                                 28-Sep-2020 11:09               12826
class.splstring.php                                28-Sep-2020 11:09                4893
class.splsubject.php                               28-Sep-2020 11:09                3647
class.spltempfileobject.php                        28-Sep-2020 11:09               15748
class.spltype.php                                  28-Sep-2020 11:09                3110
class.spoofchecker.php                             28-Sep-2020 11:09               11932
class.sqlite3.php                                  28-Sep-2020 11:09               14925
class.sqlite3result.php                            28-Sep-2020 11:09                4653
class.sqlite3stmt.php                              28-Sep-2020 11:09                6604
class.stomp.php                                    28-Sep-2020 11:09                9772
class.stompexception.php                           28-Sep-2020 11:09                5703
class.stompframe.php                               28-Sep-2020 11:09                3679
class.streamwrapper.php                            28-Sep-2020 11:09               17129
class.svm.php                                      28-Sep-2020 11:09               13921
class.svmmodel.php                                 28-Sep-2020 11:09                6215
class.swoole-async.php                             28-Sep-2020 11:09                6530
class.swoole-atomic.php                            28-Sep-2020 11:09                4363
class.swoole-buffer.php                            28-Sep-2020 11:09                6650
class.swoole-channel.php                           28-Sep-2020 11:09                3745
class.swoole-client.php                            28-Sep-2020 11:09               13648
class.swoole-connection-iterator.php               28-Sep-2020 11:09                7390
class.swoole-coroutine.php                         28-Sep-2020 11:09               21867
class.swoole-event.php                             28-Sep-2020 11:09                6276
class.swoole-exception.php                         28-Sep-2020 11:09                2652
class.swoole-http-client.php                       28-Sep-2020 11:09               12538
class.swoole-http-request.php                      28-Sep-2020 11:09                2833
class.swoole-http-response.php                     28-Sep-2020 11:09                8672
class.swoole-http-server.php                       28-Sep-2020 11:09               21761
class.swoole-lock.php                              28-Sep-2020 11:09                4629
class.swoole-mmap.php                              28-Sep-2020 11:09                2678
class.swoole-mysql-exception.php                   28-Sep-2020 11:09                2687
class.swoole-mysql.php                             28-Sep-2020 11:09                5214
class.swoole-process.php                           28-Sep-2020 11:09               11921
class.swoole-redis-server.php                      28-Sep-2020 11:09               25437
class.swoole-serialize.php                         28-Sep-2020 11:09                3199
class.swoole-server.php                            28-Sep-2020 11:09               24947
class.swoole-table.php                             28-Sep-2020 11:09               11105
class.swoole-timer.php                             28-Sep-2020 11:09                4413
class.swoole-websocket-frame.php                   28-Sep-2020 11:09                1729
class.swoole-websocket-server.php                  28-Sep-2020 11:09                6635
class.syncevent.php                                28-Sep-2020 11:09                4285
class.syncmutex.php                                28-Sep-2020 11:09                3681
class.syncreaderwriter.php                         28-Sep-2020 11:09                4679
class.syncsemaphore.php                            28-Sep-2020 11:09                3969
class.syncsharedmemory.php                         28-Sep-2020 11:09                4914
class.thread.php                                   28-Sep-2020 11:09               13857
class.threaded.php                                 28-Sep-2020 11:09               10671
class.throwable.php                                28-Sep-2020 11:08                6233
class.tidy.php                                     28-Sep-2020 11:09               12392
class.tidynode.php                                 28-Sep-2020 11:09                9697
class.tokyotyrant.php                              28-Sep-2020 11:09               35476
class.tokyotyrantexception.php                     28-Sep-2020 11:09                6316
class.tokyotyrantiterator.php                      28-Sep-2020 11:09               17419
class.tokyotyrantquery.php                         28-Sep-2020 11:09                8797
class.tokyotyranttable.php                         28-Sep-2020 11:09               21590
class.transliterator.php                           28-Sep-2020 11:09                7639
class.traversable.php                              28-Sep-2020 11:08                3864
class.typeerror.php                                28-Sep-2020 11:08                5952
class.uconverter.php                               28-Sep-2020 11:09               27415
class.ui-area.php                                  28-Sep-2020 11:09               11012
class.ui-control.php                               28-Sep-2020 11:09                5571
class.ui-controls-box.php                          28-Sep-2020 11:09                9355
class.ui-controls-button.php                       28-Sep-2020 11:09                6713
class.ui-controls-check.php                        28-Sep-2020 11:09                7506
class.ui-controls-colorbutton.php                  28-Sep-2020 11:09                6744
class.ui-controls-combo.php                        28-Sep-2020 11:09                6686
class.ui-controls-editablecombo.php                28-Sep-2020 11:09                6786
class.ui-controls-entry.php                        28-Sep-2020 11:09                8931
class.ui-controls-form.php                         28-Sep-2020 11:09                7686
class.ui-controls-grid.php                         28-Sep-2020 11:09               10603
class.ui-controls-group.php                        28-Sep-2020 11:09                8211
class.ui-controls-label.php                        28-Sep-2020 11:09                6414
class.ui-controls-multilineentry.php               28-Sep-2020 11:09                9254
class.ui-controls-picker.php                       28-Sep-2020 11:09                6911
class.ui-controls-progress.php                     28-Sep-2020 11:09                5962
class.ui-controls-radio.php                        28-Sep-2020 11:09                6665
class.ui-controls-separator.php                    28-Sep-2020 11:09                6612
class.ui-controls-slider.php                       28-Sep-2020 11:09                7000
class.ui-controls-spin.php                         28-Sep-2020 11:09                6872
class.ui-controls-tab.php                          28-Sep-2020 11:09                8649
class.ui-draw-brush-gradient.php                   28-Sep-2020 11:09                6376
class.ui-draw-brush-lineargradient.php             28-Sep-2020 11:09                5666
class.ui-draw-brush-radialgradient.php             28-Sep-2020 11:09                5798
class.ui-draw-brush.php                            28-Sep-2020 11:09                4171
class.ui-draw-color.php                            28-Sep-2020 11:09                6900
class.ui-draw-line-cap.php                         28-Sep-2020 11:09                2193
class.ui-draw-line-join.php                        28-Sep-2020 11:09                2152
class.ui-draw-matrix.php                           28-Sep-2020 11:09                5485
class.ui-draw-path.php                             28-Sep-2020 11:09                8844
class.ui-draw-pen.php                              28-Sep-2020 11:09                8078
class.ui-draw-stroke.php                           28-Sep-2020 11:09                6163
class.ui-draw-text-font-descriptor.php             28-Sep-2020 11:09                5394
class.ui-draw-text-font-italic.php                 28-Sep-2020 11:09                2393
class.ui-draw-text-font-stretch.php                28-Sep-2020 11:09                3665
class.ui-draw-text-font-weight.php                 28-Sep-2020 11:09                3537
class.ui-draw-text-font.php                        28-Sep-2020 11:09                4646
class.ui-draw-text-layout.php                      28-Sep-2020 11:09                4618
class.ui-exception-invalidargumentexception.php    28-Sep-2020 11:09                5893
class.ui-exception-runtimeexception.php            28-Sep-2020 11:09                5888
class.ui-executor.php                              28-Sep-2020 11:09                4935
class.ui-key.php                                   28-Sep-2020 11:09                7963
class.ui-menu.php                                  28-Sep-2020 11:09                5769
class.ui-menuitem.php                              28-Sep-2020 11:09                3658
class.ui-point.php                                 28-Sep-2020 11:09                5749
class.ui-size.php                                  28-Sep-2020 11:09                5842
class.ui-window.php                                28-Sep-2020 11:09               12643
class.underflowexception.php                       28-Sep-2020 11:09                6524
class.unexpectedvalueexception.php                 28-Sep-2020 11:09                6679
class.v8js.php                                     28-Sep-2020 11:09                7527
class.v8jsexception.php                            28-Sep-2020 11:09                9070
class.variant.php                                  28-Sep-2020 11:09                5502
class.varnishadmin.php                             28-Sep-2020 11:09               10340
class.varnishlog.php                               28-Sep-2020 11:09               23241
class.varnishstat.php                              28-Sep-2020 11:09                2716
class.volatile.php                                 28-Sep-2020 11:09               13497
class.vtiful-kernel-excel.php                      28-Sep-2020 11:09               10125
class.vtiful-kernel-format.php                     28-Sep-2020 11:09               11073
class.weakmap.php                                  28-Sep-2020 11:08                9708
class.weakref.php                                  28-Sep-2020 11:08                7646
class.weakreference.php                            28-Sep-2020 11:08                5739
class.wkhtmltox-image-converter.php                28-Sep-2020 11:09                3675
class.wkhtmltox-pdf-converter.php                  28-Sep-2020 11:09                4083
class.wkhtmltox-pdf-object.php                     28-Sep-2020 11:09                2643
class.worker.php                                   28-Sep-2020 11:09                9544
class.xmldiff-base.php                             28-Sep-2020 11:09                4026
class.xmldiff-dom.php                              28-Sep-2020 11:09                5398
class.xmldiff-file.php                             28-Sep-2020 11:09                5013
class.xmldiff-memory.php                           28-Sep-2020 11:09                5043
class.xmlreader.php                                28-Sep-2020 11:09               29594
class.xsltprocessor.php                            28-Sep-2020 11:09                8375
class.yac.php                                      28-Sep-2020 11:08                8282
class.yaconf.php                                   28-Sep-2020 11:09                3189
class.yaf-action-abstract.php                      28-Sep-2020 11:09               12415
class.yaf-application.php                          28-Sep-2020 11:09               12192
class.yaf-bootstrap-abstract.php                   28-Sep-2020 11:09                6011
class.yaf-config-abstract.php                      28-Sep-2020 11:09                4870
class.yaf-config-ini.php                           28-Sep-2020 11:09               17159
class.yaf-config-simple.php                        28-Sep-2020 11:09               12540
class.yaf-controller-abstract.php                  28-Sep-2020 11:09               18149
class.yaf-dispatcher.php                           28-Sep-2020 11:09               18730
class.yaf-exception-dispatchfailed.php             28-Sep-2020 11:09                2718
class.yaf-exception-loadfailed-action.php          28-Sep-2020 11:09                2786
class.yaf-exception-loadfailed-controller.php      28-Sep-2020 11:09                2807
class.yaf-exception-loadfailed-module.php          28-Sep-2020 11:09                2775
class.yaf-exception-loadfailed-view.php            28-Sep-2020 11:09                2717
class.yaf-exception-loadfailed.php                 28-Sep-2020 11:09                2696
class.yaf-exception-routerfailed.php               28-Sep-2020 11:09                2705
class.yaf-exception-startuperror.php               28-Sep-2020 11:09                2703
class.yaf-exception-typeerror.php                  28-Sep-2020 11:09                2677
class.yaf-exception.php                            28-Sep-2020 11:09                6673
class.yaf-loader.php                               28-Sep-2020 11:09               17799
class.yaf-plugin-abstract.php                      28-Sep-2020 11:09               18351
class.yaf-registry.php                             28-Sep-2020 11:09                5327
class.yaf-request-abstract.php                     28-Sep-2020 11:09               20839
class.yaf-request-http.php                         28-Sep-2020 11:09               21356
class.yaf-request-simple.php                       28-Sep-2020 11:09               20460
class.yaf-response-abstract.php                    28-Sep-2020 11:09               10323
class.yaf-route-interface.php                      28-Sep-2020 11:09                3264
class.yaf-route-map.php                            28-Sep-2020 11:09                5729
class.yaf-route-regex.php                          28-Sep-2020 11:09                6747
class.yaf-route-rewrite.php                        28-Sep-2020 11:09                6379
class.yaf-route-simple.php                         28-Sep-2020 11:09                5583
class.yaf-route-static.php                         28-Sep-2020 11:09                4377
class.yaf-route-supervar.php                       28-Sep-2020 11:09                4172
class.yaf-router.php                               28-Sep-2020 11:09               11415
class.yaf-session.php                              28-Sep-2020 11:09               11785
class.yaf-view-interface.php                       28-Sep-2020 11:09                5205
class.yaf-view-simple.php                          28-Sep-2020 11:09                9506
class.yar-client-exception.php                     28-Sep-2020 11:09                6471
class.yar-client.php                               28-Sep-2020 11:09                4949
class.yar-concurrent-client.php                    28-Sep-2020 11:09                5443
class.yar-server-exception.php                     28-Sep-2020 11:09                6830
class.yar-server.php                               28-Sep-2020 11:09                3161
class.ziparchive.php                               28-Sep-2020 11:08               34941
class.zmq.php                                      28-Sep-2020 11:09               29865
class.zmqcontext.php                               28-Sep-2020 11:09                5048
class.zmqdevice.php                                28-Sep-2020 11:09                6798
class.zmqpoll.php                                  28-Sep-2020 11:09                4771
class.zmqsocket.php                                28-Sep-2020 11:09               10145
class.zookeeper.php                                28-Sep-2020 11:09               41832
class.zookeeperauthenticationexception.php         28-Sep-2020 11:09                5806
class.zookeeperconfig.php                          28-Sep-2020 11:09                5366
class.zookeeperconnectionexception.php             28-Sep-2020 11:09                5805
class.zookeeperexception.php                       28-Sep-2020 11:09                5681
class.zookeepermarshallingexception.php            28-Sep-2020 11:09                5825
class.zookeepernonodeexception.php                 28-Sep-2020 11:09                5797
class.zookeeperoperationtimeoutexception.php       28-Sep-2020 11:09                5830
class.zookeepersessionexception.php                28-Sep-2020 11:09                5758
classkit.configuration.php                         28-Sep-2020 11:09                1163
classkit.constants.php                             28-Sep-2020 11:09                2269
classkit.installation.php                          28-Sep-2020 11:09                1475
classkit.requirements.php                          28-Sep-2020 11:09                1126
classkit.resources.php                             28-Sep-2020 11:09                1109
classkit.setup.php                                 28-Sep-2020 11:09                1506
classobj.configuration.php                         28-Sep-2020 11:09                1166
classobj.constants.php                             28-Sep-2020 11:09                1068
classobj.examples.php                              28-Sep-2020 11:09               15453
classobj.installation.php                          28-Sep-2020 11:09                1150
classobj.requirements.php                          28-Sep-2020 11:09                1126
classobj.resources.php                             28-Sep-2020 11:09                1109
classobj.setup.php                                 28-Sep-2020 11:09                1502
closure.bind.php                                   28-Sep-2020 11:08                8104
closure.bindto.php                                 28-Sep-2020 11:08                9387
closure.call.php                                   28-Sep-2020 11:08                6524
closure.construct.php                              28-Sep-2020 11:08                2622
closure.fromcallable.php                           28-Sep-2020 11:08                2951
cmark.installation.php                             28-Sep-2020 11:09                1862
cmark.requirements.php                             28-Sep-2020 11:09                1197
cmark.setup.php                                    28-Sep-2020 11:09                1331
collator.asort.php                                 28-Sep-2020 11:09                8760
collator.compare.php                               28-Sep-2020 11:09                8379
collator.construct.php                             28-Sep-2020 11:09                5412
collator.create.php                                28-Sep-2020 11:09                5131
collator.getattribute.php                          28-Sep-2020 11:09                5629
collator.geterrorcode.php                          28-Sep-2020 11:09                4850
collator.geterrormessage.php                       28-Sep-2020 11:09                4909
collator.getlocale.php                             28-Sep-2020 11:09                6387
collator.getsortkey.php                            28-Sep-2020 11:09                6850
collator.getstrength.php                           28-Sep-2020 11:09                4793
collator.setattribute.php                          28-Sep-2020 11:09                6380
collator.setstrength.php                           28-Sep-2020 11:09               12549
collator.sort.php                                  28-Sep-2020 11:09                7523
collator.sortwithsortkeys.php                      28-Sep-2020 11:09                6172
collectable.isgarbage.php                          28-Sep-2020 11:09                2240
collectable.setgarbage.php                         28-Sep-2020 11:09                2426
com.configuration.php                              28-Sep-2020 11:09                6783
com.constants.php                                  28-Sep-2020 11:09               22028
com.construct.php                                  28-Sep-2020 11:09                8286
com.error-handling.php                             28-Sep-2020 11:09                1443
com.examples.arrays.php                            28-Sep-2020 11:09                1977
com.examples.foreach.php                           28-Sep-2020 11:09                2885
com.examples.php                                   28-Sep-2020 11:09                1326
com.installation.php                               28-Sep-2020 11:09                1492
com.requirements.php                               28-Sep-2020 11:09                1159
com.resources.php                                  28-Sep-2020 11:09                1079
com.setup.php                                      28-Sep-2020 11:09                1457
commonmark-cql.construct.php                       28-Sep-2020 11:09                2043
commonmark-cql.invoke.php                          28-Sep-2020 11:09                3629
commonmark-interfaces-ivisitable.accept.php        28-Sep-2020 11:09                2979
commonmark-interfaces-ivisitor.enter.php           28-Sep-2020 11:09                3781
commonmark-interfaces-ivisitor.leave.php           28-Sep-2020 11:09                3783
commonmark-node-bulletlist.construct.php           28-Sep-2020 11:09                2977
commonmark-node-codeblock.construct.php            28-Sep-2020 11:09                2625
commonmark-node-heading.construct.php              28-Sep-2020 11:09                2519
commonmark-node-image.construct.php                28-Sep-2020 11:09                3077
commonmark-node-link.construct.php                 28-Sep-2020 11:09                3075
commonmark-node-orderedlist.construct.php          28-Sep-2020 11:09                3814
commonmark-node-text.construct.php                 28-Sep-2020 11:09                2561
commonmark-node.accept.php                         28-Sep-2020 11:09                2736
commonmark-node.appendchild.php                    28-Sep-2020 11:09                2615
commonmark-node.insertafter.php                    28-Sep-2020 11:09                2640
commonmark-node.insertbefore.php                   28-Sep-2020 11:09                2637
commonmark-node.prependchild.php                   28-Sep-2020 11:09                2641
commonmark-node.replace.php                        28-Sep-2020 11:09                2590
commonmark-node.unlink.php                         28-Sep-2020 11:09                2301
commonmark-parser.construct.php                    28-Sep-2020 11:09                3395
commonmark-parser.finish.php                       28-Sep-2020 11:09                2354
commonmark-parser.parse.php                        28-Sep-2020 11:09                2464
compersisthelper.construct.php                     28-Sep-2020 11:09                3281
compersisthelper.getcurfilename.php                28-Sep-2020 11:09                2851
compersisthelper.getmaxstreamsize.php              28-Sep-2020 11:09                2977
compersisthelper.initnew.php                       28-Sep-2020 11:09                2844
compersisthelper.loadfromfile.php                  28-Sep-2020 11:09                3902
compersisthelper.loadfromstream.php                28-Sep-2020 11:09                3170
compersisthelper.savetofile.php                    28-Sep-2020 11:09                5779
compersisthelper.savetostream.php                  28-Sep-2020 11:09                3195
componere-abstract-definition.addinterface.php     28-Sep-2020 11:08                3146
componere-abstract-definition.addmethod.php        28-Sep-2020 11:08                3869
componere-abstract-definition.addtrait.php         28-Sep-2020 11:08                3102
componere-abstract-definition.getreflector.php     28-Sep-2020 11:08                2266
componere-definition.addconstant.php               28-Sep-2020 11:08                4191
componere-definition.addproperty.php               28-Sep-2020 11:08                3598
componere-definition.construct.php                 28-Sep-2020 11:08                5427
componere-definition.getclosure.php                28-Sep-2020 11:08                3272
componere-definition.getclosures.php               28-Sep-2020 11:08                2563
componere-definition.isregistered.php              28-Sep-2020 11:08                2123
componere-definition.register.php                  28-Sep-2020 11:08                2347
componere-method.construct.php                     28-Sep-2020 11:08                2076
componere-method.getreflector.php                  28-Sep-2020 11:08                2085
componere-method.setprivate.php                    28-Sep-2020 11:08                2371
componere-method.setprotected.php                  28-Sep-2020 11:08                2384
componere-method.setstatic.php                     28-Sep-2020 11:08                1968
componere-patch.apply.php                          28-Sep-2020 11:08                1775
componere-patch.construct.php                      28-Sep-2020 11:08                3352
componere-patch.derive.php                         28-Sep-2020 11:08                3081
componere-patch.getclosure.php                     28-Sep-2020 11:08                2865
componere-patch.getclosures.php                    28-Sep-2020 11:08                2051
componere-patch.isapplied.php                      28-Sep-2020 11:08                1695
componere-patch.revert.php                         28-Sep-2020 11:08                1775
componere-value.construct.php                      28-Sep-2020 11:08                2493
componere-value.hasdefault.php                     28-Sep-2020 11:08                1742
componere-value.isprivate.php                      28-Sep-2020 11:08                1760
componere-value.isprotected.php                    28-Sep-2020 11:08                1768
componere-value.isstatic.php                       28-Sep-2020 11:08                1755
componere-value.setprivate.php                     28-Sep-2020 11:08                2394
componere-value.setprotected.php                   28-Sep-2020 11:08                2406
componere-value.setstatic.php                      28-Sep-2020 11:08                1985
componere.cast.php                                 28-Sep-2020 11:08                4870
componere.cast_by_ref.php                          28-Sep-2020 11:08                5032
componere.installation.php                         28-Sep-2020 11:08                1229
componere.requirements.php                         28-Sep-2020 11:08                1083
componere.setup.php                                28-Sep-2020 11:08                1366
cond.broadcast.php                                 28-Sep-2020 11:09                4703
cond.create.php                                    28-Sep-2020 11:09                4102
cond.destroy.php                                   28-Sep-2020 11:09                4738
cond.signal.php                                    28-Sep-2020 11:09                4515
cond.wait.php                                      28-Sep-2020 11:09                6344
configuration.changes.modes.php                    28-Sep-2020 11:08                3886
configuration.changes.php                          28-Sep-2020 11:08                9147
configuration.file.per-user.php                    28-Sep-2020 11:08                3227
configuration.file.php                             28-Sep-2020 11:08               12100
configuration.php                                  28-Sep-2020 11:08                1607
configure.about.php                                28-Sep-2020 11:09               18071
configure.php                                      28-Sep-2020 11:09                1313
constants.dbx.php                                  28-Sep-2020 11:08                7287
context.curl.php                                   28-Sep-2020 11:08                9323
context.ftp.php                                    28-Sep-2020 11:08                4730
context.http.php                                   28-Sep-2020 11:08               17862
context.mongodb.php                                28-Sep-2020 11:08                5622
context.params.php                                 28-Sep-2020 11:08                2409
context.phar.php                                   28-Sep-2020 11:08                2718
context.php                                        28-Sep-2020 11:08                2853
context.socket.php                                 28-Sep-2020 11:08               10425
context.ssl.php                                    28-Sep-2020 11:08               14948
context.zip.php                                    28-Sep-2020 11:08                4290
control-structures.alternative-syntax.php          28-Sep-2020 11:08                7195
control-structures.break.php                       28-Sep-2020 11:08                6660
control-structures.continue.php                    28-Sep-2020 11:08                9476
control-structures.declare.php                     28-Sep-2020 11:08               13371
control-structures.do.while.php                    28-Sep-2020 11:08                5687
control-structures.else.php                        28-Sep-2020 11:08                3014
control-structures.elseif.php                      28-Sep-2020 11:08                7707
control-structures.for.php                         28-Sep-2020 11:08               12271
control-structures.foreach.php                     28-Sep-2020 11:08               24939
control-structures.goto.php                        28-Sep-2020 11:08                7377
control-structures.if.php                          28-Sep-2020 11:08                4821
control-structures.intro.php                       28-Sep-2020 11:08                2390
control-structures.switch.php                      28-Sep-2020 11:08               17251
control-structures.while.php                       28-Sep-2020 11:08                4586
copyright.php                                      28-Sep-2020 11:08                2024
countable.count.php                                28-Sep-2020 11:09                5634
csprng.configuration.php                           28-Sep-2020 11:08                1154
csprng.constants.php                               28-Sep-2020 11:08                1050
csprng.installation.php                            28-Sep-2020 11:08                1138
csprng.requirements.php                            28-Sep-2020 11:08                1114
csprng.resources.php                               28-Sep-2020 11:08                1097
csprng.setup.php                                   28-Sep-2020 11:08                1471
ctype.configuration.php                            28-Sep-2020 11:09                1148
ctype.constants.php                                28-Sep-2020 11:09                1042
ctype.installation.php                             28-Sep-2020 11:09                1317
ctype.requirements.php                             28-Sep-2020 11:09                1120
ctype.resources.php                                28-Sep-2020 11:09                1091
ctype.setup.php                                    28-Sep-2020 11:09                1466
cubrid.configuration.php                           28-Sep-2020 11:08                1095
cubrid.constants.php                               28-Sep-2020 11:08               13698
cubrid.examples.php                                28-Sep-2020 11:08               21059
cubrid.installation.php                            28-Sep-2020 11:08                2020
cubrid.requirements.php                            28-Sep-2020 11:08                1162
cubrid.resources.php                               28-Sep-2020 11:08                2986
cubrid.setup.php                                   28-Sep-2020 11:08                1477
cubridmysql.cubrid.php                             28-Sep-2020 11:08                4824
curl.configuration.php                             28-Sep-2020 11:09                2394
curl.constants.php                                 28-Sep-2020 11:09              126888
curl.examples-basic.php                            28-Sep-2020 11:09                4638
curl.examples.php                                  28-Sep-2020 11:09                1261
curl.installation.php                              28-Sep-2020 11:09                2616
curl.requirements.php                              28-Sep-2020 11:09                1218
curl.resources.php                                 28-Sep-2020 11:09                1137
curl.setup.php                                     28-Sep-2020 11:09                1477
curlfile.construct.php                             28-Sep-2020 11:09               20366
curlfile.getfilename.php                           28-Sep-2020 11:09                2023
curlfile.getmimetype.php                           28-Sep-2020 11:09                2029
curlfile.getpostfilename.php                       28-Sep-2020 11:09                2081
curlfile.setmimetype.php                           28-Sep-2020 11:09                2259
curlfile.setpostfilename.php                       28-Sep-2020 11:09                2292
curlfile.wakeup.php                                28-Sep-2020 11:09                2223
dateinterval.construct.php                         28-Sep-2020 11:09                8124
dateinterval.createfromdatestring.php              28-Sep-2020 11:09                8239
dateinterval.format.php                            28-Sep-2020 11:09               14296
dateperiod.construct.php                           28-Sep-2020 11:09               13654
dateperiod.getdateinterval.php                     28-Sep-2020 11:09                4651
dateperiod.getenddate.php                          28-Sep-2020 11:09                7495
dateperiod.getrecurrences.php                      28-Sep-2020 11:09                2501
dateperiod.getstartdate.php                        28-Sep-2020 11:09                5086
datetime.add.php                                   28-Sep-2020 11:09               12557
datetime.configuration.php                         28-Sep-2020 11:09                5368
datetime.constants.php                             28-Sep-2020 11:09                2679
datetime.construct.php                             28-Sep-2020 11:09               16579
datetime.createfromformat.php                      28-Sep-2020 11:09               27978
datetime.createfromimmutable.php                   28-Sep-2020 11:09                4066
datetime.diff.php                                  28-Sep-2020 11:09               12166
datetime.examples-arithmetic.php                   28-Sep-2020 11:09               15992
datetime.examples.php                              28-Sep-2020 11:09                1313
datetime.format.php                                28-Sep-2020 11:09               20069
datetime.formats.compound.php                      28-Sep-2020 11:09                9204
datetime.formats.date.php                          28-Sep-2020 11:09               13401
datetime.formats.php                               28-Sep-2020 11:09                2740
datetime.formats.relative.php                      28-Sep-2020 11:09               14962
datetime.formats.time.php                          28-Sep-2020 11:09                7221
datetime.getlasterrors.php                         28-Sep-2020 11:09                5798
datetime.getoffset.php                             28-Sep-2020 11:09                7805
datetime.gettimestamp.php                          28-Sep-2020 11:09                6156
datetime.gettimezone.php                           28-Sep-2020 11:09                7308
datetime.installation.php                          28-Sep-2020 11:09                2120
datetime.modify.php                                28-Sep-2020 11:09               10702
datetime.requirements.php                          28-Sep-2020 11:09                1126
datetime.resources.php                             28-Sep-2020 11:09                1109
datetime.set-state.php                             28-Sep-2020 11:09                2420
datetime.setdate.php                               28-Sep-2020 11:09               10397
datetime.setisodate.php                            28-Sep-2020 11:09               13430
datetime.settime.php                               28-Sep-2020 11:09               14139
datetime.settimestamp.php                          28-Sep-2020 11:09                9359
datetime.settimezone.php                           28-Sep-2020 11:09                9134
datetime.setup.php                                 28-Sep-2020 11:09                1530
datetime.sub.php                                   28-Sep-2020 11:09               12531
datetime.wakeup.php                                28-Sep-2020 11:09                2766
datetimeimmutable.add.php                          28-Sep-2020 11:09                2199
datetimeimmutable.construct.php                    28-Sep-2020 11:09                3288
datetimeimmutable.createfromformat.php             28-Sep-2020 11:09                3546
datetimeimmutable.createfrommutable.php            28-Sep-2020 11:09                4224
datetimeimmutable.getlasterrors.php                28-Sep-2020 11:09                2085
datetimeimmutable.modify.php                       28-Sep-2020 11:09                3174
datetimeimmutable.set-state.php                    28-Sep-2020 11:09                2181
datetimeimmutable.setdate.php                      28-Sep-2020 11:09                2327
datetimeimmutable.setisodate.php                   28-Sep-2020 11:09                2384
datetimeimmutable.settime.php                      28-Sep-2020 11:09                2525
datetimeimmutable.settimestamp.php                 28-Sep-2020 11:09                2198
datetimeimmutable.settimezone.php                  28-Sep-2020 11:09                2224
datetimeimmutable.sub.php                          28-Sep-2020 11:09                2206
datetimezone.construct.php                         28-Sep-2020 11:09                6489
datetimezone.getlocation.php                       28-Sep-2020 11:09                4962
datetimezone.getname.php                           28-Sep-2020 11:09                2956
datetimezone.getoffset.php                         28-Sep-2020 11:09                7972
datetimezone.gettransitions.php                    28-Sep-2020 11:09                6630
datetimezone.listabbreviations.php                 28-Sep-2020 11:09                5272
datetimezone.listidentifiers.php                   28-Sep-2020 11:09                6399
dba.configuration.php                              28-Sep-2020 11:08                2160
dba.constants.php                                  28-Sep-2020 11:08                1026
dba.example.php                                    28-Sep-2020 11:08                6890
dba.examples.php                                   28-Sep-2020 11:08                1251
dba.installation.php                               28-Sep-2020 11:08               10454
dba.requirements.php                               28-Sep-2020 11:08                7624
dba.resources.php                                  28-Sep-2020 11:08                1385
dba.setup.php                                      28-Sep-2020 11:08                1458
dbase.configuration.php                            28-Sep-2020 11:08                1148
dbase.constants.php                                28-Sep-2020 11:08                3332
dbase.installation.php                             28-Sep-2020 11:08                1436
dbase.requirements.php                             28-Sep-2020 11:08                1108
dbase.resources.php                                28-Sep-2020 11:08                1366
dbase.setup.php                                    28-Sep-2020 11:08                1482
dbplus.configuration.php                           28-Sep-2020 11:08                1154
dbplus.constants.php                               28-Sep-2020 11:08                1503
dbplus.errorcodes.php                              28-Sep-2020 11:08               12996
dbplus.installation.php                            28-Sep-2020 11:08                2531
dbplus.requirements.php                            28-Sep-2020 11:08                1705
dbplus.resources.php                               28-Sep-2020 11:08                1405
dbplus.setup.php                                   28-Sep-2020 11:08                1490
dbx.configuration.php                              28-Sep-2020 11:08                2623
dbx.installation.php                               28-Sep-2020 11:08                2169
dbx.requirements.php                               28-Sep-2020 11:08                2380
dbx.resources.php                                  28-Sep-2020 11:08                1190
dbx.setup.php                                      28-Sep-2020 11:08                1464
debugger-about.php                                 28-Sep-2020 11:09                1818
debugger.php                                       28-Sep-2020 11:09                1266
dio.configuration.php                              28-Sep-2020 11:09                1136
dio.constants.php                                  28-Sep-2020 11:09                9533
dio.installation.php                               28-Sep-2020 11:09                1945
dio.requirements.php                               28-Sep-2020 11:09                1096
dio.resources.php                                  28-Sep-2020 11:09                1239
dio.setup.php                                      28-Sep-2020 11:09                1465
dir.configuration.php                              28-Sep-2020 11:09                1136
dir.constants.php                                  28-Sep-2020 11:09                2533
dir.installation.php                               28-Sep-2020 11:09                1120
dir.requirements.php                               28-Sep-2020 11:09                1096
dir.resources.php                                  28-Sep-2020 11:09                1079
dir.setup.php                                      28-Sep-2020 11:09                1476
directory.close.php                                28-Sep-2020 11:09                1951
directory.read.php                                 28-Sep-2020 11:09                1930
directory.rewind.php                               28-Sep-2020 11:09                1971
directoryiterator.construct.php                    28-Sep-2020 11:09                4875
directoryiterator.current.php                      28-Sep-2020 11:09                6188
directoryiterator.getatime.php                     28-Sep-2020 11:09                5623
directoryiterator.getbasename.php                  28-Sep-2020 11:09                6570
directoryiterator.getctime.php                     28-Sep-2020 11:09                5730
directoryiterator.getextension.php                 28-Sep-2020 11:09                6283
directoryiterator.getfilename.php                  28-Sep-2020 11:09                5276
directoryiterator.getgroup.php                     28-Sep-2020 11:09                5762
directoryiterator.getinode.php                     28-Sep-2020 11:09                4565
directoryiterator.getmtime.php                     28-Sep-2020 11:09                5616
directoryiterator.getowner.php                     28-Sep-2020 11:09                5153
directoryiterator.getpath.php                      28-Sep-2020 11:09                4711
directoryiterator.getpathname.php                  28-Sep-2020 11:09                5157
directoryiterator.getperms.php                     28-Sep-2020 11:09                6110
directoryiterator.getsize.php                      28-Sep-2020 11:09                4860
directoryiterator.gettype.php                      28-Sep-2020 11:09                5710
directoryiterator.isdir.php                        28-Sep-2020 11:09                5496
directoryiterator.isdot.php                        28-Sep-2020 11:09                5730
directoryiterator.isexecutable.php                 28-Sep-2020 11:09                5374
directoryiterator.isfile.php                       28-Sep-2020 11:09                5650
directoryiterator.islink.php                       28-Sep-2020 11:09                7281
directoryiterator.isreadable.php                   28-Sep-2020 11:09                5228
directoryiterator.iswritable.php                   28-Sep-2020 11:09                5404
directoryiterator.key.php                          28-Sep-2020 11:09                5793
directoryiterator.next.php                         28-Sep-2020 11:09                5464
directoryiterator.rewind.php                       28-Sep-2020 11:09                5364
directoryiterator.seek.php                         28-Sep-2020 11:09                5239
directoryiterator.tostring.php                     28-Sep-2020 11:09                4503
directoryiterator.valid.php                        28-Sep-2020 11:09                5662
doc.changelog.php                                  28-Sep-2020 11:09              142279
dom.configuration.php                              28-Sep-2020 11:09                1136
dom.constants.php                                  28-Sep-2020 11:09               16698
dom.examples.php                                   28-Sep-2020 11:09                2847
dom.installation.php                               28-Sep-2020 11:09                1213
dom.requirements.php                               28-Sep-2020 11:09                1386
dom.resources.php                                  28-Sep-2020 11:09                1079
dom.setup.php                                      28-Sep-2020 11:09                1451
domattr.construct.php                              28-Sep-2020 11:09                5314
domattr.isid.php                                   28-Sep-2020 11:09                4765
domcdatasection.construct.php                      28-Sep-2020 11:09                5033
domcharacterdata.appenddata.php                    28-Sep-2020 11:09                3616
domcharacterdata.deletedata.php                    28-Sep-2020 11:09                4628
domcharacterdata.insertdata.php                    28-Sep-2020 11:09                4348
domcharacterdata.replacedata.php                   28-Sep-2020 11:09                4971
domcharacterdata.substringdata.php                 28-Sep-2020 11:09                4495
domcomment.construct.php                           28-Sep-2020 11:09                4854
domdocument.construct.php                          28-Sep-2020 11:09                4106
domdocument.createattribute.php                    28-Sep-2020 11:09                5507
domdocument.createattributens.php                  28-Sep-2020 11:09                6299
domdocument.createcdatasection.php                 28-Sep-2020 11:09                5191
domdocument.createcomment.php                      28-Sep-2020 11:09                5138
domdocument.createdocumentfragment.php             28-Sep-2020 11:09                4836
domdocument.createelement.php                      28-Sep-2020 11:09               11058
domdocument.createelementns.php                    28-Sep-2020 11:09               13743
domdocument.createentityreference.php              28-Sep-2020 11:09                5833
domdocument.createprocessinginstruction.php        28-Sep-2020 11:09                6049
domdocument.createtextnode.php                     28-Sep-2020 11:09                5130
domdocument.getelementbyid.php                     28-Sep-2020 11:09                7447
domdocument.getelementsbytagname.php               28-Sep-2020 11:09                5944
domdocument.getelementsbytagnamens.php             28-Sep-2020 11:09                6929
domdocument.importnode.php                         28-Sep-2020 11:09                8787
domdocument.load.php                               28-Sep-2020 11:09                5839
domdocument.loadhtml.php                           28-Sep-2020 11:09                6345
domdocument.loadhtmlfile.php                       28-Sep-2020 11:09                6150
domdocument.loadxml.php                            28-Sep-2020 11:09                6611
domdocument.normalizedocument.php                  28-Sep-2020 11:09                2691
domdocument.registernodeclass.php                  28-Sep-2020 11:09               15357
domdocument.relaxngvalidate.php                    28-Sep-2020 11:09                3706
domdocument.relaxngvalidatesource.php              28-Sep-2020 11:09                3733
domdocument.save.php                               28-Sep-2020 11:09                7386
domdocument.savehtml.php                           28-Sep-2020 11:09                7158
domdocument.savehtmlfile.php                       28-Sep-2020 11:09                7809
domdocument.savexml.php                            28-Sep-2020 11:09                8572
domdocument.schemavalidate.php                     28-Sep-2020 11:09                4560
domdocument.schemavalidatesource.php               28-Sep-2020 11:09                4585
domdocument.validate.php                           28-Sep-2020 11:09                5695
domdocument.xinclude.php                           28-Sep-2020 11:09                6951
domdocumentfragment.appendxml.php                  28-Sep-2020 11:09                5219
domelement.construct.php                           28-Sep-2020 11:09                6183
domelement.getattribute.php                        28-Sep-2020 11:09                3274
domelement.getattributenode.php                    28-Sep-2020 11:09                3585
domelement.getattributenodens.php                  28-Sep-2020 11:09                3961
domelement.getattributens.php                      28-Sep-2020 11:09                3724
domelement.getelementsbytagname.php                28-Sep-2020 11:09                3373
domelement.getelementsbytagnamens.php              28-Sep-2020 11:09                3612
domelement.hasattribute.php                        28-Sep-2020 11:09                3501
domelement.hasattributens.php                      28-Sep-2020 11:09                3855
domelement.removeattribute.php                     28-Sep-2020 11:09                3648
domelement.removeattributenode.php                 28-Sep-2020 11:09                3993
domelement.removeattributens.php                   28-Sep-2020 11:09                4002
domelement.setattribute.php                        28-Sep-2020 11:09                5740
domelement.setattributenode.php                    28-Sep-2020 11:09                3745
domelement.setattributenodens.php                  28-Sep-2020 11:09                3741
domelement.setattributens.php                      28-Sep-2020 11:09                4711
domelement.setidattribute.php                      28-Sep-2020 11:09                4357
domelement.setidattributenode.php                  28-Sep-2020 11:09                4452
domelement.setidattributens.php                    28-Sep-2020 11:09                4768
domentityreference.construct.php                   28-Sep-2020 11:09                4710
domimplementation.construct.php                    28-Sep-2020 11:09                1822
domimplementation.createdocument.php               28-Sep-2020 11:09                5558
domimplementation.createdocumenttype.php           28-Sep-2020 11:09                8992
domimplementation.hasfeature.php                   28-Sep-2020 11:09                9411
domnamednodemap.count.php                          28-Sep-2020 11:09                2280
domnamednodemap.getnameditem.php                   28-Sep-2020 11:09                3059
domnamednodemap.getnameditemns.php                 28-Sep-2020 11:09                3387
domnamednodemap.item.php                           28-Sep-2020 11:09                2638
domnode.appendchild.php                            28-Sep-2020 11:09                8097
domnode.c14n.php                                   28-Sep-2020 11:09                3577
domnode.c14nfile.php                               28-Sep-2020 11:09                3972
domnode.clonenode.php                              28-Sep-2020 11:09                2372
domnode.getlineno.php                              28-Sep-2020 11:09                4838
domnode.getnodepath.php                            28-Sep-2020 11:09                5094
domnode.hasattributes.php                          28-Sep-2020 11:09                2478
domnode.haschildnodes.php                          28-Sep-2020 11:09                2400
domnode.insertbefore.php                           28-Sep-2020 11:09                4627
domnode.isdefaultnamespace.php                     28-Sep-2020 11:09                2585
domnode.issamenode.php                             28-Sep-2020 11:09                2534
domnode.issupported.php                            28-Sep-2020 11:09                3440
domnode.lookupnamespaceuri.php                     28-Sep-2020 11:09                2853
domnode.lookupprefix.php                           28-Sep-2020 11:09                2788
domnode.normalize.php                              28-Sep-2020 11:09                2539
domnode.removechild.php                            28-Sep-2020 11:09                6542
domnode.replacechild.php                           28-Sep-2020 11:09                5047
domnodelist.count.php                              28-Sep-2020 11:09                2197
domnodelist.item.php                               28-Sep-2020 11:09                6439
domprocessinginstruction.construct.php             28-Sep-2020 11:09                6399
domtext.construct.php                              28-Sep-2020 11:09                4617
domtext.iselementcontentwhitespace.php             28-Sep-2020 11:09                2393
domtext.iswhitespaceinelementcontent.php           28-Sep-2020 11:09                2362
domtext.splittext.php                              28-Sep-2020 11:09                2940
domxpath.construct.php                             28-Sep-2020 11:09                2333
domxpath.evaluate.php                              28-Sep-2020 11:09                7154
domxpath.query.php                                 28-Sep-2020 11:09               11926
domxpath.registernamespace.php                     28-Sep-2020 11:09                2895
domxpath.registerphpfunctions.php                  28-Sep-2020 11:09               13977
dotnet.construct.php                               28-Sep-2020 11:09                2716
ds-collection.clear.php                            28-Sep-2020 11:09                3942
ds-collection.copy.php                             28-Sep-2020 11:09                4380
ds-collection.isempty.php                          28-Sep-2020 11:09                4220
ds-collection.toarray.php                          28-Sep-2020 11:09                4229
ds-deque.allocate.php                              28-Sep-2020 11:09                4560
ds-deque.apply.php                                 28-Sep-2020 11:09                5055
ds-deque.capacity.php                              28-Sep-2020 11:09                3896
ds-deque.clear.php                                 28-Sep-2020 11:09                3829
ds-deque.construct.php                             28-Sep-2020 11:09                4335
ds-deque.contains.php                              28-Sep-2020 11:09                7444
ds-deque.copy.php                                  28-Sep-2020 11:09                4212
ds-deque.count.php                                 28-Sep-2020 11:09                1447
ds-deque.filter.php                                28-Sep-2020 11:09                7501
ds-deque.find.php                                  28-Sep-2020 11:09                5396
ds-deque.first.php                                 28-Sep-2020 11:09                3762
ds-deque.get.php                                   28-Sep-2020 11:09                6598
ds-deque.insert.php                                28-Sep-2020 11:09                6936
ds-deque.isempty.php                               28-Sep-2020 11:09                4072
ds-deque.join.php                                  28-Sep-2020 11:09                5689
ds-deque.jsonserialize.php                         28-Sep-2020 11:09                1722
ds-deque.last.php                                  28-Sep-2020 11:09                3751
ds-deque.map.php                                   28-Sep-2020 11:09                5446
ds-deque.merge.php                                 28-Sep-2020 11:09                4852
ds-deque.pop.php                                   28-Sep-2020 11:09                4249
ds-deque.push.php                                  28-Sep-2020 11:09                4658
ds-deque.reduce.php                                28-Sep-2020 11:09                8560
ds-deque.remove.php                                28-Sep-2020 11:09                4778
ds-deque.reverse.php                               28-Sep-2020 11:09                3663
ds-deque.reversed.php                              28-Sep-2020 11:09                4026
ds-deque.rotate.php                                28-Sep-2020 11:09                5050
ds-deque.set.php                                   28-Sep-2020 11:09                6078
ds-deque.shift.php                                 28-Sep-2020 11:09                4348
ds-deque.slice.php                                 28-Sep-2020 11:09                7159
ds-deque.sort.php                                  28-Sep-2020 11:09                7484
ds-deque.sorted.php                                28-Sep-2020 11:09                7529
ds-deque.sum.php                                   28-Sep-2020 11:09                5285
ds-deque.toarray.php                               28-Sep-2020 11:09                4085
ds-deque.unshift.php                               28-Sep-2020 11:09                4701
ds-hashable.equals.php                             28-Sep-2020 11:09                3262
ds-hashable.hash.php                               28-Sep-2020 11:09                8428
ds-map.allocate.php                                28-Sep-2020 11:09                4428
ds-map.apply.php                                   28-Sep-2020 11:09                5827
ds-map.capacity.php                                28-Sep-2020 11:09                3183
ds-map.clear.php                                   28-Sep-2020 11:09                4387
ds-map.construct.php                               28-Sep-2020 11:09                4906
ds-map.copy.php                                    28-Sep-2020 11:09                4144
ds-map.count.php                                   28-Sep-2020 11:09                1410
ds-map.diff.php                                    28-Sep-2020 11:09                5599
ds-map.filter.php                                  28-Sep-2020 11:09                8366
ds-map.first.php                                   28-Sep-2020 11:09                4071
ds-map.get.php                                     28-Sep-2020 11:09                8548
ds-map.haskey.php                                  28-Sep-2020 11:09                4572
ds-map.hasvalue.php                                28-Sep-2020 11:09                4614
ds-map.intersect.php                               28-Sep-2020 11:09                6118
ds-map.isempty.php                                 28-Sep-2020 11:09                4326
ds-map.jsonserialize.php                           28-Sep-2020 11:09                1702
ds-map.keys.php                                    28-Sep-2020 11:09                3950
ds-map.ksort.php                                   28-Sep-2020 11:09                8217
ds-map.ksorted.php                                 28-Sep-2020 11:09                8324
ds-map.last.php                                    28-Sep-2020 11:09                4057
ds-map.map.php                                     28-Sep-2020 11:09                6486
ds-map.merge.php                                   28-Sep-2020 11:09                5820
ds-map.pairs.php                                   28-Sep-2020 11:09                4309
ds-map.put.php                                     28-Sep-2020 11:09               14813
ds-map.putall.php                                  28-Sep-2020 11:09                5442
ds-map.reduce.php                                  28-Sep-2020 11:09                9601
ds-map.remove.php                                  28-Sep-2020 11:09                6957
ds-map.reverse.php                                 28-Sep-2020 11:09                4147
ds-map.reversed.php                                28-Sep-2020 11:09                4268
ds-map.skip.php                                    28-Sep-2020 11:09                4494
ds-map.slice.php                                   28-Sep-2020 11:09                8062
ds-map.sort.php                                    28-Sep-2020 11:09                8136
ds-map.sorted.php                                  28-Sep-2020 11:09                8304
ds-map.sum.php                                     28-Sep-2020 11:09                5814
ds-map.toarray.php                                 28-Sep-2020 11:09                5164
ds-map.union.php                                   28-Sep-2020 11:09                6106
ds-map.values.php                                  28-Sep-2020 11:09                3942
ds-map.xor.php                                     28-Sep-2020 11:09                5662
ds-pair.clear.php                                  28-Sep-2020 11:09                3726
ds-pair.construct.php                              28-Sep-2020 11:09                2458
ds-pair.copy.php                                   28-Sep-2020 11:09                4132
ds-pair.isempty.php                                28-Sep-2020 11:09                4018
ds-pair.jsonserialize.php                          28-Sep-2020 11:09                1721
ds-pair.toarray.php                                28-Sep-2020 11:09                4011
ds-priorityqueue.allocate.php                      28-Sep-2020 11:09                4718
ds-priorityqueue.capacity.php                      28-Sep-2020 11:09                3382
ds-priorityqueue.clear.php                         28-Sep-2020 11:09                4488
ds-priorityqueue.construct.php                     28-Sep-2020 11:09                2908
ds-priorityqueue.copy.php                          28-Sep-2020 11:09                4507
ds-priorityqueue.count.php                         28-Sep-2020 11:09                1548
ds-priorityqueue.isempty.php                       28-Sep-2020 11:09                4984
ds-priorityqueue.jsonserialize.php                 28-Sep-2020 11:09                1832
ds-priorityqueue.peek.php                          28-Sep-2020 11:09                4743
ds-priorityqueue.pop.php                           28-Sep-2020 11:09                5517
ds-priorityqueue.push.php                          28-Sep-2020 11:09                5534
ds-priorityqueue.toarray.php                       28-Sep-2020 11:09                5181
ds-queue.allocate.php                              28-Sep-2020 11:09                4756
ds-queue.capacity.php                              28-Sep-2020 11:09                3902
ds-queue.clear.php                                 28-Sep-2020 11:09                3814
ds-queue.construct.php                             28-Sep-2020 11:09                4333
ds-queue.copy.php                                  28-Sep-2020 11:09                4349
ds-queue.count.php                                 28-Sep-2020 11:09                1444
ds-queue.isempty.php                               28-Sep-2020 11:09                4088
ds-queue.jsonserialize.php                         28-Sep-2020 11:09                1728
ds-queue.peek.php                                  28-Sep-2020 11:09                4335
ds-queue.pop.php                                   28-Sep-2020 11:09                4870
ds-queue.push.php                                  28-Sep-2020 11:09                4693
ds-queue.toarray.php                               28-Sep-2020 11:09                4248
ds-sequence.allocate.php                           28-Sep-2020 11:09                4458
ds-sequence.apply.php                              28-Sep-2020 11:09                5167
ds-sequence.capacity.php                           28-Sep-2020 11:09                4458
ds-sequence.contains.php                           28-Sep-2020 11:09                7568
ds-sequence.filter.php                             28-Sep-2020 11:09                7637
ds-sequence.find.php                               28-Sep-2020 11:09                5505
ds-sequence.first.php                              28-Sep-2020 11:09                3874
ds-sequence.get.php                                28-Sep-2020 11:09                6723
ds-sequence.insert.php                             28-Sep-2020 11:09                7052
ds-sequence.join.php                               28-Sep-2020 11:09                5782
ds-sequence.last.php                               28-Sep-2020 11:09                3842
ds-sequence.map.php                                28-Sep-2020 11:09                5572
ds-sequence.merge.php                              28-Sep-2020 11:09                4975
ds-sequence.pop.php                                28-Sep-2020 11:09                4358
ds-sequence.push.php                               28-Sep-2020 11:09                4777
ds-sequence.reduce.php                             28-Sep-2020 11:09                8676
ds-sequence.remove.php                             28-Sep-2020 11:09                4887
ds-sequence.reverse.php                            28-Sep-2020 11:09                3773
ds-sequence.reversed.php                           28-Sep-2020 11:09                4146
ds-sequence.rotate.php                             28-Sep-2020 11:09                5184
ds-sequence.set.php                                28-Sep-2020 11:09                6199
ds-sequence.shift.php                              28-Sep-2020 11:09                4457
ds-sequence.slice.php                              28-Sep-2020 11:09                7321
ds-sequence.sort.php                               28-Sep-2020 11:09                7608
ds-sequence.sorted.php                             28-Sep-2020 11:09                7653
ds-sequence.sum.php                                28-Sep-2020 11:09                5407
ds-sequence.unshift.php                            28-Sep-2020 11:09                4809
ds-set.add.php                                     28-Sep-2020 11:09               13011
ds-set.allocate.php                                28-Sep-2020 11:09                4441
ds-set.capacity.php                                28-Sep-2020 11:09                3857
ds-set.clear.php                                   28-Sep-2020 11:09                3762
ds-set.construct.php                               28-Sep-2020 11:09                4291
ds-set.contains.php                                28-Sep-2020 11:09                7402
ds-set.copy.php                                    28-Sep-2020 11:09                4290
ds-set.count.php                                   28-Sep-2020 11:09                1410
ds-set.diff.php                                    28-Sep-2020 11:09                4829
ds-set.filter.php                                  28-Sep-2020 11:09                7434
ds-set.first.php                                   28-Sep-2020 11:09                3717
ds-set.get.php                                     28-Sep-2020 11:09                6544
ds-set.intersect.php                               28-Sep-2020 11:09                5055
ds-set.isempty.php                                 28-Sep-2020 11:09                4032
ds-set.join.php                                    28-Sep-2020 11:09                5637
ds-set.jsonserialize.php                           28-Sep-2020 11:09                1696
ds-set.last.php                                    28-Sep-2020 11:09                3719
ds-set.merge.php                                   28-Sep-2020 11:09                4780
ds-set.reduce.php                                  28-Sep-2020 11:09                8508
ds-set.remove.php                                  28-Sep-2020 11:09                5169
ds-set.reverse.php                                 28-Sep-2020 11:09                3613
ds-set.reversed.php                                28-Sep-2020 11:09                3966
ds-set.slice.php                                   28-Sep-2020 11:09                7075
ds-set.sort.php                                    28-Sep-2020 11:09                7422
ds-set.sorted.php                                  28-Sep-2020 11:09                7467
ds-set.sum.php                                     28-Sep-2020 11:09                5227
ds-set.toarray.php                                 28-Sep-2020 11:09                4033
ds-set.union.php                                   28-Sep-2020 11:09                5022
ds-set.xor.php                                     28-Sep-2020 11:09                4996
ds-stack.allocate.php                              28-Sep-2020 11:09                2657
ds-stack.capacity.php                              28-Sep-2020 11:09                2044
ds-stack.clear.php                                 28-Sep-2020 11:09                3814
ds-stack.construct.php                             28-Sep-2020 11:09                4299
ds-stack.copy.php                                  28-Sep-2020 11:09                4349
ds-stack.count.php                                 28-Sep-2020 11:09                1444
ds-stack.isempty.php                               28-Sep-2020 11:09                4088
ds-stack.jsonserialize.php                         28-Sep-2020 11:09                1728
ds-stack.peek.php                                  28-Sep-2020 11:09                4329
ds-stack.pop.php                                   28-Sep-2020 11:09                4864
ds-stack.push.php                                  28-Sep-2020 11:09                4693
ds-stack.toarray.php                               28-Sep-2020 11:09                4072
ds-vector.allocate.php                             28-Sep-2020 11:09                4377
ds-vector.apply.php                                28-Sep-2020 11:09                5080
ds-vector.capacity.php                             28-Sep-2020 11:09                4365
ds-vector.clear.php                                28-Sep-2020 11:09                3840
ds-vector.construct.php                            28-Sep-2020 11:09                4366
ds-vector.contains.php                             28-Sep-2020 11:09                7473
ds-vector.copy.php                                 28-Sep-2020 11:09                4372
ds-vector.count.php                                28-Sep-2020 11:09                1460
ds-vector.filter.php                               28-Sep-2020 11:09                7534
ds-vector.find.php                                 28-Sep-2020 11:09                5420
ds-vector.first.php                                28-Sep-2020 11:09                3787
ds-vector.get.php                                  28-Sep-2020 11:09                6628
ds-vector.insert.php                               28-Sep-2020 11:09                6965
ds-vector.isempty.php                              28-Sep-2020 11:09                4095
ds-vector.join.php                                 28-Sep-2020 11:09                5715
ds-vector.jsonserialize.php                        28-Sep-2020 11:09                1735
ds-vector.last.php                                 28-Sep-2020 11:09                3775
ds-vector.map.php                                  28-Sep-2020 11:09                5477
ds-vector.merge.php                                28-Sep-2020 11:09                4882
ds-vector.pop.php                                  28-Sep-2020 11:09                4273
ds-vector.push.php                                 28-Sep-2020 11:09                4686
ds-vector.reduce.php                               28-Sep-2020 11:09                8587
ds-vector.remove.php                               28-Sep-2020 11:09                4802
ds-vector.reverse.php                              28-Sep-2020 11:09                3688
ds-vector.reversed.php                             28-Sep-2020 11:09                4055
ds-vector.rotate.php                               28-Sep-2020 11:09                5083
ds-vector.set.php                                  28-Sep-2020 11:09                6108
ds-vector.shift.php                                28-Sep-2020 11:09                4372
ds-vector.slice.php                                28-Sep-2020 11:09                7204
ds-vector.sort.php                                 28-Sep-2020 11:09                7515
ds-vector.sorted.php                               28-Sep-2020 11:09                7560
ds-vector.sum.php                                  28-Sep-2020 11:09                5314
ds-vector.toarray.php                              28-Sep-2020 11:09                4109
ds-vector.unshift.php                              28-Sep-2020 11:09                4730
ds.constants.php                                   28-Sep-2020 11:09                1032
ds.examples.php                                    28-Sep-2020 11:09                4841
ds.installation.php                                28-Sep-2020 11:09                2400
ds.requirements.php                                28-Sep-2020 11:09                1091
ds.setup.php                                       28-Sep-2020 11:09                1310
eio.configuration.php                              28-Sep-2020 11:09                1136
eio.constants.php                                  28-Sep-2020 11:09               19525
eio.examples.php                                   28-Sep-2020 11:09               29461
eio.installation.php                               28-Sep-2020 11:09                1576
eio.requirements.php                               28-Sep-2020 11:09                1210
eio.resources.php                                  28-Sep-2020 11:09                1119
eio.setup.php                                      28-Sep-2020 11:09                1463
emptyiterator.current.php                          28-Sep-2020 11:09                2661
emptyiterator.key.php                              28-Sep-2020 11:09                2584
emptyiterator.next.php                             28-Sep-2020 11:09                2310
emptyiterator.rewind.php                           28-Sep-2020 11:09                2330
emptyiterator.valid.php                            28-Sep-2020 11:09                2303
enchant.configuration.php                          28-Sep-2020 11:09                1160
enchant.constants.php                              28-Sep-2020 11:09                2233
enchant.examples.php                               28-Sep-2020 11:09                5771
enchant.installation.php                           28-Sep-2020 11:09                1581
enchant.requirements.php                           28-Sep-2020 11:09                1676
enchant.resources.php                              28-Sep-2020 11:09                1202
enchant.setup.php                                  28-Sep-2020 11:09                1504
error.clone.php                                    28-Sep-2020 11:08                2369
error.construct.php                                28-Sep-2020 11:08                3159
error.getcode.php                                  28-Sep-2020 11:08                4194
error.getfile.php                                  28-Sep-2020 11:08                3793
error.getline.php                                  28-Sep-2020 11:08                4069
error.getmessage.php                               28-Sep-2020 11:08                3871
error.getprevious.php                              28-Sep-2020 11:08                6860
error.gettrace.php                                 28-Sep-2020 11:08                4295
error.gettraceasstring.php                         28-Sep-2020 11:08                4116
error.tostring.php                                 28-Sep-2020 11:08                4057
errorexception.construct.php                       28-Sep-2020 11:08                4856
errorexception.getseverity.php                     28-Sep-2020 11:08                4320
errorfunc.configuration.php                        28-Sep-2020 11:08               23997
errorfunc.constants.php                            28-Sep-2020 11:08               11317
errorfunc.examples.php                             28-Sep-2020 11:08               23941
errorfunc.installation.php                         28-Sep-2020 11:08                1156
errorfunc.requirements.php                         28-Sep-2020 11:08                1132
errorfunc.resources.php                            28-Sep-2020 11:08                1115
errorfunc.setup.php                                28-Sep-2020 11:08                1519
ev.backend.php                                     28-Sep-2020 11:09                3344
ev.configuration.php                               28-Sep-2020 11:09                1130
ev.depth.php                                       28-Sep-2020 11:09                3155
ev.embeddablebackends.php                          28-Sep-2020 11:09                6872
ev.examples.php                                    28-Sep-2020 11:09               47736
ev.feedsignal.php                                  28-Sep-2020 11:09                3220
ev.feedsignalevent.php                             28-Sep-2020 11:09                3002
ev.global.constants.php                            28-Sep-2020 11:09                1156
ev.installation.php                                28-Sep-2020 11:09                1567
ev.iteration.php                                   28-Sep-2020 11:09                2525
ev.now.php                                         28-Sep-2020 11:09                2940
ev.nowupdate.php                                   28-Sep-2020 11:09                3135
ev.periodic-modes.php                              28-Sep-2020 11:09                7692
ev.recommendedbackends.php                         28-Sep-2020 11:09                7613
ev.requirements.php                                28-Sep-2020 11:09                1146
ev.resources.php                                   28-Sep-2020 11:09                1080
ev.resume.php                                      28-Sep-2020 11:09                3728
ev.run.php                                         28-Sep-2020 11:09                4686
ev.setup.php                                       28-Sep-2020 11:09                1419
ev.sleep.php                                       28-Sep-2020 11:09                2271
ev.stop.php                                        28-Sep-2020 11:09                2707
ev.supportedbackends.php                           28-Sep-2020 11:09                6855
ev.suspend.php                                     28-Sep-2020 11:09                3460
ev.time.php                                        28-Sep-2020 11:09                2575
ev.verify.php                                      28-Sep-2020 11:09                2205
ev.watcher-callbacks.php                           28-Sep-2020 11:09                3900
ev.watchers.php                                    28-Sep-2020 11:09                3383
evcheck.construct.php                              28-Sep-2020 11:09                3614
evcheck.createstopped.php                          28-Sep-2020 11:09                3345
evchild.construct.php                              28-Sep-2020 11:09                6309
evchild.createstopped.php                          28-Sep-2020 11:09                4665
evchild.set.php                                    28-Sep-2020 11:09                3007
evembed.construct.php                              28-Sep-2020 11:09                8342
evembed.createstopped.php                          28-Sep-2020 11:09                4383
evembed.set.php                                    28-Sep-2020 11:09                2390
evembed.sweep.php                                  28-Sep-2020 11:09                3005
event.add.php                                      28-Sep-2020 11:09                3506
event.addsignal.php                                28-Sep-2020 11:09                7934
event.addtimer.php                                 28-Sep-2020 11:09                5171
event.callbacks.php                                28-Sep-2020 11:09                5235
event.configuration.php                            28-Sep-2020 11:09                1148
event.construct.php                                28-Sep-2020 11:09                4518
event.constructing.signal.events.php               28-Sep-2020 11:09                6751
event.del.php                                      28-Sep-2020 11:09                2409
event.delsignal.php                                28-Sep-2020 11:09                2117
event.deltimer.php                                 28-Sep-2020 11:09                2116
event.examples.php                                 28-Sep-2020 11:09              198907
event.flags.php                                    28-Sep-2020 11:09                2238
event.free.php                                     28-Sep-2020 11:09                2914
event.getsupportedmethods.php                      28-Sep-2020 11:09                2520
event.installation.php                             28-Sep-2020 11:09                1591
event.pending.php                                  28-Sep-2020 11:09                2594
event.persistence.php                              28-Sep-2020 11:09                2664
event.requirements.php                             28-Sep-2020 11:09                1361
event.resources.php                                28-Sep-2020 11:09                1075
event.set.php                                      28-Sep-2020 11:09                4149
event.setpriority.php                              28-Sep-2020 11:09                2276
event.settimer.php                                 28-Sep-2020 11:09                3881
event.setup.php                                    28-Sep-2020 11:09                1455
event.signal.php                                   28-Sep-2020 11:09                4017
event.timer.php                                    28-Sep-2020 11:09                3458
eventbase.construct.php                            28-Sep-2020 11:09                2622
eventbase.dispatch.php                             28-Sep-2020 11:09                3115
eventbase.exit.php                                 28-Sep-2020 11:09                2756
eventbase.free.php                                 28-Sep-2020 11:09                3199
eventbase.getfeatures.php                          28-Sep-2020 11:09                5918
eventbase.getmethod.php                            28-Sep-2020 11:09                4581
eventbase.gettimeofdaycached.php                   28-Sep-2020 11:09                2589
eventbase.gotexit.php                              28-Sep-2020 11:09                3176
eventbase.gotstop.php                              28-Sep-2020 11:09                3148
eventbase.loop.php                                 28-Sep-2020 11:09                3285
eventbase.priorityinit.php                         28-Sep-2020 11:09                2760
eventbase.reinit.php                               28-Sep-2020 11:09                2174
eventbase.stop.php                                 28-Sep-2020 11:09                2673
eventbuffer.add.php                                28-Sep-2020 11:09                2766
eventbuffer.addbuffer.php                          28-Sep-2020 11:09                3141
eventbuffer.appendfrom.php                         28-Sep-2020 11:09                4784
eventbuffer.construct.php                          28-Sep-2020 11:09                2096
eventbuffer.copyout.php                            28-Sep-2020 11:09                3747
eventbuffer.drain.php                              28-Sep-2020 11:09                3256
eventbuffer.enablelocking.php                      28-Sep-2020 11:09                2797
eventbuffer.expand.php                             28-Sep-2020 11:09                2548
eventbuffer.freeze.php                             28-Sep-2020 11:09                2812
eventbuffer.lock.php                               28-Sep-2020 11:09                2979
eventbuffer.prepend.php                            28-Sep-2020 11:09                3267
eventbuffer.prependbuffer.php                      28-Sep-2020 11:09                3483
eventbuffer.pullup.php                             28-Sep-2020 11:09                4496
eventbuffer.read.php                               28-Sep-2020 11:09                4753
eventbuffer.readfrom.php                           28-Sep-2020 11:09                4230
eventbuffer.readline.php                           28-Sep-2020 11:09                4069
eventbuffer.search.php                             28-Sep-2020 11:09                8635
eventbuffer.searcheol.php                          28-Sep-2020 11:09                4555
eventbuffer.substr.php                             28-Sep-2020 11:09                3262
eventbuffer.unfreeze.php                           28-Sep-2020 11:09                2824
eventbuffer.unlock.php                             28-Sep-2020 11:09                2629
eventbuffer.write.php                              28-Sep-2020 11:09                3301
eventbufferevent.about.callbacks.php               28-Sep-2020 11:09                5423
eventbufferevent.close.php                         28-Sep-2020 11:09                2421
eventbufferevent.connect.php                       28-Sep-2020 11:09               26948
eventbufferevent.connecthost.php                   28-Sep-2020 11:09               18248
eventbufferevent.construct.php                     28-Sep-2020 11:09                6334
eventbufferevent.createpair.php                    28-Sep-2020 11:09                3888
eventbufferevent.disable.php                       28-Sep-2020 11:09                3056
eventbufferevent.enable.php                        28-Sep-2020 11:09                3321
eventbufferevent.free.php                          28-Sep-2020 11:09                2729
eventbufferevent.getdnserrorstring.php             28-Sep-2020 11:09                3010
eventbufferevent.getenabled.php                    28-Sep-2020 11:09                2983
eventbufferevent.getinput.php                      28-Sep-2020 11:09                5095
eventbufferevent.getoutput.php                     28-Sep-2020 11:09                8250
eventbufferevent.read.php                          28-Sep-2020 11:09                2898
eventbufferevent.readbuffer.php                    28-Sep-2020 11:09                3003
eventbufferevent.setcallbacks.php                  28-Sep-2020 11:09                4301
eventbufferevent.setpriority.php                   28-Sep-2020 11:09                2648
eventbufferevent.settimeouts.php                   28-Sep-2020 11:09                2822
eventbufferevent.setwatermark.php                  28-Sep-2020 11:09                3758
eventbufferevent.sslerror.php                      28-Sep-2020 11:09                6299
eventbufferevent.sslfilter.php                     28-Sep-2020 11:09               40768
eventbufferevent.sslgetcipherinfo.php              28-Sep-2020 11:09                2777
eventbufferevent.sslgetciphername.php              28-Sep-2020 11:09                2663
eventbufferevent.sslgetcipherversion.php           28-Sep-2020 11:09                2689
eventbufferevent.sslgetprotocol.php                28-Sep-2020 11:09                2623
eventbufferevent.sslrenegotiate.php                28-Sep-2020 11:09                2755
eventbufferevent.sslsocket.php                     28-Sep-2020 11:09                5191
eventbufferevent.write.php                         28-Sep-2020 11:09                2977
eventbufferevent.writebuffer.php                   28-Sep-2020 11:09                3108
eventconfig.avoidmethod.php                        28-Sep-2020 11:09                4182
eventconfig.construct.php                          28-Sep-2020 11:09                4451
eventconfig.requirefeatures.php                    28-Sep-2020 11:09                5904
eventconfig.setmaxdispatchinterval.php             28-Sep-2020 11:09                4215
eventdnsbase.addnameserverip.php                   28-Sep-2020 11:09                2672
eventdnsbase.addsearch.php                         28-Sep-2020 11:09                2406
eventdnsbase.clearsearch.php                       28-Sep-2020 11:09                2760
eventdnsbase.construct.php                         28-Sep-2020 11:09                3147
eventdnsbase.countnameservers.php                  28-Sep-2020 11:09                2431
eventdnsbase.loadhosts.php                         28-Sep-2020 11:09                2555
eventdnsbase.parseresolvconf.php                   28-Sep-2020 11:09                3967
eventdnsbase.setoption.php                         28-Sep-2020 11:09                3073
eventdnsbase.setsearchndots.php                    28-Sep-2020 11:09                2610
eventhttp.accept.php                               28-Sep-2020 11:09               13166
eventhttp.addserveralias.php                       28-Sep-2020 11:09                6378
eventhttp.bind.php                                 28-Sep-2020 11:09                7790
eventhttp.construct.php                            28-Sep-2020 11:09               19804
eventhttp.removeserveralias.php                    28-Sep-2020 11:09                2949
eventhttp.setallowedmethods.php                    28-Sep-2020 11:09                3242
eventhttp.setcallback.php                          28-Sep-2020 11:09               19644
eventhttp.setdefaultcallback.php                   28-Sep-2020 11:09                7702
eventhttp.setmaxbodysize.php                       28-Sep-2020 11:09                2773
eventhttp.setmaxheaderssize.php                    28-Sep-2020 11:09                2682
eventhttp.settimeout.php                           28-Sep-2020 11:09                2363
eventhttpconnection.construct.php                  28-Sep-2020 11:09                4932
eventhttpconnection.getbase.php                    28-Sep-2020 11:09                2483
eventhttpconnection.getpeer.php                    28-Sep-2020 11:09                2820
eventhttpconnection.makerequest.php                28-Sep-2020 11:09               12479
eventhttpconnection.setclosecallback.php           28-Sep-2020 11:09               11696
eventhttpconnection.setlocaladdress.php            28-Sep-2020 11:09                3059
eventhttpconnection.setlocalport.php               28-Sep-2020 11:09                2943
eventhttpconnection.setmaxbodysize.php             28-Sep-2020 11:09                2985
eventhttpconnection.setmaxheaderssize.php          28-Sep-2020 11:09                3003
eventhttpconnection.setretries.php                 28-Sep-2020 11:09                2583
eventhttpconnection.settimeout.php                 28-Sep-2020 11:09                2480
eventhttprequest.addheader.php                     28-Sep-2020 11:09                3570
eventhttprequest.cancel.php                        28-Sep-2020 11:09                2750
eventhttprequest.clearheaders.php                  28-Sep-2020 11:09                2740
eventhttprequest.closeconnection.php               28-Sep-2020 11:09                2327
eventhttprequest.construct.php                     28-Sep-2020 11:09               12638
eventhttprequest.findheader.php                    28-Sep-2020 11:09                3285
eventhttprequest.free.php                          28-Sep-2020 11:09                2246
eventhttprequest.getbufferevent.php                28-Sep-2020 11:09                3546
eventhttprequest.getcommand.php                    28-Sep-2020 11:09                2605
eventhttprequest.getconnection.php                 28-Sep-2020 11:09                4250
eventhttprequest.gethost.php                       28-Sep-2020 11:09                2778
eventhttprequest.getinputbuffer.php                28-Sep-2020 11:09                2718
eventhttprequest.getinputheaders.php               28-Sep-2020 11:09                2750
eventhttprequest.getoutputbuffer.php               28-Sep-2020 11:09                2776
eventhttprequest.getoutputheaders.php              28-Sep-2020 11:09                2733
eventhttprequest.getresponsecode.php               28-Sep-2020 11:09                3067
eventhttprequest.geturi.php                        28-Sep-2020 11:09                2987
eventhttprequest.removeheader.php                  28-Sep-2020 11:09                3294
eventhttprequest.senderror.php                     28-Sep-2020 11:09                5633
eventhttprequest.sendreply.php                     28-Sep-2020 11:09                3842
eventhttprequest.sendreplychunk.php                28-Sep-2020 11:09                3346
eventhttprequest.sendreplyend.php                  28-Sep-2020 11:09                2988
eventhttprequest.sendreplystart.php                28-Sep-2020 11:09                4123
eventlistener.construct.php                        28-Sep-2020 11:09               27349
eventlistener.disable.php                          28-Sep-2020 11:09                2602
eventlistener.enable.php                           28-Sep-2020 11:09                2589
eventlistener.getbase.php                          28-Sep-2020 11:09                2250
eventlistener.getsocketname.php                    28-Sep-2020 11:09                3040
eventlistener.setcallback.php                      28-Sep-2020 11:09                5504
eventlistener.seterrorcallback.php                 28-Sep-2020 11:09                4143
eventsslcontext.construct.php                      28-Sep-2020 11:09                5713
eventutil.construct.php                            28-Sep-2020 11:09                2265
eventutil.getlastsocketerrno.php                   28-Sep-2020 11:09                3136
eventutil.getlastsocketerror.php                   28-Sep-2020 11:09                2964
eventutil.getsocketfd.php                          28-Sep-2020 11:09                3045
eventutil.getsocketname.php                        28-Sep-2020 11:09                3473
eventutil.setsocketoption.php                      28-Sep-2020 11:09                5256
eventutil.sslrandpoll.php                          28-Sep-2020 11:09                2288
evfork.construct.php                               28-Sep-2020 11:09                3693
evfork.createstopped.php                           28-Sep-2020 11:09                3579
evidle.construct.php                               28-Sep-2020 11:09                3705
evidle.createstopped.php                           28-Sep-2020 11:09                3876
evio.construct.php                                 28-Sep-2020 11:09                4600
evio.createstopped.php                             28-Sep-2020 11:09                4867
evio.set.php                                       28-Sep-2020 11:09                2720
evloop.backend.php                                 28-Sep-2020 11:09                2624
evloop.check.php                                   28-Sep-2020 11:09                2988
evloop.child.php                                   28-Sep-2020 11:09                3218
evloop.construct.php                               28-Sep-2020 11:09                3870
evloop.defaultloop.php                             28-Sep-2020 11:09                4326
evloop.embed.php                                   28-Sep-2020 11:09                3247
evloop.fork.php                                    28-Sep-2020 11:09                3238
evloop.idle.php                                    28-Sep-2020 11:09                3258
evloop.invokepending.php                           28-Sep-2020 11:09                2157
evloop.io.php                                      28-Sep-2020 11:09                3532
evloop.loopfork.php                                28-Sep-2020 11:09                2462
evloop.now.php                                     28-Sep-2020 11:09                2742
evloop.nowupdate.php                               28-Sep-2020 11:09                3108
evloop.periodic.php                                28-Sep-2020 11:09                3580
evloop.prepare.php                                 28-Sep-2020 11:09                3253
evloop.resume.php                                  28-Sep-2020 11:09                2771
evloop.run.php                                     28-Sep-2020 11:09                4685
evloop.signal.php                                  28-Sep-2020 11:09                3392
evloop.stat.php                                    28-Sep-2020 11:09                3492
evloop.stop.php                                    28-Sep-2020 11:09                2830
evloop.suspend.php                                 28-Sep-2020 11:09                2762
evloop.timer.php                                   28-Sep-2020 11:09                3510
evloop.verify.php                                  28-Sep-2020 11:09                2538
evperiodic.again.php                               28-Sep-2020 11:09                2508
evperiodic.at.php                                  28-Sep-2020 11:09                2529
evperiodic.construct.php                           28-Sep-2020 11:09               10100
evperiodic.createstopped.php                       28-Sep-2020 11:09                5413
evperiodic.set.php                                 28-Sep-2020 11:09                2991
evprepare.construct.php                            28-Sep-2020 11:09                3421
evprepare.createstopped.php                        28-Sep-2020 11:09                4179
evsignal.construct.php                             28-Sep-2020 11:09                5491
evsignal.createstopped.php                         28-Sep-2020 11:09                4559
evsignal.set.php                                   28-Sep-2020 11:09                2343
evstat.attr.php                                    28-Sep-2020 11:09                8642
evstat.construct.php                               28-Sep-2020 11:09                7397
evstat.createstopped.php                           28-Sep-2020 11:09                4834
evstat.prev.php                                    28-Sep-2020 11:09                2887
evstat.set.php                                     28-Sep-2020 11:09                2670
evstat.stat.php                                    28-Sep-2020 11:09                2807
evtimer.again.php                                  28-Sep-2020 11:09                3006
evtimer.construct.php                              28-Sep-2020 11:09               13468
evtimer.createstopped.php                          28-Sep-2020 11:09                8264
evtimer.set.php                                    28-Sep-2020 11:09                2811
evwatcher.clear.php                                28-Sep-2020 11:09                2716
evwatcher.construct.php                            28-Sep-2020 11:09                1844
evwatcher.feed.php                                 28-Sep-2020 11:09                2458
evwatcher.getloop.php                              28-Sep-2020 11:09                2225
evwatcher.invoke.php                               28-Sep-2020 11:09                2459
evwatcher.keepalive.php                            28-Sep-2020 11:09                5018
evwatcher.setcallback.php                          28-Sep-2020 11:09                2467
evwatcher.start.php                                28-Sep-2020 11:09                2451
evwatcher.stop.php                                 28-Sep-2020 11:09                2421
example.xml-external-entity.php                    28-Sep-2020 11:09               25950
example.xml-map-tags.php                           28-Sep-2020 11:09                9006
example.xml-structure.php                          28-Sep-2020 11:09                7593
example.xmlwriter-namespace.php                    28-Sep-2020 11:09                5394
example.xmlwriter-oop.php                          28-Sep-2020 11:09                3331
example.xmlwriter-simple.php                       28-Sep-2020 11:09                8845
exception.clone.php                                28-Sep-2020 11:08                2351
exception.construct.php                            28-Sep-2020 11:08                4282
exception.getcode.php                              28-Sep-2020 11:08                4674
exception.getfile.php                              28-Sep-2020 11:08                3876
exception.getline.php                              28-Sep-2020 11:08                4120
exception.getmessage.php                           28-Sep-2020 11:08                3921
exception.getprevious.php                          28-Sep-2020 11:08                7515
exception.gettrace.php                             28-Sep-2020 11:08                4376
exception.gettraceasstring.php                     28-Sep-2020 11:08                4165
exception.tostring.php                             28-Sep-2020 11:08                4129
exec.configuration.php                             28-Sep-2020 11:09                1142
exec.constants.php                                 28-Sep-2020 11:09                1076
exec.installation.php                              28-Sep-2020 11:09                1126
exec.requirements.php                              28-Sep-2020 11:09                1102
exec.resources.php                                 28-Sep-2020 11:09                1250
exec.setup.php                                     28-Sep-2020 11:09                1482
exif.configuration.php                             28-Sep-2020 11:09                7425
exif.constants.php                                 28-Sep-2020 11:09                1883
exif.installation.php                              28-Sep-2020 11:09                1614
exif.requirements.php                              28-Sep-2020 11:09                1705
exif.resources.php                                 28-Sep-2020 11:09                1085
exif.setup.php                                     28-Sep-2020 11:09                1476
expect.configuration.php                           28-Sep-2020 11:09                5262
expect.constants.php                               28-Sep-2020 11:09                3561
expect.examples-usage.php                          28-Sep-2020 11:09               17092
expect.examples.php                                28-Sep-2020 11:09                1280
expect.installation.php                            28-Sep-2020 11:09                2294
expect.requirements.php                            28-Sep-2020 11:09                1224
expect.resources.php                               28-Sep-2020 11:09                1327
expect.setup.php                                   28-Sep-2020 11:09                1498
extensions.alphabetical.php                        28-Sep-2020 11:09               23275
extensions.membership.php                          28-Sep-2020 11:09               21107
extensions.php                                     28-Sep-2020 11:09                1573
extensions.state.php                               28-Sep-2020 11:09                3323
fann.configuration.php                             28-Sep-2020 11:09                1142
fann.constants.php                                 28-Sep-2020 11:09               20710
fann.examples-1.php                                28-Sep-2020 11:09                8977
fann.examples.php                                  28-Sep-2020 11:09                1236
fann.installation.php                              28-Sep-2020 11:09                4931
fann.requirements.php                              28-Sep-2020 11:09                1070
fann.resources.php                                 28-Sep-2020 11:09                1039
fann.setup.php                                     28-Sep-2020 11:09                1447
fannconnection.construct.php                       28-Sep-2020 11:09                2734
fannconnection.getfromneuron.php                   28-Sep-2020 11:09                2234
fannconnection.gettoneuron.php                     28-Sep-2020 11:09                2227
fannconnection.getweight.php                       28-Sep-2020 11:09                2198
fannconnection.setweight.php                       28-Sep-2020 11:09                2753
faq.build.php                                      28-Sep-2020 11:09               27328
faq.com.php                                        28-Sep-2020 11:09               12267
faq.databases.php                                  28-Sep-2020 11:09               12760
faq.general.php                                    28-Sep-2020 11:09                4933
faq.html.php                                       28-Sep-2020 11:09               21411
faq.installation.php                               28-Sep-2020 11:09               30794
faq.mailinglist.php                                28-Sep-2020 11:09               11279
faq.misc.php                                       28-Sep-2020 11:09               16184
faq.obtaining.php                                  28-Sep-2020 11:09               10871
faq.passwords.php                                  28-Sep-2020 11:09               10441
faq.php                                            28-Sep-2020 11:09                1897
faq.using.php                                      28-Sep-2020 11:09               34621
fbsql.configuration.php                            28-Sep-2020 11:08                3584
fbsql.constants.php                                28-Sep-2020 11:08                6430
fbsql.installation.php                             28-Sep-2020 11:08                2157
fbsql.requirements.php                             28-Sep-2020 11:08                1310
fbsql.resources.php                                28-Sep-2020 11:08                1091
fbsql.setup.php                                    28-Sep-2020 11:08                1492
fdf.configuration.php                              28-Sep-2020 11:09                1136
fdf.constants.php                                  28-Sep-2020 11:09                8064
fdf.examples.php                                   28-Sep-2020 11:09                7689
fdf.installation.php                               28-Sep-2020 11:09                3521
fdf.requirements.php                               28-Sep-2020 11:09                1514
fdf.resources.php                                  28-Sep-2020 11:09                1672
fdf.setup.php                                      28-Sep-2020 11:09                1457
features.commandline.differences.php               28-Sep-2020 11:08               12566
features.commandline.ini.php                       28-Sep-2020 11:08                2164
features.commandline.interactive.php               28-Sep-2020 11:08                8079
features.commandline.introduction.php              28-Sep-2020 11:08                6782
features.commandline.io-streams.php                28-Sep-2020 11:08                6032
features.commandline.options.php                   28-Sep-2020 11:08               26951
features.commandline.php                           28-Sep-2020 11:08                1942
features.commandline.usage.php                     28-Sep-2020 11:08               14479
features.commandline.webserver.php                 28-Sep-2020 11:08               12596
features.connection-handling.php                   28-Sep-2020 11:08                6242
features.cookies.php                               28-Sep-2020 11:08                3405
features.dtrace.dtrace.php                         28-Sep-2020 11:08               13854
features.dtrace.introduction.php                   28-Sep-2020 11:08                3243
features.dtrace.php                                28-Sep-2020 11:08                1533
features.dtrace.systemtap.php                      28-Sep-2020 11:08                7935
features.file-upload.common-pitfalls.php           28-Sep-2020 11:08                5390
features.file-upload.errors.php                    28-Sep-2020 11:08                3913
features.file-upload.errors.seealso.php            28-Sep-2020 11:08                1258
features.file-upload.multiple.php                  28-Sep-2020 11:08                4831
features.file-upload.php                           28-Sep-2020 11:08                1768
features.file-upload.post-method.php               28-Sep-2020 11:08               16447
features.file-upload.put-method.php                28-Sep-2020 11:08                5656
features.gc.collecting-cycles.php                  28-Sep-2020 11:08                7863
features.gc.performance-considerations.php         28-Sep-2020 11:08               14039
features.gc.php                                    28-Sep-2020 11:08                1637
features.gc.refcounting-basics.php                 28-Sep-2020 11:08               21598
features.http-auth.php                             28-Sep-2020 11:08               27355
features.persistent-connections.php                28-Sep-2020 11:08                9733
features.php                                       28-Sep-2020 11:08                4260
features.remote-files.php                          28-Sep-2020 11:08                8639
features.safe-mode.functions.php                   28-Sep-2020 11:08               17141
features.safe-mode.php                             28-Sep-2020 11:08                2694
features.session.security.management.php           28-Sep-2020 11:09               23142
features.sessions.php                              28-Sep-2020 11:08                1332
features.xforms.php                                28-Sep-2020 11:08                5507
ffi.addr.php                                       28-Sep-2020 11:08                2621
ffi.alignof.php                                    28-Sep-2020 11:08                2528
ffi.arraytype.php                                  28-Sep-2020 11:08                4445
ffi.cast.php                                       28-Sep-2020 11:08                4353
ffi.cdef.php                                       28-Sep-2020 11:08                3452
ffi.configuration.php                              28-Sep-2020 11:08                4029
ffi.constants.php                                  28-Sep-2020 11:08                1026
ffi.examples-basic.php                             28-Sep-2020 11:08               14906
ffi.examples-callback.php                          28-Sep-2020 11:08                4988
ffi.examples-complete.php                          28-Sep-2020 11:08                5745
ffi.examples.php                                   28-Sep-2020 11:08                1395
ffi.free.php                                       28-Sep-2020 11:08                2307
ffi.installation.php                               28-Sep-2020 11:08                1308
ffi.isnull.php                                     28-Sep-2020 11:08                2282
ffi.load.php                                       28-Sep-2020 11:08                3942
ffi.memcmp.php                                     28-Sep-2020 11:08                3629
ffi.memcpy.php                                     28-Sep-2020 11:08                3254
ffi.memset.php                                     28-Sep-2020 11:08                2888
ffi.new.php                                        28-Sep-2020 11:08                4973
ffi.requirements.php                               28-Sep-2020 11:08                1167
ffi.resources.php                                  28-Sep-2020 11:08                1079
ffi.scope.php                                      28-Sep-2020 11:08                2968
ffi.setup.php                                      28-Sep-2020 11:08                1446
ffi.sizeof.php                                     28-Sep-2020 11:08                2432
ffi.string.php                                     28-Sep-2020 11:08                3156
ffi.type.php                                       28-Sep-2020 11:08                3489
ffi.typeof.php                                     28-Sep-2020 11:08                2621
fileinfo.configuration.php                         28-Sep-2020 11:09                1166
fileinfo.constants.php                             28-Sep-2020 11:09                5649
fileinfo.installation.php                          28-Sep-2020 11:09                2475
fileinfo.requirements.php                          28-Sep-2020 11:09                1139
fileinfo.resources.php                             28-Sep-2020 11:09                1306
fileinfo.setup.php                                 28-Sep-2020 11:09                1518
filepro.configuration.php                          28-Sep-2020 11:08                1160
filepro.constants.php                              28-Sep-2020 11:08                1058
filepro.installation.php                           28-Sep-2020 11:08                1651
filepro.requirements.php                           28-Sep-2020 11:08                1120
filepro.resources.php                              28-Sep-2020 11:08                1103
filepro.setup.php                                  28-Sep-2020 11:08                1505
filesystem.configuration.php                       28-Sep-2020 11:09                7412
filesystem.constants.php                           28-Sep-2020 11:09               10957
filesystem.installation.php                        28-Sep-2020 11:09                1162
filesystem.requirements.php                        28-Sep-2020 11:09                1138
filesystem.resources.php                           28-Sep-2020 11:09                1263
filesystem.setup.php                               28-Sep-2020 11:09                1544
filesystemiterator.construct.php                   28-Sep-2020 11:09                5821
filesystemiterator.current.php                     28-Sep-2020 11:09                5149
filesystemiterator.getflags.php                    28-Sep-2020 11:09                3083
filesystemiterator.key.php                         28-Sep-2020 11:09                5211
filesystemiterator.next.php                        28-Sep-2020 11:09                4495
filesystemiterator.rewind.php                      28-Sep-2020 11:09                5112
filesystemiterator.setflags.php                    28-Sep-2020 11:09                6629
filter.configuration.php                           28-Sep-2020 11:09                5146
filter.constants.php                               28-Sep-2020 11:09               20967
filter.examples.php                                28-Sep-2020 11:09                1341
filter.examples.sanitization.php                   28-Sep-2020 11:09                5998
filter.examples.validation.php                     28-Sep-2020 11:09               11090
filter.filters.flags.php                           28-Sep-2020 11:09               11538
filter.filters.misc.php                            28-Sep-2020 11:09                1748
filter.filters.php                                 28-Sep-2020 11:09                1489
filter.filters.sanitize.php                        28-Sep-2020 11:09                8529
filter.filters.validate.php                        28-Sep-2020 11:09                9583
filter.installation.php                            28-Sep-2020 11:09                1396
filter.requirements.php                            28-Sep-2020 11:09                1114
filter.resources.php                               28-Sep-2020 11:09                1087
filter.setup.php                                   28-Sep-2020 11:09                1485
filteriterator.accept.php                          28-Sep-2020 11:09                5480
filteriterator.construct.php                       28-Sep-2020 11:09                3200
filteriterator.current.php                         28-Sep-2020 11:09                2975
filteriterator.getinneriterator.php                28-Sep-2020 11:09                2438
filteriterator.key.php                             28-Sep-2020 11:09                2911
filteriterator.next.php                            28-Sep-2020 11:09                2870
filteriterator.rewind.php                          28-Sep-2020 11:09                3061
filteriterator.valid.php                           28-Sep-2020 11:09                2406
filters.compression.php                            28-Sep-2020 11:09               16978
filters.convert.php                                28-Sep-2020 11:09               11906
filters.encryption.php                             28-Sep-2020 11:09               46029
filters.php                                        28-Sep-2020 11:09                3213
filters.string.php                                 28-Sep-2020 11:09               10519
finfo.buffer.php                                   28-Sep-2020 11:09                2106
finfo.construct.php                                28-Sep-2020 11:09                2092
finfo.file.php                                     28-Sep-2020 11:09                2093
finfo.set-flags.php                                28-Sep-2020 11:09                1850
fpm.setup.php                                      28-Sep-2020 11:09                1169
ftp.configuration.php                              28-Sep-2020 11:09                1136
ftp.constants.php                                  28-Sep-2020 11:09                4771
ftp.examples-basic.php                             28-Sep-2020 11:09                5206
ftp.examples.php                                   28-Sep-2020 11:09                1253
ftp.installation.php                               28-Sep-2020 11:09                1563
ftp.requirements.php                               28-Sep-2020 11:09                1096
ftp.resources.php                                  28-Sep-2020 11:09                1402
ftp.setup.php                                      28-Sep-2020 11:09                1457
funchand.configuration.php                         28-Sep-2020 11:09                1166
funchand.constants.php                             28-Sep-2020 11:09                1084
funchand.installation.php                          28-Sep-2020 11:09                1150
funchand.requirements.php                          28-Sep-2020 11:09                1126
funchand.resources.php                             28-Sep-2020 11:09                1109
funchand.setup.php                                 28-Sep-2020 11:09                1504
funcref.php                                        28-Sep-2020 11:09               14917
function.abs.php                                   28-Sep-2020 11:09                4870
function.acos.php                                  28-Sep-2020 11:09                3273
function.acosh.php                                 28-Sep-2020 11:09                3608
function.addcslashes.php                           28-Sep-2020 11:09                8617
function.addslashes.php                            28-Sep-2020 11:09                7477
function.apache-child-terminate.php                28-Sep-2020 11:09                4105
function.apache-get-modules.php                    28-Sep-2020 11:09                3074
function.apache-get-version.php                    28-Sep-2020 11:09                3448
function.apache-getenv.php                         28-Sep-2020 11:09                4902
function.apache-lookup-uri.php                     28-Sep-2020 11:09                5889
function.apache-note.php                           28-Sep-2020 11:09                6574
function.apache-request-headers.php                28-Sep-2020 11:09                5906
function.apache-reset-timeout.php                  28-Sep-2020 11:09                3458
function.apache-response-headers.php               28-Sep-2020 11:09                4725
function.apache-setenv.php                         28-Sep-2020 11:09                5402
function.apcu-add.php                              28-Sep-2020 11:08                8166
function.apcu-cache-info.php                       28-Sep-2020 11:08                6259
function.apcu-cas.php                              28-Sep-2020 11:08                8813
function.apcu-clear-cache.php                      28-Sep-2020 11:08                2432
function.apcu-dec.php                              28-Sep-2020 11:08                8178
function.apcu-delete.php                           28-Sep-2020 11:08                6046
function.apcu-enabled.php                          28-Sep-2020 11:08                2160
function.apcu-entry.php                            28-Sep-2020 11:08                8718
function.apcu-exists.php                           28-Sep-2020 11:08                7084
function.apcu-fetch.php                            28-Sep-2020 11:08                5496
function.apcu-inc.php                              28-Sep-2020 11:08                8162
function.apcu-sma-info.php                         28-Sep-2020 11:08                4123
function.apcu-store.php                            28-Sep-2020 11:08                6963
function.array-change-key-case.php                 28-Sep-2020 11:09                5394
function.array-chunk.php                           28-Sep-2020 11:09                6486
function.array-column.php                          28-Sep-2020 11:09               18200
function.array-combine.php                         28-Sep-2020 11:09                7095
function.array-count-values.php                    28-Sep-2020 11:09                5600
function.array-diff-assoc.php                      28-Sep-2020 11:09               11079
function.array-diff-key.php                        28-Sep-2020 11:09               13179
function.array-diff-uassoc.php                     28-Sep-2020 11:09               12275
function.array-diff-ukey.php                       28-Sep-2020 11:09               12639
function.array-diff.php                            28-Sep-2020 11:09               12430
function.array-fill-keys.php                       28-Sep-2020 11:09                5416
function.array-fill.php                            28-Sep-2020 11:09                7547
function.array-filter.php                          28-Sep-2020 11:09               16813
function.array-flip.php                            28-Sep-2020 11:09                7390
function.array-intersect-assoc.php                 28-Sep-2020 11:09                8810
function.array-intersect-key.php                   28-Sep-2020 11:09               10476
function.array-intersect-uassoc.php                28-Sep-2020 11:09                8855
function.array-intersect-ukey.php                  28-Sep-2020 11:09               12406
function.array-intersect.php                       28-Sep-2020 11:09                6690
function.array-key-exists.php                      28-Sep-2020 11:09                8859
function.array-key-first.php                       28-Sep-2020 11:09                7085
function.array-key-last.php                        28-Sep-2020 11:09                3001
function.array-keys.php                            28-Sep-2020 11:09                8469
function.array-map.php                             28-Sep-2020 11:09               23319
function.array-merge-recursive.php                 28-Sep-2020 11:09                6849
function.array-merge.php                           28-Sep-2020 11:09               12931
function.array-multisort.php                       28-Sep-2020 11:09               24590
function.array-pad.php                             28-Sep-2020 11:09                7090
function.array-pop.php                             28-Sep-2020 11:09                5960
function.array-product.php                         28-Sep-2020 11:09                4934
function.array-push.php                            28-Sep-2020 11:09                7088
function.array-rand.php                            28-Sep-2020 11:09                6669
function.array-reduce.php                          28-Sep-2020 11:09               10531
function.array-replace-recursive.php               28-Sep-2020 11:09               11345
function.array-replace.php                         28-Sep-2020 11:09                6851
function.array-reverse.php                         28-Sep-2020 11:09                5985
function.array-search.php                          28-Sep-2020 11:09                8924
function.array-shift.php                           28-Sep-2020 11:09                5729
function.array-slice.php                           28-Sep-2020 11:09               14864
function.array-splice.php                          28-Sep-2020 11:09               17273
function.array-sum.php                             28-Sep-2020 11:09                4990
function.array-udiff-assoc.php                     28-Sep-2020 11:09               14919
function.array-udiff-uassoc.php                    28-Sep-2020 11:09               16418
function.array-udiff.php                           28-Sep-2020 11:09               29667
function.array-uintersect-assoc.php                28-Sep-2020 11:09                8088
function.array-uintersect-uassoc.php               28-Sep-2020 11:09                8326
function.array-uintersect.php                      28-Sep-2020 11:09                7669
function.array-unique.php                          28-Sep-2020 11:09               10030
function.array-unshift.php                         28-Sep-2020 11:09                5827
function.array-values.php                          28-Sep-2020 11:09                4488
function.array-walk-recursive.php                  28-Sep-2020 11:09                7668
function.array-walk.php                            28-Sep-2020 11:09               11801
function.array.php                                 28-Sep-2020 11:09               12194
function.arsort.php                                28-Sep-2020 11:09                6325
function.asin.php                                  28-Sep-2020 11:09                3267
function.asinh.php                                 28-Sep-2020 11:09                3633
function.asort.php                                 28-Sep-2020 11:09                6244
function.assert-options.php                        28-Sep-2020 11:08               12190
function.assert.php                                28-Sep-2020 11:08               26664
function.atan.php                                  28-Sep-2020 11:09                3268
function.atan2.php                                 28-Sep-2020 11:09                3163
function.atanh.php                                 28-Sep-2020 11:09                3624
function.autoload.php                              28-Sep-2020 11:09                3032
function.base-convert.php                          28-Sep-2020 11:09                6640
function.base64-decode.php                         28-Sep-2020 11:09                5226
function.base64-encode.php                         28-Sep-2020 11:09                4634
function.basename.php                              28-Sep-2020 11:09                7289
function.bcadd.php                                 28-Sep-2020 11:09                5031
function.bccomp.php                                28-Sep-2020 11:09                5016
function.bcdiv.php                                 28-Sep-2020 11:09                4484
function.bcmod.php                                 28-Sep-2020 11:09                7104
function.bcmul.php                                 28-Sep-2020 11:09                6797
function.bcpow.php                                 28-Sep-2020 11:09                6876
function.bcpowmod.php                              28-Sep-2020 11:09                6299
function.bcscale.php                               28-Sep-2020 11:09                5063
function.bcsqrt.php                                28-Sep-2020 11:09                4074
function.bcsub.php                                 28-Sep-2020 11:09                4988
function.bin2hex.php                               28-Sep-2020 11:09                2965
function.bind-textdomain-codeset.php               28-Sep-2020 11:09                3023
function.bindec.php                                28-Sep-2020 11:09               16052
function.bindtextdomain.php                        28-Sep-2020 11:09                3961
function.blenc-encrypt.php                         28-Sep-2020 11:08                5475
function.boolval.php                               28-Sep-2020 11:09               10817
function.bson-decode.php                           28-Sep-2020 11:08                2378
function.bson-encode.php                           28-Sep-2020 11:08                2463
function.bzclose.php                               28-Sep-2020 11:08                2861
function.bzcompress.php                            28-Sep-2020 11:08                4988
function.bzdecompress.php                          28-Sep-2020 11:08                5479
function.bzerrno.php                               28-Sep-2020 11:08                2981
function.bzerror.php                               28-Sep-2020 11:08                4238
function.bzerrstr.php                              28-Sep-2020 11:08                2988
function.bzflush.php                               28-Sep-2020 11:08                3030
function.bzopen.php                                28-Sep-2020 11:08                4567
function.bzread.php                                28-Sep-2020 11:08                6398
function.bzwrite.php                               28-Sep-2020 11:08                5404
function.cal-days-in-month.php                     28-Sep-2020 11:09                4476
function.cal-from-jd.php                           28-Sep-2020 11:09                6783
function.cal-info.php                              28-Sep-2020 11:09                5913
function.cal-to-jd.php                             28-Sep-2020 11:09                5318
function.call-user-func-array.php                  28-Sep-2020 11:09               15255
function.call-user-func.php                        28-Sep-2020 11:09               15828
function.call-user-method-array.php                28-Sep-2020 11:09                4978
function.call-user-method.php                      28-Sep-2020 11:09                5742
function.ceil.php                                  28-Sep-2020 11:09                4350
function.chdir.php                                 28-Sep-2020 11:09                5625
function.checkdate.php                             28-Sep-2020 11:09                5348
function.checkdnsrr.php                            28-Sep-2020 11:09                5642
function.chgrp.php                                 28-Sep-2020 11:09                6978
function.chmod.php                                 28-Sep-2020 11:09                9368
function.chop.php                                  28-Sep-2020 11:09                1921
function.chown.php                                 28-Sep-2020 11:09                7024
function.chr.php                                   28-Sep-2020 11:09                8397
function.chroot.php                                28-Sep-2020 11:09                4307
function.chunk-split.php                           28-Sep-2020 11:09                5394
function.class-alias.php                           28-Sep-2020 11:09                7273
function.class-exists.php                          28-Sep-2020 11:09                7772
function.class-implements.php                      28-Sep-2020 11:09                6500
function.class-parents.php                         28-Sep-2020 11:09                6157
function.class-uses.php                            28-Sep-2020 11:09                6237
function.classkit-import.php                       28-Sep-2020 11:09                6519
function.classkit-method-add.php                   28-Sep-2020 11:09                8361
function.classkit-method-copy.php                  28-Sep-2020 11:09                7102
function.classkit-method-redefine.php              28-Sep-2020 11:09                8826
function.classkit-method-remove.php                28-Sep-2020 11:09                6665
function.classkit-method-rename.php                28-Sep-2020 11:09                6629
function.clearstatcache.php                        28-Sep-2020 11:09               11374
function.cli-get-process-title.php                 28-Sep-2020 11:08                4192
function.cli-set-process-title.php                 28-Sep-2020 11:08                5673
function.closedir.php                              28-Sep-2020 11:09                4651
function.closelog.php                              28-Sep-2020 11:09                2682
function.com-create-guid.php                       28-Sep-2020 11:09                2314
function.com-event-sink.php                        28-Sep-2020 11:09                9328
function.com-get-active-object.php                 28-Sep-2020 11:09                4712
function.com-load-typelib.php                      28-Sep-2020 11:09                4957
function.com-message-pump.php                      28-Sep-2020 11:09                3645
function.com-print-typeinfo.php                    28-Sep-2020 11:09                4379
function.commonmark-parse.php                      28-Sep-2020 11:09                3671
function.commonmark-render-html.php                28-Sep-2020 11:09                4167
function.commonmark-render-latex.php               28-Sep-2020 11:09                4411
function.commonmark-render-man.php                 28-Sep-2020 11:09                4395
function.commonmark-render-xml.php                 28-Sep-2020 11:09                4125
function.commonmark-render.php                     28-Sep-2020 11:09                4345
function.compact.php                               28-Sep-2020 11:09                7597
function.connection-aborted.php                    28-Sep-2020 11:09                2819
function.connection-status.php                     28-Sep-2020 11:09                2905
function.constant.php                              28-Sep-2020 11:09                6603
function.convert-cyr-string.php                    28-Sep-2020 11:09                4487
function.convert-uudecode.php                      28-Sep-2020 11:09                4175
function.convert-uuencode.php                      28-Sep-2020 11:09                4827
function.copy.php                                  28-Sep-2020 11:09                6356
function.cos.php                                   28-Sep-2020 11:09                3775
function.cosh.php                                  28-Sep-2020 11:09                3085
function.count-chars.php                           28-Sep-2020 11:09                6846
function.count.php                                 28-Sep-2020 11:09               11892
function.crc32.php                                 28-Sep-2020 11:09                7137
function.create-function.php                       28-Sep-2020 11:09               19217
function.crypt.php                                 28-Sep-2020 11:09               22853
function.ctype-alnum.php                           28-Sep-2020 11:09                6224
function.ctype-alpha.php                           28-Sep-2020 11:09                6603
function.ctype-cntrl.php                           28-Sep-2020 11:09                5959
function.ctype-digit.php                           28-Sep-2020 11:09                9576
function.ctype-graph.php                           28-Sep-2020 11:09                6795
function.ctype-lower.php                           28-Sep-2020 11:09                6153
function.ctype-print.php                           28-Sep-2020 11:09                6906
function.ctype-punct.php                           28-Sep-2020 11:09                6167
function.ctype-space.php                           28-Sep-2020 11:09                6976
function.ctype-upper.php                           28-Sep-2020 11:09                6210
function.ctype-xdigit.php                          28-Sep-2020 11:09                5852
function.cubrid-affected-rows.php                  28-Sep-2020 11:08                9182
function.cubrid-bind.php                           28-Sep-2020 11:08               21169
function.cubrid-client-encoding.php                28-Sep-2020 11:08                5048
function.cubrid-close-prepare.php                  28-Sep-2020 11:08                6590
function.cubrid-close-request.php                  28-Sep-2020 11:08                6601
function.cubrid-close.php                          28-Sep-2020 11:08                6393
function.cubrid-col-get.php                        28-Sep-2020 11:08                8419
function.cubrid-col-size.php                       28-Sep-2020 11:08                8571
function.cubrid-column-names.php                   28-Sep-2020 11:08                8601
function.cubrid-column-types.php                   28-Sep-2020 11:08                8582
function.cubrid-commit.php                         28-Sep-2020 11:08               16153
function.cubrid-connect-with-url.php               28-Sep-2020 11:08               15275
function.cubrid-connect.php                        28-Sep-2020 11:08               11893
function.cubrid-current-oid.php                    28-Sep-2020 11:08                5812
function.cubrid-data-seek.php                      28-Sep-2020 11:08                7178
function.cubrid-db-name.php                        28-Sep-2020 11:08                6330
function.cubrid-disconnect.php                     28-Sep-2020 11:08                7381
function.cubrid-drop.php                           28-Sep-2020 11:08               11533
function.cubrid-errno.php                          28-Sep-2020 11:08                6839
function.cubrid-error-code-facility.php            28-Sep-2020 11:08                5807
function.cubrid-error-code.php                     28-Sep-2020 11:08                5860
function.cubrid-error-msg.php                      28-Sep-2020 11:08                5259
function.cubrid-error.php                          28-Sep-2020 11:08                6397
function.cubrid-execute.php                        28-Sep-2020 11:08               14015
function.cubrid-fetch-array.php                    28-Sep-2020 11:08                9870
function.cubrid-fetch-assoc.php                    28-Sep-2020 11:08                9041
function.cubrid-fetch-field.php                    28-Sep-2020 11:08               14124
function.cubrid-fetch-lengths.php                  28-Sep-2020 11:08                5948
function.cubrid-fetch-object.php                   28-Sep-2020 11:08               12011
function.cubrid-fetch-row.php                      28-Sep-2020 11:08                8927
function.cubrid-fetch.php                          28-Sep-2020 11:08               10133
function.cubrid-field-flags.php                    28-Sep-2020 11:08                7616
function.cubrid-field-len.php                      28-Sep-2020 11:08                8199
function.cubrid-field-name.php                     28-Sep-2020 11:08                7032
function.cubrid-field-seek.php                     28-Sep-2020 11:08               10774
function.cubrid-field-table.php                    28-Sep-2020 11:08                7254
function.cubrid-field-type.php                     28-Sep-2020 11:08                7318
function.cubrid-free-result.php                    28-Sep-2020 11:08                5540
function.cubrid-get-autocommit.php                 28-Sep-2020 11:08                3447
function.cubrid-get-charset.php                    28-Sep-2020 11:08                4828
function.cubrid-get-class-name.php                 28-Sep-2020 11:08                6147
function.cubrid-get-client-info.php                28-Sep-2020 11:08                8228
function.cubrid-get-db-parameter.php               28-Sep-2020 11:08               14290
function.cubrid-get-query-timeout.php              28-Sep-2020 11:08                6506
function.cubrid-get-server-info.php                28-Sep-2020 11:08                8426
function.cubrid-get.php                            28-Sep-2020 11:08                9904
function.cubrid-insert-id.php                      28-Sep-2020 11:08                6990
function.cubrid-is-instance.php                    28-Sep-2020 11:08                7280
function.cubrid-list-dbs.php                       28-Sep-2020 11:08                4265
function.cubrid-load-from-glo.php                  28-Sep-2020 11:08                6737
function.cubrid-lob-close.php                      28-Sep-2020 11:08                7116
function.cubrid-lob-export.php                     28-Sep-2020 11:08                7677
function.cubrid-lob-get.php                        28-Sep-2020 11:08                7580
function.cubrid-lob-send.php                       28-Sep-2020 11:08                6879
function.cubrid-lob-size.php                       28-Sep-2020 11:08                5710
function.cubrid-lob2-bind.php                      28-Sep-2020 11:08                9460
function.cubrid-lob2-close.php                     28-Sep-2020 11:08                3101
function.cubrid-lob2-export.php                    28-Sep-2020 11:08                8588
function.cubrid-lob2-import.php                    28-Sep-2020 11:08                8452
function.cubrid-lob2-new.php                       28-Sep-2020 11:08                3594
function.cubrid-lob2-read.php                      28-Sep-2020 11:08               14378
function.cubrid-lob2-seek.php                      28-Sep-2020 11:08               11060
function.cubrid-lob2-seek64.php                    28-Sep-2020 11:08               12599
function.cubrid-lob2-size.php                      28-Sep-2020 11:08                4152
function.cubrid-lob2-size64.php                    28-Sep-2020 11:08                4328
function.cubrid-lob2-tell.php                      28-Sep-2020 11:08                4172
function.cubrid-lob2-tell64.php                    28-Sep-2020 11:08                4366
function.cubrid-lob2-write.php                     28-Sep-2020 11:08               14241
function.cubrid-lock-read.php                      28-Sep-2020 11:08                9112
function.cubrid-lock-write.php                     28-Sep-2020 11:08                9529
function.cubrid-move-cursor.php                    28-Sep-2020 11:08                9020
function.cubrid-new-glo.php                        28-Sep-2020 11:08                6898
function.cubrid-next-result.php                    28-Sep-2020 11:08               17139
function.cubrid-num-cols.php                       28-Sep-2020 11:08                5804
function.cubrid-num-fields.php                     28-Sep-2020 11:08                5513
function.cubrid-num-rows.php                       28-Sep-2020 11:08                6994
function.cubrid-pconnect-with-url.php              28-Sep-2020 11:08               14783
function.cubrid-pconnect.php                       28-Sep-2020 11:08               11800
function.cubrid-ping.php                           28-Sep-2020 11:08                6131
function.cubrid-prepare.php                        28-Sep-2020 11:08               10263
function.cubrid-put.php                            28-Sep-2020 11:08               11272
function.cubrid-query.php                          28-Sep-2020 11:08               15252
function.cubrid-real-escape-string.php             28-Sep-2020 11:08                7999
function.cubrid-result.php                         28-Sep-2020 11:08                7233
function.cubrid-rollback.php                       28-Sep-2020 11:08               15434
function.cubrid-save-to-glo.php                    28-Sep-2020 11:08                6652
function.cubrid-schema.php                         28-Sep-2020 11:08               19972
function.cubrid-send-glo.php                       28-Sep-2020 11:08                6082
function.cubrid-seq-drop.php                       28-Sep-2020 11:08                9531
function.cubrid-seq-insert.php                     28-Sep-2020 11:08                9963
function.cubrid-seq-put.php                        28-Sep-2020 11:08                9893
function.cubrid-set-add.php                        28-Sep-2020 11:08                9286
function.cubrid-set-autocommit.php                 28-Sep-2020 11:08                3890
function.cubrid-set-db-parameter.php               28-Sep-2020 11:08                7875
function.cubrid-set-drop.php                       28-Sep-2020 11:08                9262
function.cubrid-set-query-timeout.php              28-Sep-2020 11:08                3229
function.cubrid-unbuffered-query.php               28-Sep-2020 11:08                6995
function.cubrid-version.php                        28-Sep-2020 11:08                8853
function.curl-close.php                            28-Sep-2020 11:09                5210
function.curl-copy-handle.php                      28-Sep-2020 11:09                5033
function.curl-errno.php                            28-Sep-2020 11:09                5371
function.curl-error.php                            28-Sep-2020 11:09                5320
function.curl-escape.php                           28-Sep-2020 11:09                6639
function.curl-exec.php                             28-Sep-2020 11:09                6577
function.curl-file-create.php                      28-Sep-2020 11:09                1544
function.curl-getinfo.php                          28-Sep-2020 11:09               31284
function.curl-init.php                             28-Sep-2020 11:09                6174
function.curl-multi-add-handle.php                 28-Sep-2020 11:09                9260
function.curl-multi-close.php                      28-Sep-2020 11:09                8876
function.curl-multi-errno.php                      28-Sep-2020 11:09                2803
function.curl-multi-exec.php                       28-Sep-2020 11:09                9806
function.curl-multi-getcontent.php                 28-Sep-2020 11:09                3059
function.curl-multi-info-read.php                  28-Sep-2020 11:09               11770
function.curl-multi-init.php                       28-Sep-2020 11:09                8304
function.curl-multi-remove-handle.php              28-Sep-2020 11:09                4107
function.curl-multi-select.php                     28-Sep-2020 11:09                3404
function.curl-multi-setopt.php                     28-Sep-2020 11:09               10418
function.curl-multi-strerror.php                   28-Sep-2020 11:09                7132
function.curl-pause.php                            28-Sep-2020 11:09                2754
function.curl-reset.php                            28-Sep-2020 11:09                5706
function.curl-setopt-array.php                     28-Sep-2020 11:09                9256
function.curl-setopt.php                           28-Sep-2020 11:09              134851
function.curl-share-close.php                      28-Sep-2020 11:09                7178
function.curl-share-errno.php                      28-Sep-2020 11:09                2830
function.curl-share-init.php                       28-Sep-2020 11:09                7043
function.curl-share-setopt.php                     28-Sep-2020 11:09                9429
function.curl-share-strerror.php                   28-Sep-2020 11:09                3028
function.curl-strerror.php                         28-Sep-2020 11:09                6082
function.curl-unescape.php                         28-Sep-2020 11:09                7035
function.curl-version.php                          28-Sep-2020 11:09                6595
function.current.php                               28-Sep-2020 11:09               10134
function.date-add.php                              28-Sep-2020 11:09                1600
function.date-create-from-format.php               28-Sep-2020 11:09                1760
function.date-create-immutable-from-format.php     28-Sep-2020 11:09                1862
function.date-create-immutable.php                 28-Sep-2020 11:09                1766
function.date-create.php                           28-Sep-2020 11:09                1650
function.date-date-set.php                         28-Sep-2020 11:09                1654
function.date-default-timezone-get.php             28-Sep-2020 11:09                7603
function.date-default-timezone-set.php             28-Sep-2020 11:09                6801
function.date-diff.php                             28-Sep-2020 11:09                1618
function.date-format.php                           28-Sep-2020 11:09                1624
function.date-get-last-errors.php                  28-Sep-2020 11:09                1744
function.date-interval-create-from-date-string.php 28-Sep-2020 11:09                1874
function.date-interval-format.php                  28-Sep-2020 11:09                1742
function.date-isodate-set.php                      28-Sep-2020 11:09                1674
function.date-modify.php                           28-Sep-2020 11:09                1628
function.date-offset-get.php                       28-Sep-2020 11:09                1668
function.date-parse-from-format.php                28-Sep-2020 11:09                5752
function.date-parse.php                            28-Sep-2020 11:09                6879
function.date-sub.php                              28-Sep-2020 11:09                1582
function.date-sun-info.php                         28-Sep-2020 11:09               11280
function.date-sunrise.php                          28-Sep-2020 11:09               11769
function.date-sunset.php                           28-Sep-2020 11:09               11755
function.date-time-set.php                         28-Sep-2020 11:09                1640
function.date-timestamp-get.php                    28-Sep-2020 11:09                1694
function.date-timestamp-set.php                    28-Sep-2020 11:09                1702
function.date-timezone-get.php                     28-Sep-2020 11:09                1692
function.date-timezone-set.php                     28-Sep-2020 11:09                1664
function.date.php                                  28-Sep-2020 11:09               37802
function.db2-autocommit.php                        28-Sep-2020 11:08               10852
function.db2-bind-param.php                        28-Sep-2020 11:08               22459
function.db2-client-info.php                       28-Sep-2020 11:08               12082
function.db2-close.php                             28-Sep-2020 11:08                5454
function.db2-column-privileges.php                 28-Sep-2020 11:08                7572
function.db2-columns.php                           28-Sep-2020 11:08                9478
function.db2-commit.php                            28-Sep-2020 11:08                3430
function.db2-conn-error.php                        28-Sep-2020 11:08                6550
function.db2-conn-errormsg.php                     28-Sep-2020 11:08                6319
function.db2-connect.php                           28-Sep-2020 11:08               40440
function.db2-cursor-type.php                       28-Sep-2020 11:08                2974
function.db2-escape-string.php                     28-Sep-2020 11:08                7903
function.db2-exec.php                              28-Sep-2020 11:08               28754
function.db2-execute.php                           28-Sep-2020 11:08               27671
function.db2-fetch-array.php                       28-Sep-2020 11:08               11350
function.db2-fetch-assoc.php                       28-Sep-2020 11:08               11366
function.db2-fetch-both.php                        28-Sep-2020 11:08               11900
function.db2-fetch-object.php                      28-Sep-2020 11:08                8960
function.db2-fetch-row.php                         28-Sep-2020 11:08               16611
function.db2-field-display-size.php                28-Sep-2020 11:08                4705
function.db2-field-name.php                        28-Sep-2020 11:08                4599
function.db2-field-num.php                         28-Sep-2020 11:08                4610
function.db2-field-precision.php                   28-Sep-2020 11:08                4636
function.db2-field-scale.php                       28-Sep-2020 11:08                4602
function.db2-field-type.php                        28-Sep-2020 11:08                4604
function.db2-field-width.php                       28-Sep-2020 11:08                4810
function.db2-foreign-keys.php                      28-Sep-2020 11:08                8357
function.db2-free-result.php                       28-Sep-2020 11:08                3068
function.db2-free-stmt.php                         28-Sep-2020 11:08                3058
function.db2-get-option.php                        28-Sep-2020 11:08               24809
function.db2-last-insert-id.php                    28-Sep-2020 11:08                8487
function.db2-lob-read.php                          28-Sep-2020 11:08               17688
function.db2-next-result.php                       28-Sep-2020 11:08                8910
function.db2-num-fields.php                        28-Sep-2020 11:08                7005
function.db2-num-rows.php                          28-Sep-2020 11:08                4232
function.db2-pclose.php                            28-Sep-2020 11:08                5638
function.db2-pconnect.php                          28-Sep-2020 11:08               32341
function.db2-prepare.php                           28-Sep-2020 11:08               10476
function.db2-primary-keys.php                      28-Sep-2020 11:08                6991
function.db2-procedure-columns.php                 28-Sep-2020 11:08               11018
function.db2-procedures.php                        28-Sep-2020 11:08                7431
function.db2-result.php                            28-Sep-2020 11:08                7793
function.db2-rollback.php                          28-Sep-2020 11:08                9753
function.db2-server-info.php                       28-Sep-2020 11:08               24213
function.db2-set-option.php                        28-Sep-2020 11:08               70699
function.db2-special-columns.php                   28-Sep-2020 11:08                9550
function.db2-statistics.php                        28-Sep-2020 11:08               11692
function.db2-stmt-error.php                        28-Sep-2020 11:08                4198
function.db2-stmt-errormsg.php                     28-Sep-2020 11:08                3826
function.db2-table-privileges.php                  28-Sep-2020 11:08                7411
function.db2-tables.php                            28-Sep-2020 11:08                7391
function.dba-close.php                             28-Sep-2020 11:08                3126
function.dba-delete.php                            28-Sep-2020 11:08                3879
function.dba-exists.php                            28-Sep-2020 11:08                3950
function.dba-fetch.php                             28-Sep-2020 11:08                5528
function.dba-firstkey.php                          28-Sep-2020 11:08                3446
function.dba-handlers.php                          28-Sep-2020 11:08                5407
function.dba-insert.php                            28-Sep-2020 11:08                4540
function.dba-key-split.php                         28-Sep-2020 11:08                3586
function.dba-list.php                              28-Sep-2020 11:08                1937
function.dba-nextkey.php                           28-Sep-2020 11:08                3359
function.dba-open.php                              28-Sep-2020 11:08               12013
function.dba-optimize.php                          28-Sep-2020 11:08                2967
function.dba-popen.php                             28-Sep-2020 11:08                4605
function.dba-replace.php                           28-Sep-2020 11:08                4351
function.dba-sync.php                              28-Sep-2020 11:08                3035
function.dbase-add-record.php                      28-Sep-2020 11:08                6968
function.dbase-close.php                           28-Sep-2020 11:08                5187
function.dbase-create.php                          28-Sep-2020 11:08                8593
function.dbase-delete-record.php                   28-Sep-2020 11:08                4801
function.dbase-get-header-info.php                 28-Sep-2020 11:08                7126
function.dbase-get-record-with-names.php           28-Sep-2020 11:08                8987
function.dbase-get-record.php                      28-Sep-2020 11:08                5557
function.dbase-numfields.php                       28-Sep-2020 11:08                5931
function.dbase-numrecords.php                      28-Sep-2020 11:08                7283
function.dbase-open.php                            28-Sep-2020 11:08                6655
function.dbase-pack.php                            28-Sep-2020 11:08                6398
function.dbase-replace-record.php                  28-Sep-2020 11:08                9804
function.dbplus-add.php                            28-Sep-2020 11:08                3727
function.dbplus-aql.php                            28-Sep-2020 11:08                3737
function.dbplus-chdir.php                          28-Sep-2020 11:08                3002
function.dbplus-close.php                          28-Sep-2020 11:08                3093
function.dbplus-curr.php                           28-Sep-2020 11:08                4421
function.dbplus-errcode.php                        28-Sep-2020 11:08                2853
function.dbplus-errno.php                          28-Sep-2020 11:08                2759
function.dbplus-find.php                           28-Sep-2020 11:08                4795
function.dbplus-first.php                          28-Sep-2020 11:08                4419
function.dbplus-flush.php                          28-Sep-2020 11:08                3382
function.dbplus-freealllocks.php                   28-Sep-2020 11:08                3137
function.dbplus-freelock.php                       28-Sep-2020 11:08                4018
function.dbplus-freerlocks.php                     28-Sep-2020 11:08                3669
function.dbplus-getlock.php                        28-Sep-2020 11:08                4005
function.dbplus-getunique.php                      28-Sep-2020 11:08                3339
function.dbplus-info.php                           28-Sep-2020 11:08                3218
function.dbplus-last.php                           28-Sep-2020 11:08                4207
function.dbplus-lockrel.php                        28-Sep-2020 11:08                2975
function.dbplus-next.php                           28-Sep-2020 11:08                4212
function.dbplus-open.php                           28-Sep-2020 11:08                3155
function.dbplus-prev.php                           28-Sep-2020 11:08                4216
function.dbplus-rchperm.php                        28-Sep-2020 11:08                3678
function.dbplus-rcreate.php                        28-Sep-2020 11:08                4280
function.dbplus-rcrtexact.php                      28-Sep-2020 11:08                3942
function.dbplus-rcrtlike.php                       28-Sep-2020 11:08                3987
function.dbplus-resolve.php                        28-Sep-2020 11:08                3532
function.dbplus-restorepos.php                     28-Sep-2020 11:08                3183
function.dbplus-rkeys.php                          28-Sep-2020 11:08                3626
function.dbplus-ropen.php                          28-Sep-2020 11:08                3096
function.dbplus-rquery.php                         28-Sep-2020 11:08                3256
function.dbplus-rrename.php                        28-Sep-2020 11:08                3178
function.dbplus-rsecindex.php                      28-Sep-2020 11:08                3942
function.dbplus-runlink.php                        28-Sep-2020 11:08                2924
function.dbplus-rzap.php                           28-Sep-2020 11:08                2895
function.dbplus-savepos.php                        28-Sep-2020 11:08                2922
function.dbplus-setindex.php                       28-Sep-2020 11:08                3185
function.dbplus-setindexbynumber.php               28-Sep-2020 11:08                3252
function.dbplus-sql.php                            28-Sep-2020 11:08                3234
function.dbplus-tcl.php                            28-Sep-2020 11:08                3975
function.dbplus-tremove.php                        28-Sep-2020 11:08                3659
function.dbplus-undo.php                           28-Sep-2020 11:08                2895
function.dbplus-undoprepare.php                    28-Sep-2020 11:08                2963
function.dbplus-unlockrel.php                      28-Sep-2020 11:08                2975
function.dbplus-unselect.php                       28-Sep-2020 11:08                3072
function.dbplus-update.php                         28-Sep-2020 11:08                3592
function.dbplus-xlockrel.php                       28-Sep-2020 11:08                3309
function.dbplus-xunlockrel.php                     28-Sep-2020 11:08                2964
function.dbx-close.php                             28-Sep-2020 11:08                4407
function.dbx-compare.php                           28-Sep-2020 11:08                9639
function.dbx-connect.php                           28-Sep-2020 11:08               10683
function.dbx-error.php                             28-Sep-2020 11:08                5719
function.dbx-escape-string.php                     28-Sep-2020 11:08                6227
function.dbx-fetch-row.php                         28-Sep-2020 11:08                6511
function.dbx-query.php                             28-Sep-2020 11:08               23414
function.dbx-sort.php                              28-Sep-2020 11:08                8265
function.dcgettext.php                             28-Sep-2020 11:09                3242
function.dcngettext.php                            28-Sep-2020 11:09                3610
function.debug-backtrace.php                       28-Sep-2020 11:08               11466
function.debug-print-backtrace.php                 28-Sep-2020 11:08                7653
function.debug-zval-dump.php                       28-Sep-2020 11:09                9754
function.decbin.php                                28-Sep-2020 11:09                8768
function.dechex.php                                28-Sep-2020 11:09                7270
function.decoct.php                                28-Sep-2020 11:09                4766
function.define-syslog-variables.php               28-Sep-2020 11:09               12341
function.define.php                                28-Sep-2020 11:09               11503
function.defined.php                               28-Sep-2020 11:09                5275
function.deflate-add.php                           28-Sep-2020 11:08                4173
function.deflate-init.php                          28-Sep-2020 11:08                5954
function.deg2rad.php                               28-Sep-2020 11:09                3858
function.delete.php                                28-Sep-2020 11:09                2325
function.dgettext.php                              28-Sep-2020 11:09                3018
function.die.php                                   28-Sep-2020 11:09                1434
function.dio-close.php                             28-Sep-2020 11:09                3896
function.dio-fcntl.php                             28-Sep-2020 11:09                9183
function.dio-open.php                              28-Sep-2020 11:09                7599
function.dio-read.php                              28-Sep-2020 11:09                3200
function.dio-seek.php                              28-Sep-2020 11:09                7175
function.dio-stat.php                              28-Sep-2020 11:09                3695
function.dio-tcsetattr.php                         28-Sep-2020 11:09                6879
function.dio-truncate.php                          28-Sep-2020 11:09                3355
function.dio-write.php                             28-Sep-2020 11:09                3560
function.dir.php                                   28-Sep-2020 11:09                6449
function.dirname.php                               28-Sep-2020 11:09                7738
function.disk-free-space.php                       28-Sep-2020 11:09                5386
function.disk-total-space.php                      28-Sep-2020 11:09                5054
function.diskfreespace.php                         28-Sep-2020 11:09                1622
function.dl.php                                    28-Sep-2020 11:08               11775
function.dngettext.php                             28-Sep-2020 11:09                3445
function.dns-check-record.php                      28-Sep-2020 11:09                1635
function.dns-get-mx.php                            28-Sep-2020 11:09                1581
function.dns-get-record.php                        28-Sep-2020 11:09               22912
function.dom-import-simplexml.php                  28-Sep-2020 11:09                6603
function.doubleval.php                             28-Sep-2020 11:09                1580
function.each.php                                  28-Sep-2020 11:09               11533
function.easter-date.php                           28-Sep-2020 11:09               11095
function.easter-days.php                           28-Sep-2020 11:09                6508
function.echo.php                                  28-Sep-2020 11:09               11859
function.eio-busy.php                              28-Sep-2020 11:09                4198
function.eio-cancel.php                            28-Sep-2020 11:09                7226
function.eio-chmod.php                             28-Sep-2020 11:09                5391
function.eio-chown.php                             28-Sep-2020 11:09                5517
function.eio-close.php                             28-Sep-2020 11:09                4981
function.eio-custom.php                            28-Sep-2020 11:09               10067
function.eio-dup2.php                              28-Sep-2020 11:09                5023
function.eio-event-loop.php                        28-Sep-2020 11:09                5773
function.eio-fallocate.php                         28-Sep-2020 11:09                6435
function.eio-fchmod.php                            28-Sep-2020 11:09                5430
function.eio-fchown.php                            28-Sep-2020 11:09                5312
function.eio-fdatasync.php                         28-Sep-2020 11:09                4878
function.eio-fstat.php                             28-Sep-2020 11:09               11292
function.eio-fstatvfs.php                          28-Sep-2020 11:09                4979
function.eio-fsync.php                             28-Sep-2020 11:09                4997
function.eio-ftruncate.php                         28-Sep-2020 11:09                5447
function.eio-futime.php                            28-Sep-2020 11:09                5678
function.eio-get-event-stream.php                  28-Sep-2020 11:09                8437
function.eio-get-last-error.php                    28-Sep-2020 11:09                2942
function.eio-grp-add.php                           28-Sep-2020 11:09               12100
function.eio-grp-cancel.php                        28-Sep-2020 11:09                2961
function.eio-grp-limit.php                         28-Sep-2020 11:09                2811
function.eio-grp.php                               28-Sep-2020 11:09               12060
function.eio-init.php                              28-Sep-2020 11:09                3096
function.eio-link.php                              28-Sep-2020 11:09               12303
function.eio-lstat.php                             28-Sep-2020 11:09                9388
function.eio-mkdir.php                             28-Sep-2020 11:09                8685
function.eio-mknod.php                             28-Sep-2020 11:09               10577
function.eio-nop.php                               28-Sep-2020 11:09                4739
function.eio-npending.php                          28-Sep-2020 11:09                2910
function.eio-nready.php                            28-Sep-2020 11:09                2660
function.eio-nreqs.php                             28-Sep-2020 11:09                5544
function.eio-nthreads.php                          28-Sep-2020 11:09                3377
function.eio-open.php                              28-Sep-2020 11:09               11255
function.eio-poll.php                              28-Sep-2020 11:09                5707
function.eio-read.php                              28-Sep-2020 11:09               12551
function.eio-readahead.php                         28-Sep-2020 11:09                5393
function.eio-readdir.php                           28-Sep-2020 11:09               16718
function.eio-readlink.php                          28-Sep-2020 11:09               11917
function.eio-realpath.php                          28-Sep-2020 11:09                4943
function.eio-rename.php                            28-Sep-2020 11:09                8794
function.eio-rmdir.php                             28-Sep-2020 11:09                7748
function.eio-seek.php                              28-Sep-2020 11:09                6091
function.eio-sendfile.php                          28-Sep-2020 11:09                5529
function.eio-set-max-idle.php                      28-Sep-2020 11:09                2983
function.eio-set-max-parallel.php                  28-Sep-2020 11:09                3028
function.eio-set-max-poll-reqs.php                 28-Sep-2020 11:09                2302
function.eio-set-max-poll-time.php                 28-Sep-2020 11:09                2372
function.eio-set-min-parallel.php                  28-Sep-2020 11:09                3017
function.eio-stat.php                              28-Sep-2020 11:09                9361
function.eio-statvfs.php                           28-Sep-2020 11:09                7668
function.eio-symlink.php                           28-Sep-2020 11:09               10412
function.eio-sync-file-range.php                   28-Sep-2020 11:09                6220
function.eio-sync.php                              28-Sep-2020 11:09                2629
function.eio-syncfs.php                            28-Sep-2020 11:09                4564
function.eio-truncate.php                          28-Sep-2020 11:09                5343
function.eio-unlink.php                            28-Sep-2020 11:09                4588
function.eio-utime.php                             28-Sep-2020 11:09                5305
function.eio-write.php                             28-Sep-2020 11:09                6030
function.empty.php                                 28-Sep-2020 11:09               11720
function.enchant-broker-describe.php               28-Sep-2020 11:09                4932
function.enchant-broker-dict-exists.php            28-Sep-2020 11:09                4647
function.enchant-broker-free-dict.php              28-Sep-2020 11:09                3131
function.enchant-broker-free.php                   28-Sep-2020 11:09                2903
function.enchant-broker-get-dict-path.php          28-Sep-2020 11:09                3360
function.enchant-broker-get-error.php              28-Sep-2020 11:09                2483
function.enchant-broker-init.php                   28-Sep-2020 11:09                2522
function.enchant-broker-list-dicts.php             28-Sep-2020 11:09                5868
function.enchant-broker-request-dict.php           28-Sep-2020 11:09                5577
function.enchant-broker-request-pwl-dict.php       28-Sep-2020 11:09                3810
function.enchant-broker-set-dict-path.php          28-Sep-2020 11:09                3665
function.enchant-broker-set-ordering.php           28-Sep-2020 11:09                3581
function.enchant-dict-add-to-personal.php          28-Sep-2020 11:09                5342
function.enchant-dict-add-to-session.php           28-Sep-2020 11:09                3213
function.enchant-dict-check.php                    28-Sep-2020 11:09                2805
function.enchant-dict-describe.php                 28-Sep-2020 11:09                5202
function.enchant-dict-get-error.php                28-Sep-2020 11:09                2497
function.enchant-dict-is-in-session.php            28-Sep-2020 11:09                3224
function.enchant-dict-quick-check.php              28-Sep-2020 11:09                6788
function.enchant-dict-store-replacement.php        28-Sep-2020 11:09                3295
function.enchant-dict-suggest.php                  28-Sep-2020 11:09                6528
function.end.php                                   28-Sep-2020 11:09                5149
function.ereg-replace.php                          28-Sep-2020 11:09               11770
function.ereg.php                                  28-Sep-2020 11:09                9506
function.eregi-replace.php                         28-Sep-2020 11:09                7290
function.eregi.php                                 28-Sep-2020 11:09                7817
function.error-clear-last.php                      28-Sep-2020 11:08                4316
function.error-get-last.php                        28-Sep-2020 11:08                4517
function.error-log.php                             28-Sep-2020 11:08               10229
function.error-reporting.php                       28-Sep-2020 11:08                9549
function.escapeshellarg.php                        28-Sep-2020 11:09                5809
function.escapeshellcmd.php                        28-Sep-2020 11:09                7365
function.eval.php                                  28-Sep-2020 11:09                8751
function.exec.php                                  28-Sep-2020 11:09                8845
function.exif-imagetype.php                        28-Sep-2020 11:09                8710
function.exif-read-data.php                        28-Sep-2020 11:09               21976
function.exif-tagname.php                          28-Sep-2020 11:09                4448
function.exif-thumbnail.php                        28-Sep-2020 11:09                8336
function.exit.php                                  28-Sep-2020 11:09                9468
function.exp.php                                   28-Sep-2020 11:09                4061
function.expect-expectl.php                        28-Sep-2020 11:09               11349
function.expect-popen.php                          28-Sep-2020 11:09                4446
function.explode.php                               28-Sep-2020 11:09               15171
function.expm1.php                                 28-Sep-2020 11:09                3737
function.extension-loaded.php                      28-Sep-2020 11:08                5400
function.extract.php                               28-Sep-2020 11:09               18135
function.ezmlm-hash.php                            28-Sep-2020 11:09                4464
function.fann-cascadetrain-on-data.php             28-Sep-2020 11:09                6020
function.fann-cascadetrain-on-file.php             28-Sep-2020 11:09                5010
function.fann-clear-scaling-params.php             28-Sep-2020 11:09                2455
function.fann-copy.php                             28-Sep-2020 11:09                2745
function.fann-create-from-file.php                 28-Sep-2020 11:09                3081
function.fann-create-shortcut-array.php            28-Sep-2020 11:09                3855
function.fann-create-shortcut.php                  28-Sep-2020 11:09                4649
function.fann-create-sparse-array.php              28-Sep-2020 11:09                4446
function.fann-create-sparse.php                    28-Sep-2020 11:09                4951
function.fann-create-standard-array.php            28-Sep-2020 11:09                4168
function.fann-create-standard.php                  28-Sep-2020 11:09                4717
function.fann-create-train-from-callback.php       28-Sep-2020 11:09                8710
function.fann-create-train.php                     28-Sep-2020 11:09                4018
function.fann-descale-input.php                    28-Sep-2020 11:09                3500
function.fann-descale-output.php                   28-Sep-2020 11:09                3515
function.fann-descale-train.php                    28-Sep-2020 11:09                3539
function.fann-destroy-train.php                    28-Sep-2020 11:09                2421
function.fann-destroy.php                          28-Sep-2020 11:09                2455
function.fann-duplicate-train-data.php             28-Sep-2020 11:09                2732
function.fann-get-activation-function.php          28-Sep-2020 11:09                5009
function.fann-get-activation-steepness.php         28-Sep-2020 11:09                5420
function.fann-get-bias-array.php                   28-Sep-2020 11:09                2437
function.fann-get-bit-fail-limit.php               28-Sep-2020 11:09                3554
function.fann-get-bit-fail.php                     28-Sep-2020 11:09                4783
function.fann-get-cascade-activation-functions-..> 28-Sep-2020 11:09                3646
function.fann-get-cascade-activation-functions.php 28-Sep-2020 11:09                4108
function.fann-get-cascade-activation-steepnesse..> 28-Sep-2020 11:09                3700
function.fann-get-cascade-activation-steepnesse..> 28-Sep-2020 11:09                3857
function.fann-get-cascade-candidate-change-frac..> 28-Sep-2020 11:09                4975
function.fann-get-cascade-candidate-limit.php      28-Sep-2020 11:09                3345
function.fann-get-cascade-candidate-stagnation-..> 28-Sep-2020 11:09                4084
function.fann-get-cascade-max-cand-epochs.php      28-Sep-2020 11:09                3227
function.fann-get-cascade-max-out-epochs.php       28-Sep-2020 11:09                3149
function.fann-get-cascade-min-cand-epochs.php      28-Sep-2020 11:09                3200
function.fann-get-cascade-min-out-epochs.php       28-Sep-2020 11:09                3159
function.fann-get-cascade-num-candidate-groups.php 28-Sep-2020 11:09                3620
function.fann-get-cascade-num-candidates.php       28-Sep-2020 11:09                5820
function.fann-get-cascade-output-change-fractio..> 28-Sep-2020 11:09                4906
function.fann-get-cascade-output-stagnation-epo..> 28-Sep-2020 11:09                4030
function.fann-get-cascade-weight-multiplier.php    28-Sep-2020 11:09                3301
function.fann-get-connection-array.php             28-Sep-2020 11:09                2458
function.fann-get-connection-rate.php              28-Sep-2020 11:09                2530
function.fann-get-errno.php                        28-Sep-2020 11:09                3043
function.fann-get-errstr.php                       28-Sep-2020 11:09                3045
function.fann-get-layer-array.php                  28-Sep-2020 11:09                2537
function.fann-get-learning-momentum.php            28-Sep-2020 11:09                3539
function.fann-get-learning-rate.php                28-Sep-2020 11:09                3401
function.fann-get-mse.php                          28-Sep-2020 11:09                3028
function.fann-get-network-type.php                 28-Sep-2020 11:09                2503
function.fann-get-num-input.php                    28-Sep-2020 11:09                2393
function.fann-get-num-layers.php                   28-Sep-2020 11:09                2447
function.fann-get-num-output.php                   28-Sep-2020 11:09                2411
function.fann-get-quickprop-decay.php              28-Sep-2020 11:09                3168
function.fann-get-quickprop-mu.php                 28-Sep-2020 11:09                3064
function.fann-get-rprop-decrease-factor.php        28-Sep-2020 11:09                3116
function.fann-get-rprop-delta-max.php              28-Sep-2020 11:09                3199
function.fann-get-rprop-delta-min.php              28-Sep-2020 11:09                2995
function.fann-get-rprop-delta-zero.php             28-Sep-2020 11:09                3397
function.fann-get-rprop-increase-factor.php        28-Sep-2020 11:09                3141
function.fann-get-sarprop-step-error-shift.php     28-Sep-2020 11:09                3115
function.fann-get-sarprop-step-error-threshold-..> 28-Sep-2020 11:09                3245
function.fann-get-sarprop-temperature.php          28-Sep-2020 11:09                3039
function.fann-get-sarprop-weight-decay-shift.php   28-Sep-2020 11:09                3092
function.fann-get-total-connections.php            28-Sep-2020 11:09                2577
function.fann-get-total-neurons.php                28-Sep-2020 11:09                2628
function.fann-get-train-error-function.php         28-Sep-2020 11:09                3333
function.fann-get-train-stop-function.php          28-Sep-2020 11:09                3322
function.fann-get-training-algorithm.php           28-Sep-2020 11:09                3495
function.fann-init-weights.php                     28-Sep-2020 11:09                4191
function.fann-length-train-data.php                28-Sep-2020 11:09                2710
function.fann-merge-train-data.php                 28-Sep-2020 11:09                3038
function.fann-num-input-train-data.php             28-Sep-2020 11:09                3372
function.fann-num-output-train-data.php            28-Sep-2020 11:09                3369
function.fann-print-error.php                      28-Sep-2020 11:09                2874
function.fann-randomize-weights.php                28-Sep-2020 11:09                3621
function.fann-read-train-from-file.php             28-Sep-2020 11:09                4907
function.fann-reset-errno.php                      28-Sep-2020 11:09                3065
function.fann-reset-errstr.php                     28-Sep-2020 11:09                3045
function.fann-reset-mse.php                        28-Sep-2020 11:09                3250
function.fann-run.php                              28-Sep-2020 11:09                2662
function.fann-save-train.php                       28-Sep-2020 11:09                3232
function.fann-save.php                             28-Sep-2020 11:09                4045
function.fann-scale-input-train-data.php           28-Sep-2020 11:09                3814
function.fann-scale-input.php                      28-Sep-2020 11:09                3516
function.fann-scale-output-train-data.php          28-Sep-2020 11:09                3841
function.fann-scale-output.php                     28-Sep-2020 11:09                3519
function.fann-scale-train-data.php                 28-Sep-2020 11:09                3818
function.fann-scale-train.php                      28-Sep-2020 11:09                3559
function.fann-set-activation-function-hidden.php   28-Sep-2020 11:09                4222
function.fann-set-activation-function-layer.php    28-Sep-2020 11:09                4687
function.fann-set-activation-function-output.php   28-Sep-2020 11:09                4238
function.fann-set-activation-function.php          28-Sep-2020 11:09                5848
function.fann-set-activation-steepness-hidden.php  28-Sep-2020 11:09                4522
function.fann-set-activation-steepness-layer.php   28-Sep-2020 11:09                4938
function.fann-set-activation-steepness-output.php  28-Sep-2020 11:09                4503
function.fann-set-activation-steepness.php         28-Sep-2020 11:09                5676
function.fann-set-bit-fail-limit.php               28-Sep-2020 11:09                3178
function.fann-set-callback.php                     28-Sep-2020 11:09                5366
function.fann-set-cascade-activation-functions.php 28-Sep-2020 11:09                3835
function.fann-set-cascade-activation-steepnesse..> 28-Sep-2020 11:09                4046
function.fann-set-cascade-candidate-change-frac..> 28-Sep-2020 11:09                3510
function.fann-set-cascade-candidate-limit.php      28-Sep-2020 11:09                3327
function.fann-set-cascade-candidate-stagnation-..> 28-Sep-2020 11:09                3570
function.fann-set-cascade-max-cand-epochs.php      28-Sep-2020 11:09                3328
function.fann-set-cascade-max-out-epochs.php       28-Sep-2020 11:09                3280
function.fann-set-cascade-min-cand-epochs.php      28-Sep-2020 11:09                3306
function.fann-set-cascade-min-out-epochs.php       28-Sep-2020 11:09                3290
function.fann-set-cascade-num-candidate-groups.php 28-Sep-2020 11:09                3408
function.fann-set-cascade-output-change-fractio..> 28-Sep-2020 11:09                3470
function.fann-set-cascade-output-stagnation-epo..> 28-Sep-2020 11:09                3534
function.fann-set-cascade-weight-multiplier.php    28-Sep-2020 11:09                3310
function.fann-set-error-log.php                    28-Sep-2020 11:09                2828
function.fann-set-input-scaling-params.php         28-Sep-2020 11:09                4078
function.fann-set-learning-momentum.php            28-Sep-2020 11:09                3574
function.fann-set-learning-rate.php                28-Sep-2020 11:09                3504
function.fann-set-output-scaling-params.php        28-Sep-2020 11:09                4097
function.fann-set-quickprop-decay.php              28-Sep-2020 11:09                3248
function.fann-set-quickprop-mu.php                 28-Sep-2020 11:09                3106
function.fann-set-rprop-decrease-factor.php        28-Sep-2020 11:09                3299
function.fann-set-rprop-delta-max.php              28-Sep-2020 11:09                3432
function.fann-set-rprop-delta-min.php              28-Sep-2020 11:09                3223
function.fann-set-rprop-delta-zero.php             28-Sep-2020 11:09                3634
function.fann-set-rprop-increase-factor.php        28-Sep-2020 11:09                3325
function.fann-set-sarprop-step-error-shift.php     28-Sep-2020 11:09                3354
function.fann-set-sarprop-step-error-threshold-..> 28-Sep-2020 11:09                3526
function.fann-set-sarprop-temperature.php          28-Sep-2020 11:09                3275
function.fann-set-sarprop-weight-decay-shift.php   28-Sep-2020 11:09                3344
function.fann-set-scaling-params.php               28-Sep-2020 11:09                4982
function.fann-set-train-error-function.php         28-Sep-2020 11:09                3512
function.fann-set-train-stop-function.php          28-Sep-2020 11:09                3501
function.fann-set-training-algorithm.php           28-Sep-2020 11:09                3450
function.fann-set-weight-array.php                 28-Sep-2020 11:09                2920
function.fann-set-weight.php                       28-Sep-2020 11:09                3192
function.fann-shuffle-train-data.php               28-Sep-2020 11:09                2616
function.fann-subset-train-data.php                28-Sep-2020 11:09                4015
function.fann-test-data.php                        28-Sep-2020 11:09                4051
function.fann-test.php                             28-Sep-2020 11:09                4274
function.fann-train-epoch.php                      28-Sep-2020 11:09                4408
function.fann-train-on-data.php                    28-Sep-2020 11:09                6049
function.fann-train-on-file.php                    28-Sep-2020 11:09                5965
function.fann-train.php                            28-Sep-2020 11:09                4297
function.fastcgi-finish-request.php                28-Sep-2020 11:09                2134
function.fbird-add-user.php                        28-Sep-2020 11:08                2226
function.fbird-affected-rows.php                   28-Sep-2020 11:08                2235
function.fbird-backup.php                          28-Sep-2020 11:08                1639
function.fbird-blob-add.php                        28-Sep-2020 11:08                2584
function.fbird-blob-cancel.php                     28-Sep-2020 11:08                3410
function.fbird-blob-close.php                      28-Sep-2020 11:08                2613
function.fbird-blob-create.php                     28-Sep-2020 11:08                2612
function.fbird-blob-echo.php                       28-Sep-2020 11:08                2402
function.fbird-blob-get.php                        28-Sep-2020 11:08                2396
function.fbird-blob-import.php                     28-Sep-2020 11:08                2608
function.fbird-blob-info.php                       28-Sep-2020 11:08                1668
function.fbird-blob-open.php                       28-Sep-2020 11:08                2392
function.fbird-close.php                           28-Sep-2020 11:08                2166
function.fbird-commit-ret.php                      28-Sep-2020 11:08                1660
function.fbird-commit.php                          28-Sep-2020 11:08                1632
function.fbird-connect.php                         28-Sep-2020 11:08                2170
function.fbird-db-info.php                         28-Sep-2020 11:08                1644
function.fbird-delete-user.php                     28-Sep-2020 11:08                2234
function.fbird-drop-db.php                         28-Sep-2020 11:08                2186
function.fbird-errcode.php                         28-Sep-2020 11:08                1993
function.fbird-errmsg.php                          28-Sep-2020 11:08                1987
function.fbird-execute.php                         28-Sep-2020 11:08                1998
function.fbird-fetch-assoc.php                     28-Sep-2020 11:08                2250
function.fbird-fetch-object.php                    28-Sep-2020 11:08                2260
function.fbird-fetch-row.php                       28-Sep-2020 11:08                2240
function.fbird-field-info.php                      28-Sep-2020 11:08                2065
function.fbird-free-event-handler.php              28-Sep-2020 11:08                2161
function.fbird-free-query.php                      28-Sep-2020 11:08                1696
function.fbird-free-result.php                     28-Sep-2020 11:08                1680
function.fbird-gen-id.php                          28-Sep-2020 11:08                1642
function.fbird-maintain-db.php                     28-Sep-2020 11:08                1682
function.fbird-modify-user.php                     28-Sep-2020 11:08                2250
function.fbird-name-result.php                     28-Sep-2020 11:08                2233
function.fbird-num-fields.php                      28-Sep-2020 11:08                2054
function.fbird-num-params.php                      28-Sep-2020 11:08                2229
function.fbird-param-info.php                      28-Sep-2020 11:08                2234
function.fbird-pconnect.php                        28-Sep-2020 11:08                2186
function.fbird-prepare.php                         28-Sep-2020 11:08                1634
function.fbird-query.php                           28-Sep-2020 11:08                2537
function.fbird-restore.php                         28-Sep-2020 11:08                1641
function.fbird-rollback-ret.php                    28-Sep-2020 11:08                1688
function.fbird-rollback.php                        28-Sep-2020 11:08                1664
function.fbird-server-info.php                     28-Sep-2020 11:08                1692
function.fbird-service-attach.php                  28-Sep-2020 11:08                1728
function.fbird-service-detach.php                  28-Sep-2020 11:08                1740
function.fbird-set-event-handler.php               28-Sep-2020 11:08                2337
function.fbird-trans.php                           28-Sep-2020 11:08                1642
function.fbird-wait-event.php                      28-Sep-2020 11:08                2269
function.fbsql-affected-rows.php                   28-Sep-2020 11:08                4646
function.fbsql-autocommit.php                      28-Sep-2020 11:08                4511
function.fbsql-blob-size.php                       28-Sep-2020 11:08                3629
function.fbsql-change-user.php                     28-Sep-2020 11:08                4080
function.fbsql-clob-size.php                       28-Sep-2020 11:08                3619
function.fbsql-close.php                           28-Sep-2020 11:08                5192
function.fbsql-commit.php                          28-Sep-2020 11:08                3727
function.fbsql-connect.php                         28-Sep-2020 11:08                5593
function.fbsql-create-blob.php                     28-Sep-2020 11:08                7397
function.fbsql-create-clob.php                     28-Sep-2020 11:08                7404
function.fbsql-create-db.php                       28-Sep-2020 11:08                5712
function.fbsql-data-seek.php                       28-Sep-2020 11:08                7708
function.fbsql-database-password.php               28-Sep-2020 11:08                6497
function.fbsql-database.php                        28-Sep-2020 11:08                3358
function.fbsql-db-query.php                        28-Sep-2020 11:08                4328
function.fbsql-db-status.php                       28-Sep-2020 11:08                5489
function.fbsql-drop-db.php                         28-Sep-2020 11:08                3716
function.fbsql-errno.php                           28-Sep-2020 11:08                6620
function.fbsql-error.php                           28-Sep-2020 11:08                6651
function.fbsql-fetch-array.php                     28-Sep-2020 11:08                8400
function.fbsql-fetch-assoc.php                     28-Sep-2020 11:08                6767
function.fbsql-fetch-field.php                     28-Sep-2020 11:08                8640
function.fbsql-fetch-lengths.php                   28-Sep-2020 11:08                3446
function.fbsql-fetch-object.php                    28-Sep-2020 11:08                6169
function.fbsql-fetch-row.php                       28-Sep-2020 11:08                4338
function.fbsql-field-flags.php                     28-Sep-2020 11:08                3008
function.fbsql-field-len.php                       28-Sep-2020 11:08                2747
function.fbsql-field-name.php                      28-Sep-2020 11:08                5348
function.fbsql-field-seek.php                      28-Sep-2020 11:08                3550
function.fbsql-field-table.php                     28-Sep-2020 11:08                2778
function.fbsql-field-type.php                      28-Sep-2020 11:08                9736
function.fbsql-free-result.php                     28-Sep-2020 11:08                2894
function.fbsql-get-autostart-info.php              28-Sep-2020 11:08                2772
function.fbsql-hostname.php                        28-Sep-2020 11:08                3874
function.fbsql-insert-id.php                       28-Sep-2020 11:08                3939
function.fbsql-list-dbs.php                        28-Sep-2020 11:08                6000
function.fbsql-list-fields.php                     28-Sep-2020 11:08                7669
function.fbsql-list-tables.php                     28-Sep-2020 11:08                3969
function.fbsql-next-result.php                     28-Sep-2020 11:08                5624
function.fbsql-num-fields.php                      28-Sep-2020 11:08                3450
function.fbsql-num-rows.php                        28-Sep-2020 11:08                5915
function.fbsql-password.php                        28-Sep-2020 11:08                3811
function.fbsql-pconnect.php                        28-Sep-2020 11:08                4721
function.fbsql-query.php                           28-Sep-2020 11:08                8825
function.fbsql-read-blob.php                       28-Sep-2020 11:08                8375
function.fbsql-read-clob.php                       28-Sep-2020 11:08                8377
function.fbsql-result.php                          28-Sep-2020 11:08                5222
function.fbsql-rollback.php                        28-Sep-2020 11:08                3641
function.fbsql-rows-fetched.php                    28-Sep-2020 11:08                2426
function.fbsql-select-db.php                       28-Sep-2020 11:08                5132
function.fbsql-set-characterset.php                28-Sep-2020 11:08                2395
function.fbsql-set-lob-mode.php                    28-Sep-2020 11:08                5342
function.fbsql-set-password.php                    28-Sep-2020 11:08                3789
function.fbsql-set-transaction.php                 28-Sep-2020 11:08                4120
function.fbsql-start-db.php                        28-Sep-2020 11:08                4115
function.fbsql-stop-db.php                         28-Sep-2020 11:08                3844
function.fbsql-table-name.php                      28-Sep-2020 11:08                5629
function.fbsql-tablename.php                       28-Sep-2020 11:08                1575
function.fbsql-username.php                        28-Sep-2020 11:08                3878
function.fbsql-warnings.php                        28-Sep-2020 11:08                3029
function.fclose.php                                28-Sep-2020 11:09                4184
function.fdf-add-doc-javascript.php                28-Sep-2020 11:09                5173
function.fdf-add-template.php                      28-Sep-2020 11:09                2310
function.fdf-close.php                             28-Sep-2020 11:09                2938
function.fdf-create.php                            28-Sep-2020 11:09                3476
function.fdf-enum-values.php                       28-Sep-2020 11:09                2249
function.fdf-errno.php                             28-Sep-2020 11:09                2511
function.fdf-error.php                             28-Sep-2020 11:09                3101
function.fdf-get-ap.php                            28-Sep-2020 11:09                3662
function.fdf-get-attachment.php                    28-Sep-2020 11:09                5843
function.fdf-get-encoding.php                      28-Sep-2020 11:09                3219
function.fdf-get-file.php                          28-Sep-2020 11:09                3062
function.fdf-get-flags.php                         28-Sep-2020 11:09                2062
function.fdf-get-opt.php                           28-Sep-2020 11:09                2188
function.fdf-get-status.php                        28-Sep-2020 11:09                3073
function.fdf-get-value.php                         28-Sep-2020 11:09                4409
function.fdf-get-version.php                       28-Sep-2020 11:09                3399
function.fdf-header.php                            28-Sep-2020 11:09                2038
function.fdf-next-field-name.php                   28-Sep-2020 11:09                4073
function.fdf-open-string.php                       28-Sep-2020 11:09                4653
function.fdf-open.php                              28-Sep-2020 11:09                4423
function.fdf-remove-item.php                       28-Sep-2020 11:09                2065
function.fdf-save-string.php                       28-Sep-2020 11:09                5436
function.fdf-save.php                              28-Sep-2020 11:09                3777
function.fdf-set-ap.php                            28-Sep-2020 11:09                3850
function.fdf-set-encoding.php                      28-Sep-2020 11:09                3408
function.fdf-set-file.php                          28-Sep-2020 11:09                5023
function.fdf-set-flags.php                         28-Sep-2020 11:09                3855
function.fdf-set-javascript-action.php             28-Sep-2020 11:09                4045
function.fdf-set-on-import-javascript.php          28-Sep-2020 11:09                2872
function.fdf-set-opt.php                           28-Sep-2020 11:09                4061
function.fdf-set-status.php                        28-Sep-2020 11:09                3464
function.fdf-set-submit-form-action.php            28-Sep-2020 11:09                4263
function.fdf-set-target-frame.php                  28-Sep-2020 11:09                3430
function.fdf-set-value.php                         28-Sep-2020 11:09                5337
function.fdf-set-version.php                       28-Sep-2020 11:09                3676
function.feof.php                                  28-Sep-2020 11:09                7782
function.fflush.php                                28-Sep-2020 11:09                5446
function.fgetc.php                                 28-Sep-2020 11:09                6406
function.fgetcsv.php                               28-Sep-2020 11:09               13268
function.fgets.php                                 28-Sep-2020 11:09                8327
function.fgetss.php                                28-Sep-2020 11:09                9451
function.file-exists.php                           28-Sep-2020 11:09                7439
function.file-get-contents.php                     28-Sep-2020 11:09               17543
function.file-put-contents.php                     28-Sep-2020 11:09               13510
function.file.php                                  28-Sep-2020 11:09               12376
function.fileatime.php                             28-Sep-2020 11:09                6835
function.filectime.php                             28-Sep-2020 11:09                6850
function.filegroup.php                             28-Sep-2020 11:09                5679
function.fileinode.php                             28-Sep-2020 11:09                5019
function.filemtime.php                             28-Sep-2020 11:09                6620
function.fileowner.php                             28-Sep-2020 11:09                5352
function.fileperms.php                             28-Sep-2020 11:09               17372
function.filepro-fieldcount.php                    28-Sep-2020 11:08                2462
function.filepro-fieldname.php                     28-Sep-2020 11:08                2463
function.filepro-fieldtype.php                     28-Sep-2020 11:08                2472
function.filepro-fieldwidth.php                    28-Sep-2020 11:08                2461
function.filepro-retrieve.php                      28-Sep-2020 11:08                3418
function.filepro-rowcount.php                      28-Sep-2020 11:08                2759
function.filepro.php                               28-Sep-2020 11:08                2912
function.filesize.php                              28-Sep-2020 11:09                5427
function.filetype.php                              28-Sep-2020 11:09                6317
function.filter-has-var.php                        28-Sep-2020 11:09                2760
function.filter-id.php                             28-Sep-2020 11:09                2595
function.filter-input-array.php                    28-Sep-2020 11:09               14683
function.filter-input.php                          28-Sep-2020 11:09                7596
function.filter-list.php                           28-Sep-2020 11:09                3384
function.filter-var-array.php                      28-Sep-2020 11:09               14265
function.filter-var.php                            28-Sep-2020 11:09               13792
function.finfo-buffer.php                          28-Sep-2020 11:09                6068
function.finfo-close.php                           28-Sep-2020 11:09                2576
function.finfo-file.php                            28-Sep-2020 11:09                6827
function.finfo-open.php                            28-Sep-2020 11:09                9857
function.finfo-set-flags.php                       28-Sep-2020 11:09                3649
function.floatval.php                              28-Sep-2020 11:09                6183
function.flock.php                                 28-Sep-2020 11:09               13352
function.floor.php                                 28-Sep-2020 11:09                4510
function.flush.php                                 28-Sep-2020 11:08                4621
function.fmod.php                                  28-Sep-2020 11:09                4797
function.fnmatch.php                               28-Sep-2020 11:09                7388
function.fopen.php                                 28-Sep-2020 11:09               23195
function.forward-static-call-array.php             28-Sep-2020 11:09               10183
function.forward-static-call.php                   28-Sep-2020 11:09                9522
function.fpassthru.php                             28-Sep-2020 11:09                7533
function.fprintf.php                               28-Sep-2020 11:09               18877
function.fputcsv.php                               28-Sep-2020 11:09                9408
function.fputs.php                                 28-Sep-2020 11:09                1519
function.fread.php                                 28-Sep-2020 11:09               14905
function.frenchtojd.php                            28-Sep-2020 11:09                3900
function.fscanf.php                                28-Sep-2020 11:09               17704
function.fseek.php                                 28-Sep-2020 11:09                7615
function.fsockopen.php                             28-Sep-2020 11:09               16145
function.fstat.php                                 28-Sep-2020 11:09                5838
function.ftell.php                                 28-Sep-2020 11:09                5945
function.ftok.php                                  28-Sep-2020 11:09                3661
function.ftp-alloc.php                             28-Sep-2020 11:09                7564
function.ftp-append.php                            28-Sep-2020 11:09                3190
function.ftp-cdup.php                              28-Sep-2020 11:09                5934
function.ftp-chdir.php                             28-Sep-2020 11:09                6904
function.ftp-chmod.php                             28-Sep-2020 11:09                6178
function.ftp-close.php                             28-Sep-2020 11:09                5214
function.ftp-connect.php                           28-Sep-2020 11:09                5568
function.ftp-delete.php                            28-Sep-2020 11:09                5407
function.ftp-exec.php                              28-Sep-2020 11:09                6005
function.ftp-fget.php                              28-Sep-2020 11:09                9369
function.ftp-fput.php                              28-Sep-2020 11:09                8689
function.ftp-get-option.php                        28-Sep-2020 11:09                5043
function.ftp-get.php                               28-Sep-2020 11:09                8624
function.ftp-login.php                             28-Sep-2020 11:09                5889
function.ftp-mdtm.php                              28-Sep-2020 11:09                6579
function.ftp-mkdir.php                             28-Sep-2020 11:09                5722
function.ftp-mlsd.php                              28-Sep-2020 11:09                8227
function.ftp-nb-continue.php                       28-Sep-2020 11:09                4689
function.ftp-nb-fget.php                           28-Sep-2020 11:09                9837
function.ftp-nb-fput.php                           28-Sep-2020 11:09                9544
function.ftp-nb-get.php                            28-Sep-2020 11:09               13795
function.ftp-nb-put.php                            28-Sep-2020 11:09               10943
function.ftp-nlist.php                             28-Sep-2020 11:09                5950
function.ftp-pasv.php                              28-Sep-2020 11:09                6533
function.ftp-put.php                               28-Sep-2020 11:09                8248
function.ftp-pwd.php                               28-Sep-2020 11:09                5190
function.ftp-quit.php                              28-Sep-2020 11:09                1541
function.ftp-raw.php                               28-Sep-2020 11:09                4597
function.ftp-rawlist.php                           28-Sep-2020 11:09                7244
function.ftp-rename.php                            28-Sep-2020 11:09                6327
function.ftp-rmdir.php                             28-Sep-2020 11:09                5779
function.ftp-set-option.php                        28-Sep-2020 11:09                6300
function.ftp-site.php                              28-Sep-2020 11:09                6029
function.ftp-size.php                              28-Sep-2020 11:09                6169
function.ftp-ssl-connect.php                       28-Sep-2020 11:09                8800
function.ftp-systype.php                           28-Sep-2020 11:09                4607
function.ftruncate.php                             28-Sep-2020 11:09                6261
function.func-get-arg.php                          28-Sep-2020 11:09               14973
function.func-get-args.php                         28-Sep-2020 11:09               15268
function.func-num-args.php                         28-Sep-2020 11:09                8616
function.function-exists.php                       28-Sep-2020 11:09                6099
function.fwrite.php                                28-Sep-2020 11:09               14942
function.gc-collect-cycles.php                     28-Sep-2020 11:08                2418
function.gc-disable.php                            28-Sep-2020 11:08                2500
function.gc-enable.php                             28-Sep-2020 11:08                2474
function.gc-enabled.php                            28-Sep-2020 11:08                3188
function.gc-mem-caches.php                         28-Sep-2020 11:08                2362
function.gc-status.php                             28-Sep-2020 11:08                5909
function.gd-info.php                               28-Sep-2020 11:09                9423
function.geoip-asnum-by-name.php                   28-Sep-2020 11:09                4022
function.geoip-continent-code-by-name.php          28-Sep-2020 11:09                5546
function.geoip-country-code-by-name.php            28-Sep-2020 11:09                5289
function.geoip-country-code3-by-name.php           28-Sep-2020 11:09                4847
function.geoip-country-name-by-name.php            28-Sep-2020 11:09                4813
function.geoip-database-info.php                   28-Sep-2020 11:09                4044
function.geoip-db-avail.php                        28-Sep-2020 11:09                4186
function.geoip-db-filename.php                     28-Sep-2020 11:09                3920
function.geoip-db-get-all-info.php                 28-Sep-2020 11:09                6518
function.geoip-domain-by-name.php                  28-Sep-2020 11:09                4249
function.geoip-id-by-name.php                      28-Sep-2020 11:09                5789
function.geoip-isp-by-name.php                     28-Sep-2020 11:09                4276
function.geoip-netspeedcell-by-name.php            28-Sep-2020 11:09                4990
function.geoip-org-by-name.php                     28-Sep-2020 11:09                4295
function.geoip-record-by-name.php                  28-Sep-2020 11:09                7381
function.geoip-region-by-name.php                  28-Sep-2020 11:09                4910
function.geoip-region-name-by-code.php             28-Sep-2020 11:09                7038
function.geoip-setup-custom-directory.php          28-Sep-2020 11:09                4043
function.geoip-time-zone-by-country-and-region.php 28-Sep-2020 11:09                7201
function.get-browser.php                           28-Sep-2020 11:09                7692
function.get-called-class.php                      28-Sep-2020 11:09                4707
function.get-cfg-var.php                           28-Sep-2020 11:08                4174
function.get-class-methods.php                     28-Sep-2020 11:09                6685
function.get-class-vars.php                        28-Sep-2020 11:09               11551
function.get-class.php                             28-Sep-2020 11:09               12165
function.get-current-user.php                      28-Sep-2020 11:08                4128
function.get-declared-classes.php                  28-Sep-2020 11:09                4952
function.get-declared-interfaces.php               28-Sep-2020 11:09                3999
function.get-declared-traits.php                   28-Sep-2020 11:09                2764
function.get-defined-constants.php                 28-Sep-2020 11:08                7151
function.get-defined-functions.php                 28-Sep-2020 11:09                6601
function.get-defined-vars.php                      28-Sep-2020 11:09                6157
function.get-extension-funcs.php                   28-Sep-2020 11:08                5299
function.get-headers.php                           28-Sep-2020 11:09                8638
function.get-html-translation-table.php            28-Sep-2020 11:09               13254
function.get-include-path.php                      28-Sep-2020 11:08                3940
function.get-included-files.php                    28-Sep-2020 11:08                5802
function.get-loaded-extensions.php                 28-Sep-2020 11:08                5403
function.get-magic-quotes-gpc.php                  28-Sep-2020 11:08                7529
function.get-magic-quotes-runtime.php              28-Sep-2020 11:08                4877
function.get-meta-tags.php                         28-Sep-2020 11:09                8053
function.get-object-vars.php                       28-Sep-2020 11:09                6724
function.get-parent-class.php                      28-Sep-2020 11:09                7791
function.get-required-files.php                    28-Sep-2020 11:08                1708
function.get-resource-type.php                     28-Sep-2020 11:09                6011
function.get-resources.php                         28-Sep-2020 11:08                6602
function.getallheaders.php                         28-Sep-2020 11:09                4901
function.getcwd.php                                28-Sep-2020 11:09                5019
function.getdate.php                               28-Sep-2020 11:09                8969
function.getenv.php                                28-Sep-2020 11:08                7958
function.gethostbyaddr.php                         28-Sep-2020 11:09                4143
function.gethostbyname.php                         28-Sep-2020 11:09                4472
function.gethostbynamel.php                        28-Sep-2020 11:09                4898
function.gethostname.php                           28-Sep-2020 11:09                3977
function.getimagesize.php                          28-Sep-2020 11:09               17293
function.getimagesizefromstring.php                28-Sep-2020 11:09                5327
function.getlastmod.php                            28-Sep-2020 11:08                5003
function.getmxrr.php                               28-Sep-2020 11:09                6208
function.getmygid.php                              28-Sep-2020 11:08                3024
function.getmyinode.php                            28-Sep-2020 11:08                3075
function.getmypid.php                              28-Sep-2020 11:08                3460
function.getmyuid.php                              28-Sep-2020 11:08                3018
function.getopt.php                                28-Sep-2020 11:08               14731
function.getprotobyname.php                        28-Sep-2020 11:09                4504
function.getprotobynumber.php                      28-Sep-2020 11:09                3021
function.getrandmax.php                            28-Sep-2020 11:09                2735
function.getrusage.php                             28-Sep-2020 11:08               11655
function.getservbyname.php                         28-Sep-2020 11:09                6333
function.getservbyport.php                         28-Sep-2020 11:09                3418
function.gettext.php                               28-Sep-2020 11:09                6017
function.gettimeofday.php                          28-Sep-2020 11:09                5247
function.gettype.php                               28-Sep-2020 11:09               10336
function.glob.php                                  28-Sep-2020 11:09               10049
function.gmdate.php                                28-Sep-2020 11:09                8040
function.gmmktime.php                              28-Sep-2020 11:09               10190
function.gmp-abs.php                               28-Sep-2020 11:09                4345
function.gmp-add.php                               28-Sep-2020 11:09                4586
function.gmp-and.php                               28-Sep-2020 11:09                5069
function.gmp-binomial.php                          28-Sep-2020 11:09                3157
function.gmp-clrbit.php                            28-Sep-2020 11:09                5790
function.gmp-cmp.php                               28-Sep-2020 11:09                5468
function.gmp-com.php                               28-Sep-2020 11:09                3810
function.gmp-div-q.php                             28-Sep-2020 11:09               10052
function.gmp-div-qr.php                            28-Sep-2020 11:09                6462
function.gmp-div-r.php                             28-Sep-2020 11:09                5826
function.gmp-div.php                               28-Sep-2020 11:09                1561
function.gmp-divexact.php                          28-Sep-2020 11:09                5850
function.gmp-export.php                            28-Sep-2020 11:09                4710
function.gmp-fact.php                              28-Sep-2020 11:09                4977
function.gmp-gcd.php                               28-Sep-2020 11:09                4972
function.gmp-gcdext.php                            28-Sep-2020 11:09                9504
function.gmp-hamdist.php                           28-Sep-2020 11:09                6384
function.gmp-import.php                            28-Sep-2020 11:09                5249
function.gmp-init.php                              28-Sep-2020 11:09                5260
function.gmp-intval.php                            28-Sep-2020 11:09                5244
function.gmp-invert.php                            28-Sep-2020 11:09                5046
function.gmp-jacobi.php                            28-Sep-2020 11:09                5597
function.gmp-kronecker.php                         28-Sep-2020 11:09                3804
function.gmp-lcm.php                               28-Sep-2020 11:09                3774
function.gmp-legendre.php                          28-Sep-2020 11:09                5614
function.gmp-mod.php                               28-Sep-2020 11:09                4848
function.gmp-mul.php                               28-Sep-2020 11:09                4925
function.gmp-neg.php                               28-Sep-2020 11:09                4293
function.gmp-nextprime.php                         28-Sep-2020 11:09                4971
function.gmp-or.php                                28-Sep-2020 11:09                5439
function.gmp-perfect-power.php                     28-Sep-2020 11:09                3077
function.gmp-perfect-square.php                    28-Sep-2020 11:09                5390
function.gmp-popcount.php                          28-Sep-2020 11:09                4773
function.gmp-pow.php                               28-Sep-2020 11:09                5656
function.gmp-powm.php                              28-Sep-2020 11:09                5588
function.gmp-prob-prime.php                        28-Sep-2020 11:09                5722
function.gmp-random-bits.php                       28-Sep-2020 11:09                4477
function.gmp-random-range.php                      28-Sep-2020 11:09                5221
function.gmp-random-seed.php                       28-Sep-2020 11:09                6740
function.gmp-random.php                            28-Sep-2020 11:09                5476
function.gmp-root.php                              28-Sep-2020 11:09                2987
function.gmp-rootrem.php                           28-Sep-2020 11:09                3092
function.gmp-scan0.php                             28-Sep-2020 11:09                5478
function.gmp-scan1.php                             28-Sep-2020 11:09                5490
function.gmp-setbit.php                            28-Sep-2020 11:09               12172
function.gmp-sign.php                              28-Sep-2020 11:09                5015
function.gmp-sqrt.php                              28-Sep-2020 11:09                4888
function.gmp-sqrtrem.php                           28-Sep-2020 11:09                6296
function.gmp-strval.php                            28-Sep-2020 11:09                4878
function.gmp-sub.php                               28-Sep-2020 11:09                5020
function.gmp-testbit.php                           28-Sep-2020 11:09                5594
function.gmp-xor.php                               28-Sep-2020 11:09                5439
function.gmstrftime.php                            28-Sep-2020 11:09                6743
function.gnupg-adddecryptkey.php                   28-Sep-2020 11:09                5022
function.gnupg-addencryptkey.php                   28-Sep-2020 11:09                4644
function.gnupg-addsignkey.php                      28-Sep-2020 11:09                5028
function.gnupg-cleardecryptkeys.php                28-Sep-2020 11:09                4216
function.gnupg-clearencryptkeys.php                28-Sep-2020 11:09                4220
function.gnupg-clearsignkeys.php                   28-Sep-2020 11:09                4161
function.gnupg-decrypt.php                         28-Sep-2020 11:09                5837
function.gnupg-decryptverify.php                   28-Sep-2020 11:09                6956
function.gnupg-encrypt.php                         28-Sep-2020 11:09                5789
function.gnupg-encryptsign.php                     28-Sep-2020 11:09                6711
function.gnupg-export.php                          28-Sep-2020 11:09                4923
function.gnupg-geterror.php                        28-Sep-2020 11:09                4062
function.gnupg-getprotocol.php                     28-Sep-2020 11:09                4189
function.gnupg-import.php                          28-Sep-2020 11:09                5175
function.gnupg-init.php                            28-Sep-2020 11:09                3300
function.gnupg-keyinfo.php                         28-Sep-2020 11:09                5096
function.gnupg-setarmor.php                        28-Sep-2020 11:09                5544
function.gnupg-seterrormode.php                    28-Sep-2020 11:09                5422
function.gnupg-setsignmode.php                     28-Sep-2020 11:09                5315
function.gnupg-sign.php                            28-Sep-2020 11:09                5958
function.gnupg-verify.php                          28-Sep-2020 11:09                7942
function.grapheme-extract.php                      28-Sep-2020 11:09                7880
function.grapheme-stripos.php                      28-Sep-2020 11:09                7853
function.grapheme-stristr.php                      28-Sep-2020 11:09                7329
function.grapheme-strlen.php                       28-Sep-2020 11:09                5306
function.grapheme-strpos.php                       28-Sep-2020 11:09                7462
function.grapheme-strripos.php                     28-Sep-2020 11:09                7307
function.grapheme-strrpos.php                      28-Sep-2020 11:09                6907
function.grapheme-strstr.php                       28-Sep-2020 11:09                6942
function.grapheme-substr.php                       28-Sep-2020 11:09                6560
function.gregoriantojd.php                         28-Sep-2020 11:09                7993
function.gzclose.php                               28-Sep-2020 11:08                4063
function.gzcompress.php                            28-Sep-2020 11:08                6232
function.gzdecode.php                              28-Sep-2020 11:08                3014
function.gzdeflate.php                             28-Sep-2020 11:08                5914
function.gzencode.php                              28-Sep-2020 11:08                7368
function.gzeof.php                                 28-Sep-2020 11:08                3970
function.gzfile.php                                28-Sep-2020 11:08                4471
function.gzgetc.php                                28-Sep-2020 11:08                4455
function.gzgets.php                                28-Sep-2020 11:08                5106
function.gzgetss.php                               28-Sep-2020 11:08                5936
function.gzinflate.php                             28-Sep-2020 11:08                5210
function.gzopen.php                                28-Sep-2020 11:08                5328
function.gzpassthru.php                            28-Sep-2020 11:08                4701
function.gzputs.php                                28-Sep-2020 11:08                1528
function.gzread.php                                28-Sep-2020 11:08                5844
function.gzrewind.php                              28-Sep-2020 11:08                3036
function.gzseek.php                                28-Sep-2020 11:08                6056
function.gztell.php                                28-Sep-2020 11:08                3204
function.gzuncompress.php                          28-Sep-2020 11:08                5138
function.gzwrite.php                               28-Sep-2020 11:08                5770
function.halt-compiler.php                         28-Sep-2020 11:09                5195
function.hash-algos.php                            28-Sep-2020 11:08                5942
function.hash-copy.php                             28-Sep-2020 11:08                5426
function.hash-equals.php                           28-Sep-2020 11:08                6452
function.hash-file.php                             28-Sep-2020 11:08                6081
function.hash-final.php                            28-Sep-2020 11:08                6119
function.hash-hkdf.php                             28-Sep-2020 11:08                8687
function.hash-hmac-algos.php                       28-Sep-2020 11:08                5031
function.hash-hmac-file.php                        28-Sep-2020 11:08                7036
function.hash-hmac.php                             28-Sep-2020 11:08                6633
function.hash-init.php                             28-Sep-2020 11:08                7736
function.hash-pbkdf2.php                           28-Sep-2020 11:08               10635
function.hash-update-file.php                      28-Sep-2020 11:08                5297
function.hash-update-stream.php                    28-Sep-2020 11:08                7071
function.hash-update.php                           28-Sep-2020 11:08                4267
function.hash.php                                  28-Sep-2020 11:08               10984
function.header-register-callback.php              28-Sep-2020 11:09                6796
function.header-remove.php                         28-Sep-2020 11:09                5918
function.header.php                                28-Sep-2020 11:09               19882
function.headers-list.php                          28-Sep-2020 11:09                6095
function.headers-sent.php                          28-Sep-2020 11:09                8155
function.hebrev.php                                28-Sep-2020 11:09                3179
function.hebrevc.php                               28-Sep-2020 11:09                3296
function.hex2bin.php                               28-Sep-2020 11:09                5536
function.hexdec.php                                28-Sep-2020 11:09                6431
function.highlight-file.php                        28-Sep-2020 11:09                5383
function.highlight-string.php                      28-Sep-2020 11:09                5620
function.hrtime.php                                28-Sep-2020 11:09                4723
function.html-entity-decode.php                    28-Sep-2020 11:09               14390
function.htmlentities.php                          28-Sep-2020 11:09               17770
function.htmlspecialchars-decode.php               28-Sep-2020 11:09                8398
function.htmlspecialchars.php                      28-Sep-2020 11:09               21639
function.http-build-query.php                      28-Sep-2020 11:09               20674
function.http-response-code.php                    28-Sep-2020 11:09                6873
function.hypot.php                                 28-Sep-2020 11:09                2731
function.ibase-add-user.php                        28-Sep-2020 11:08                4410
function.ibase-affected-rows.php                   28-Sep-2020 11:08                3283
function.ibase-backup.php                          28-Sep-2020 11:08                9910
function.ibase-blob-add.php                        28-Sep-2020 11:08                3917
function.ibase-blob-cancel.php                     28-Sep-2020 11:08                3522
function.ibase-blob-close.php                      28-Sep-2020 11:08                3822
function.ibase-blob-create.php                     28-Sep-2020 11:08                3792
function.ibase-blob-echo.php                       28-Sep-2020 11:08                3874
function.ibase-blob-get.php                        28-Sep-2020 11:08                6549
function.ibase-blob-import.php                     28-Sep-2020 11:08                8387
function.ibase-blob-info.php                       28-Sep-2020 11:08                3232
function.ibase-blob-open.php                       28-Sep-2020 11:08                3896
function.ibase-close.php                           28-Sep-2020 11:08                3576
function.ibase-commit-ret.php                      28-Sep-2020 11:08                2962
function.ibase-commit.php                          28-Sep-2020 11:08                2800
function.ibase-connect.php                         28-Sep-2020 11:08                9774
function.ibase-db-info.php                         28-Sep-2020 11:08                2241
function.ibase-delete-user.php                     28-Sep-2020 11:08                3303
function.ibase-drop-db.php                         28-Sep-2020 11:08                3441
function.ibase-errcode.php                         28-Sep-2020 11:08                2368
function.ibase-errmsg.php                          28-Sep-2020 11:08                2351
function.ibase-execute.php                         28-Sep-2020 11:08                7040
function.ibase-fetch-assoc.php                     28-Sep-2020 11:08                4673
function.ibase-fetch-object.php                    28-Sep-2020 11:08                6619
function.ibase-fetch-row.php                       28-Sep-2020 11:08                4295
function.ibase-field-info.php                      28-Sep-2020 11:08                7040
function.ibase-free-event-handler.php              28-Sep-2020 11:08                3294
function.ibase-free-query.php                      28-Sep-2020 11:08                2546
function.ibase-free-result.php                     28-Sep-2020 11:08                2643
function.ibase-gen-id.php                          28-Sep-2020 11:08                2584
function.ibase-maintain-db.php                     28-Sep-2020 11:08                2572
function.ibase-modify-user.php                     28-Sep-2020 11:08                4419
function.ibase-name-result.php                     28-Sep-2020 11:08                5679
function.ibase-num-fields.php                      28-Sep-2020 11:08                6579
function.ibase-num-params.php                      28-Sep-2020 11:08                3349
function.ibase-param-info.php                      28-Sep-2020 11:08                3523
function.ibase-pconnect.php                        28-Sep-2020 11:08                7104
function.ibase-prepare.php                         28-Sep-2020 11:08                4119
function.ibase-query.php                           28-Sep-2020 11:08                7745
function.ibase-restore.php                         28-Sep-2020 11:08                9944
function.ibase-rollback-ret.php                    28-Sep-2020 11:08                3055
function.ibase-rollback.php                        28-Sep-2020 11:08                2837
function.ibase-server-info.php                     28-Sep-2020 11:08               10755
function.ibase-service-attach.php                  28-Sep-2020 11:08               12582
function.ibase-service-detach.php                  28-Sep-2020 11:08                6859
function.ibase-set-event-handler.php               28-Sep-2020 11:08                7716
function.ibase-trans.php                           28-Sep-2020 11:08                5495
function.ibase-wait-event.php                      28-Sep-2020 11:08                3952
function.iconv-get-encoding.php                    28-Sep-2020 11:09                5565
function.iconv-mime-decode-headers.php             28-Sep-2020 11:09                9591
function.iconv-mime-decode.php                     28-Sep-2020 11:09                7447
function.iconv-mime-encode.php                     28-Sep-2020 11:09               11849
function.iconv-set-encoding.php                    28-Sep-2020 11:09                4721
function.iconv-strlen.php                          28-Sep-2020 11:09                3889
function.iconv-strpos.php                          28-Sep-2020 11:09                6490
function.iconv-strrpos.php                         28-Sep-2020 11:09                5555
function.iconv-substr.php                          28-Sep-2020 11:09                7239
function.iconv.php                                 28-Sep-2020 11:09                8163
function.idate.php                                 28-Sep-2020 11:09                9595
function.idn-to-ascii.php                          28-Sep-2020 11:09                6574
function.idn-to-utf8.php                           28-Sep-2020 11:09                6592
function.ifx-affected-rows.php                     28-Sep-2020 11:08                5961
function.ifx-blobinfile-mode.php                   28-Sep-2020 11:08                2524
function.ifx-byteasvarchar.php                     28-Sep-2020 11:08                2847
function.ifx-close.php                             28-Sep-2020 11:08                4654
function.ifx-connect.php                           28-Sep-2020 11:08                5300
function.ifx-copy-blob.php                         28-Sep-2020 11:08                2815
function.ifx-create-blob.php                       28-Sep-2020 11:08                3472
function.ifx-create-char.php                       28-Sep-2020 11:08                2631
function.ifx-do.php                                28-Sep-2020 11:08                4895
function.ifx-error.php                             28-Sep-2020 11:08                3302
function.ifx-errormsg.php                          28-Sep-2020 11:08                3577
function.ifx-fetch-row.php                         28-Sep-2020 11:08                9447
function.ifx-fieldproperties.php                   28-Sep-2020 11:08                5008
function.ifx-fieldtypes.php                        28-Sep-2020 11:08                4809
function.ifx-free-blob.php                         28-Sep-2020 11:08                2701
function.ifx-free-char.php                         28-Sep-2020 11:08                2703
function.ifx-free-result.php                       28-Sep-2020 11:08                3082
function.ifx-get-blob.php                          28-Sep-2020 11:08                2658
function.ifx-get-char.php                          28-Sep-2020 11:08                2648
function.ifx-getsqlca.php                          28-Sep-2020 11:08                5853
function.ifx-htmltbl-result.php                    28-Sep-2020 11:08                6288
function.ifx-nullformat.php                        28-Sep-2020 11:08                2487
function.ifx-num-fields.php                        28-Sep-2020 11:08                4603
function.ifx-num-rows.php                          28-Sep-2020 11:08                3250
function.ifx-pconnect.php                          28-Sep-2020 11:08                4574
function.ifx-prepare.php                           28-Sep-2020 11:08                5427
function.ifx-query.php                             28-Sep-2020 11:08               10961
function.ifx-textasvarchar.php                     28-Sep-2020 11:08                2839
function.ifx-update-blob.php                       28-Sep-2020 11:08                3087
function.ifx-update-char.php                       28-Sep-2020 11:08                3085
function.ifxus-close-slob.php                      28-Sep-2020 11:08                2779
function.ifxus-create-slob.php                     28-Sep-2020 11:08                3172
function.ifxus-free-slob.php                       28-Sep-2020 11:08                2708
function.ifxus-open-slob.php                       28-Sep-2020 11:08                3437
function.ifxus-read-slob.php                       28-Sep-2020 11:08                2988
function.ifxus-seek-slob.php                       28-Sep-2020 11:08                3264
function.ifxus-tell-slob.php                       28-Sep-2020 11:08                2735
function.ifxus-write-slob.php                      28-Sep-2020 11:08                2958
function.ignore-user-abort.php                     28-Sep-2020 11:09                7465
function.iis-add-server.php                        28-Sep-2020 11:09                2490
function.iis-get-dir-security.php                  28-Sep-2020 11:09                1993
function.iis-get-script-map.php                    28-Sep-2020 11:09                2172
function.iis-get-server-by-comment.php             28-Sep-2020 11:09                1954
function.iis-get-server-by-path.php                28-Sep-2020 11:09                2555
function.iis-get-server-rights.php                 28-Sep-2020 11:09                2017
function.iis-get-service-state.php                 28-Sep-2020 11:09                1925
function.iis-remove-server.php                     28-Sep-2020 11:09                1909
function.iis-set-app-settings.php                  28-Sep-2020 11:09                2150
function.iis-set-dir-security.php                  28-Sep-2020 11:09                2121
function.iis-set-script-map.php                    28-Sep-2020 11:09                2367
function.iis-set-server-rights.php                 28-Sep-2020 11:09                2115
function.iis-start-server.php                      28-Sep-2020 11:09                1867
function.iis-start-service.php                     28-Sep-2020 11:09                1868
function.iis-stop-server.php                       28-Sep-2020 11:09                1849
function.iis-stop-service.php                      28-Sep-2020 11:09                1834
function.image-type-to-extension.php               28-Sep-2020 11:09                4879
function.image-type-to-mime-type.php               28-Sep-2020 11:09                7721
function.image2wbmp.php                            28-Sep-2020 11:09                6210
function.imageaffine.php                           28-Sep-2020 11:09                3216
function.imageaffinematrixconcat.php               28-Sep-2020 11:09                6332
function.imageaffinematrixget.php                  28-Sep-2020 11:09                6016
function.imagealphablending.php                    28-Sep-2020 11:09                6610
function.imageantialias.php                        28-Sep-2020 11:09               10540
function.imagearc.php                              28-Sep-2020 11:09               12679
function.imagebmp.php                              28-Sep-2020 11:09                6492
function.imagechar.php                             28-Sep-2020 11:09                8526
function.imagecharup.php                           28-Sep-2020 11:09                8285
function.imagecolorallocate.php                    28-Sep-2020 11:09                9620
function.imagecolorallocatealpha.php               28-Sep-2020 11:09               17470
function.imagecolorat.php                          28-Sep-2020 11:09                9438
function.imagecolorclosest.php                     28-Sep-2020 11:09               11693
function.imagecolorclosestalpha.php                28-Sep-2020 11:09               12650
function.imagecolorclosesthwb.php                  28-Sep-2020 11:09                5522
function.imagecolordeallocate.php                  28-Sep-2020 11:09                4943
function.imagecolorexact.php                       28-Sep-2020 11:09                7605
function.imagecolorexactalpha.php                  28-Sep-2020 11:09                8377
function.imagecolormatch.php                       28-Sep-2020 11:09                7736
function.imagecolorresolve.php                     28-Sep-2020 11:09                6777
function.imagecolorresolvealpha.php                28-Sep-2020 11:09                7280
function.imagecolorset.php                         28-Sep-2020 11:09                8061
function.imagecolorsforindex.php                   28-Sep-2020 11:09                6213
function.imagecolorstotal.php                      28-Sep-2020 11:09                5111
function.imagecolortransparent.php                 28-Sep-2020 11:09                8280
function.imageconvolution.php                      28-Sep-2020 11:09               11160
function.imagecopy.php                             28-Sep-2020 11:09                7696
function.imagecopymerge.php                        28-Sep-2020 11:09                8118
function.imagecopymergegray.php                    28-Sep-2020 11:09                8650
function.imagecopyresampled.php                    28-Sep-2020 11:09               17772
function.imagecopyresized.php                      28-Sep-2020 11:09               12795
function.imagecreate.php                           28-Sep-2020 11:09                7597
function.imagecreatefrombmp.php                    28-Sep-2020 11:09                4714
function.imagecreatefromgd.php                     28-Sep-2020 11:09                5471
function.imagecreatefromgd2.php                    28-Sep-2020 11:09                5672
function.imagecreatefromgd2part.php                28-Sep-2020 11:09                8055
function.imagecreatefromgif.php                    28-Sep-2020 11:09               10108
function.imagecreatefromjpeg.php                   28-Sep-2020 11:09                9238
function.imagecreatefrompng.php                    28-Sep-2020 11:09                9179
function.imagecreatefromstring.php                 28-Sep-2020 11:09                7303
function.imagecreatefromwbmp.php                   28-Sep-2020 11:09                9151
function.imagecreatefromwebp.php                   28-Sep-2020 11:09                4836
function.imagecreatefromxbm.php                    28-Sep-2020 11:09                4706
function.imagecreatefromxpm.php                    28-Sep-2020 11:09                5542
function.imagecreatetruecolor.php                  28-Sep-2020 11:09                6356
function.imagecrop.php                             28-Sep-2020 11:09                6540
function.imagecropauto.php                         28-Sep-2020 11:09                9653
function.imagedashedline.php                       28-Sep-2020 11:09               12720
function.imagedestroy.php                          28-Sep-2020 11:09                4018
function.imageellipse.php                          28-Sep-2020 11:09                9069
function.imagefill.php                             28-Sep-2020 11:09                6600
function.imagefilledarc.php                        28-Sep-2020 11:09               17413
function.imagefilledellipse.php                    28-Sep-2020 11:09                8700
function.imagefilledpolygon.php                    28-Sep-2020 11:09               10576
function.imagefilledrectangle.php                  28-Sep-2020 11:09                7219
function.imagefilltoborder.php                     28-Sep-2020 11:09                9922
function.imagefilter.php                           28-Sep-2020 11:09               33573
function.imageflip.php                             28-Sep-2020 11:09                8657
function.imagefontheight.php                       28-Sep-2020 11:09                5639
function.imagefontwidth.php                        28-Sep-2020 11:09                5648
function.imageftbbox.php                           28-Sep-2020 11:09               13714
function.imagefttext.php                           28-Sep-2020 11:09               14823
function.imagegammacorrect.php                     28-Sep-2020 11:09                5045
function.imagegd.php                               28-Sep-2020 11:09               10018
function.imagegd2.php                              28-Sep-2020 11:09               10192
function.imagegetclip.php                          28-Sep-2020 11:09                5176
function.imagegif.php                              28-Sep-2020 11:09               17662
function.imagegrabscreen.php                       28-Sep-2020 11:09                3737
function.imagegrabwindow.php                       28-Sep-2020 11:09                8639
function.imageinterlace.php                        28-Sep-2020 11:09                4957
function.imageistruecolor.php                      28-Sep-2020 11:09                6825
function.imagejpeg.php                             28-Sep-2020 11:09               15585
function.imagelayereffect.php                      28-Sep-2020 11:09               11347
function.imageline.php                             28-Sep-2020 11:09               15418
function.imageloadfont.php                         28-Sep-2020 11:09                8771
function.imageopenpolygon.php                      28-Sep-2020 11:09                8354
function.imagepalettecopy.php                      28-Sep-2020 11:09                6915
function.imagepalettetotruecolor.php               28-Sep-2020 11:09                9520
function.imagepng.php                              28-Sep-2020 11:09                8633
function.imagepolygon.php                          28-Sep-2020 11:09                8744
function.imagerectangle.php                        28-Sep-2020 11:09                9526
function.imageresolution.php                       28-Sep-2020 11:09                6597
function.imagerotate.php                           28-Sep-2020 11:09                8206
function.imagesavealpha.php                        28-Sep-2020 11:09                5991
function.imagescale.php                            28-Sep-2020 11:09                5711
function.imagesetbrush.php                         28-Sep-2020 11:09                8355
function.imagesetclip.php                          28-Sep-2020 11:09                3941
function.imagesetinterpolation.php                 28-Sep-2020 11:09                9043
function.imagesetpixel.php                         28-Sep-2020 11:09               10751
function.imagesetstyle.php                         28-Sep-2020 11:09               12333
function.imagesetthickness.php                     28-Sep-2020 11:09                7656
function.imagesettile.php                          28-Sep-2020 11:09                7429
function.imagestring.php                           28-Sep-2020 11:09                8685
function.imagestringup.php                         28-Sep-2020 11:09                7761
function.imagesx.php                               28-Sep-2020 11:09                4395
function.imagesy.php                               28-Sep-2020 11:09                4409
function.imagetruecolortopalette.php               28-Sep-2020 11:09                5858
function.imagettfbbox.php                          28-Sep-2020 11:09               19160
function.imagettftext.php                          28-Sep-2020 11:09               17776
function.imagetypes.php                            28-Sep-2020 11:09                4270
function.imagewbmp.php                             28-Sep-2020 11:09               14265
function.imagewebp.php                             28-Sep-2020 11:09                6260
function.imagexbm.php                              28-Sep-2020 11:09               10569
function.imagick-pingimage.php                     28-Sep-2020 11:09                2655
function.imap-8bit.php                             28-Sep-2020 11:09                2783
function.imap-alerts.php                           28-Sep-2020 11:09                2779
function.imap-append.php                           28-Sep-2020 11:09                9263
function.imap-base64.php                           28-Sep-2020 11:09                3151
function.imap-binary.php                           28-Sep-2020 11:09                2760
function.imap-body.php                             28-Sep-2020 11:09                4331
function.imap-bodystruct.php                       28-Sep-2020 11:09                3577
function.imap-check.php                            28-Sep-2020 11:09                5085
function.imap-clearflag-full.php                   28-Sep-2020 11:09                4593
function.imap-close.php                            28-Sep-2020 11:09                3456
function.imap-create.php                           28-Sep-2020 11:09                1627
function.imap-createmailbox.php                    28-Sep-2020 11:09               14820
function.imap-delete.php                           28-Sep-2020 11:09                8960
function.imap-deletemailbox.php                    28-Sep-2020 11:09                4009
function.imap-errors.php                           28-Sep-2020 11:09                3038
function.imap-expunge.php                          28-Sep-2020 11:09                2738
function.imap-fetch-overview.php                   28-Sep-2020 11:09               11220
function.imap-fetchbody.php                        28-Sep-2020 11:09                4843
function.imap-fetchheader.php                      28-Sep-2020 11:09                4513
function.imap-fetchmime.php                        28-Sep-2020 11:09                4934
function.imap-fetchstructure.php                   28-Sep-2020 11:09                8795
function.imap-fetchtext.php                        28-Sep-2020 11:09                1605
function.imap-gc.php                               28-Sep-2020 11:09                4127
function.imap-get-quota.php                        28-Sep-2020 11:09               12122
function.imap-get-quotaroot.php                    28-Sep-2020 11:09                8574
function.imap-getacl.php                           28-Sep-2020 11:09                4873
function.imap-getmailboxes.php                     28-Sep-2020 11:09               11423
function.imap-getsubscribed.php                    28-Sep-2020 11:09                6546
function.imap-header.php                           28-Sep-2020 11:09                1624
function.imap-headerinfo.php                       28-Sep-2020 11:09               11299
function.imap-headers.php                          28-Sep-2020 11:09                2559
function.imap-last-error.php                       28-Sep-2020 11:09                2710
function.imap-list.php                             28-Sep-2020 11:09                7984
function.imap-listmailbox.php                      28-Sep-2020 11:09                1608
function.imap-listscan.php                         28-Sep-2020 11:09                5655
function.imap-listsubscribed.php                   28-Sep-2020 11:09                1626
function.imap-lsub.php                             28-Sep-2020 11:09                4914
function.imap-mail-compose.php                     28-Sep-2020 11:09               10145
function.imap-mail-copy.php                        28-Sep-2020 11:09                4954
function.imap-mail-move.php                        28-Sep-2020 11:09                5200
function.imap-mail.php                             28-Sep-2020 11:09                5521
function.imap-mailboxmsginfo.php                   28-Sep-2020 11:09                9472
function.imap-mime-header-decode.php               28-Sep-2020 11:09                6097
function.imap-msgno.php                            28-Sep-2020 11:09                3223
function.imap-mutf7-to-utf8.php                    28-Sep-2020 11:09                2962
function.imap-num-msg.php                          28-Sep-2020 11:09                3040
function.imap-num-recent.php                       28-Sep-2020 11:09                3030
function.imap-open.php                             28-Sep-2020 11:09               21866
function.imap-ping.php                             28-Sep-2020 11:09                4199
function.imap-qprint.php                           28-Sep-2020 11:09                2786
function.imap-rename.php                           28-Sep-2020 11:09                1630
function.imap-renamemailbox.php                    28-Sep-2020 11:09                4692
function.imap-reopen.php                           28-Sep-2020 11:09                8078
function.imap-rfc822-parse-adrlist.php             28-Sep-2020 11:09                8127
function.imap-rfc822-parse-headers.php             28-Sep-2020 11:09                3438
function.imap-rfc822-write-address.php             28-Sep-2020 11:09                4965
function.imap-savebody.php                         28-Sep-2020 11:09                5106
function.imap-scan.php                             28-Sep-2020 11:09                1597
function.imap-scanmailbox.php                      28-Sep-2020 11:09                1620
function.imap-search.php                           28-Sep-2020 11:09               12557
function.imap-set-quota.php                        28-Sep-2020 11:09                5954
function.imap-setacl.php                           28-Sep-2020 11:09                4357
function.imap-setflag-full.php                     28-Sep-2020 11:09                7041
function.imap-sort.php                             28-Sep-2020 11:09                5935
function.imap-status.php                           28-Sep-2020 11:09                9964
function.imap-subscribe.php                        28-Sep-2020 11:09                3475
function.imap-thread.php                           28-Sep-2020 11:09                7097
function.imap-timeout.php                          28-Sep-2020 11:09                4241
function.imap-uid.php                              28-Sep-2020 11:09                3632
function.imap-undelete.php                         28-Sep-2020 11:09                3859
function.imap-unsubscribe.php                      28-Sep-2020 11:09                3561
function.imap-utf7-decode.php                      28-Sep-2020 11:09                3434
function.imap-utf7-encode.php                      28-Sep-2020 11:09                3233
function.imap-utf8-to-mutf7.php                    28-Sep-2020 11:09                2965
function.imap-utf8.php                             28-Sep-2020 11:09                2920
function.implode.php                               28-Sep-2020 11:09                6919
function.in-array.php                              28-Sep-2020 11:09               11262
function.include-once.php                          28-Sep-2020 11:08                2055
function.include.php                               28-Sep-2020 11:08               21950
function.inet-ntop.php                             28-Sep-2020 11:09                6761
function.inet-pton.php                             28-Sep-2020 11:09                5243
function.inflate-add.php                           28-Sep-2020 11:08                4506
function.inflate-get-read-len.php                  28-Sep-2020 11:08                2478
function.inflate-get-status.php                    28-Sep-2020 11:08                2370
function.inflate-init.php                          28-Sep-2020 11:08                5235
function.ingres-autocommit-state.php               28-Sep-2020 11:08                3214
function.ingres-autocommit.php                     28-Sep-2020 11:08                5038
function.ingres-charset.php                        28-Sep-2020 11:08                5017
function.ingres-close.php                          28-Sep-2020 11:08                3436
function.ingres-commit.php                         28-Sep-2020 11:08                4260
function.ingres-connect.php                        28-Sep-2020 11:08               16310
function.ingres-cursor.php                         28-Sep-2020 11:08                4771
function.ingres-errno.php                          28-Sep-2020 11:08                6107
function.ingres-error.php                          28-Sep-2020 11:08                6031
function.ingres-errsqlstate.php                    28-Sep-2020 11:08                6248
function.ingres-escape-string.php                  28-Sep-2020 11:08                6242
function.ingres-execute.php                        28-Sep-2020 11:08                6472
function.ingres-fetch-array.php                    28-Sep-2020 11:08               10774
function.ingres-fetch-assoc.php                    28-Sep-2020 11:08                7549
function.ingres-fetch-object.php                   28-Sep-2020 11:08                7696
function.ingres-fetch-proc-return.php              28-Sep-2020 11:08                7316
function.ingres-fetch-row.php                      28-Sep-2020 11:08                7326
function.ingres-field-length.php                   28-Sep-2020 11:08                5756
function.ingres-field-name.php                     28-Sep-2020 11:08                5596
function.ingres-field-nullable.php                 28-Sep-2020 11:08                5698
function.ingres-field-precision.php                28-Sep-2020 11:08                5842
function.ingres-field-scale.php                    28-Sep-2020 11:08                5780
function.ingres-field-type.php                     28-Sep-2020 11:08                6391
function.ingres-free-result.php                    28-Sep-2020 11:08                5116
function.ingres-next-error.php                     28-Sep-2020 11:08                4039
function.ingres-num-fields.php                     28-Sep-2020 11:08                3879
function.ingres-num-rows.php                       28-Sep-2020 11:08                5203
function.ingres-pconnect.php                       28-Sep-2020 11:08                5186
function.ingres-prepare.php                        28-Sep-2020 11:08                8074
function.ingres-query.php                          28-Sep-2020 11:08               20934
function.ingres-result-seek.php                    28-Sep-2020 11:08                8442
function.ingres-rollback.php                       28-Sep-2020 11:08                3595
function.ingres-set-environment.php                28-Sep-2020 11:08               13358
function.ingres-unbuffered-query.php               28-Sep-2020 11:08               17227
function.ini-alter.php                             28-Sep-2020 11:08                1576
function.ini-get-all.php                           28-Sep-2020 11:08                9336
function.ini-get.php                               28-Sep-2020 11:08               10965
function.ini-restore.php                           28-Sep-2020 11:08                6453
function.ini-set.php                               28-Sep-2020 11:08                5341
function.inotify-add-watch.php                     28-Sep-2020 11:09                3852
function.inotify-init.php                          28-Sep-2020 11:09                9074
function.inotify-queue-len.php                     28-Sep-2020 11:09                3644
function.inotify-read.php                          28-Sep-2020 11:09                4270
function.inotify-rm-watch.php                      28-Sep-2020 11:09                3346
function.intdiv.php                                28-Sep-2020 11:09                7324
function.interface-exists.php                      28-Sep-2020 11:09                5115
function.intl-error-name.php                       28-Sep-2020 11:09                4976
function.intl-get-error-code.php                   28-Sep-2020 11:09                4344
function.intl-get-error-message.php                28-Sep-2020 11:09                4337
function.intl-is-failure.php                       28-Sep-2020 11:09                5421
function.intval.php                                28-Sep-2020 11:09               14900
function.ip2long.php                               28-Sep-2020 11:09               10895
function.iptcembed.php                             28-Sep-2020 11:09               12705
function.iptcparse.php                             28-Sep-2020 11:09                4332
function.is-a.php                                  28-Sep-2020 11:09                6611
function.is-array.php                              28-Sep-2020 11:09                5512
function.is-bool.php                               28-Sep-2020 11:09                5682
function.is-callable.php                           28-Sep-2020 11:09               10466
function.is-countable.php                          28-Sep-2020 11:09                6234
function.is-dir.php                                28-Sep-2020 11:09                6580
function.is-double.php                             28-Sep-2020 11:09                1580
function.is-executable.php                         28-Sep-2020 11:09                5402
function.is-file.php                               28-Sep-2020 11:09                5676
function.is-finite.php                             28-Sep-2020 11:09                3085
function.is-float.php                              28-Sep-2020 11:09                6525
function.is-infinite.php                           28-Sep-2020 11:09                3305
function.is-int.php                                28-Sep-2020 11:09                6699
function.is-integer.php                            28-Sep-2020 11:09                1572
function.is-iterable.php                           28-Sep-2020 11:09                5716
function.is-link.php                               28-Sep-2020 11:09                5559
function.is-long.php                               28-Sep-2020 11:09                1556
function.is-nan.php                                28-Sep-2020 11:09                4411
function.is-null.php                               28-Sep-2020 11:09                5843
function.is-numeric.php                            28-Sep-2020 11:09                9522
function.is-object.php                             28-Sep-2020 11:09                7225
function.is-readable.php                           28-Sep-2020 11:09                6284
function.is-real.php                               28-Sep-2020 11:09                1568
function.is-resource.php                           28-Sep-2020 11:09                5081
function.is-scalar.php                             28-Sep-2020 11:09                8345
function.is-soap-fault.php                         28-Sep-2020 11:09                8461
function.is-string.php                             28-Sep-2020 11:09                6756
function.is-subclass-of.php                        28-Sep-2020 11:09               14342
function.is-tainted.php                            28-Sep-2020 11:09                2152
function.is-uploaded-file.php                      28-Sep-2020 11:09                6756
function.is-writable.php                           28-Sep-2020 11:09                5897
function.is-writeable.php                          28-Sep-2020 11:09                1591
function.isset.php                                 28-Sep-2020 11:09               17818
function.iterator-apply.php                        28-Sep-2020 11:09                6527
function.iterator-count.php                        28-Sep-2020 11:09                7857
function.iterator-to-array.php                     28-Sep-2020 11:09                6731
function.jddayofweek.php                           28-Sep-2020 11:09                3656
function.jdmonthname.php                           28-Sep-2020 11:09                4491
function.jdtofrench.php                            28-Sep-2020 11:09                3035
function.jdtogregorian.php                         28-Sep-2020 11:09                3067
function.jdtojewish.php                            28-Sep-2020 11:09                7170
function.jdtojulian.php                            28-Sep-2020 11:09                3040
function.jdtounix.php                              28-Sep-2020 11:09                3124
function.jewishtojd.php                            28-Sep-2020 11:09                4403
function.join.php                                  28-Sep-2020 11:09                1521
function.jpeg2wbmp.php                             28-Sep-2020 11:09                6401
function.json-decode.php                           28-Sep-2020 11:09               23051
function.json-encode.php                           28-Sep-2020 11:09               33682
function.json-last-error-msg.php                   28-Sep-2020 11:09                3014
function.json-last-error.php                       28-Sep-2020 11:09               14900
function.judy-type.php                             28-Sep-2020 11:09                2552
function.judy-version.php                          28-Sep-2020 11:09                2091
function.juliantojd.php                            28-Sep-2020 11:09                4523
function.key-exists.php                            28-Sep-2020 11:09                1593
function.key.php                                   28-Sep-2020 11:09                7057
function.krsort.php                                28-Sep-2020 11:09                5955
function.ksort.php                                 28-Sep-2020 11:09                5673
function.lcfirst.php                               28-Sep-2020 11:09                5677
function.lcg-value.php                             28-Sep-2020 11:09                3438
function.lchgrp.php                                28-Sep-2020 11:09                6104
function.lchown.php                                28-Sep-2020 11:09                5960
function.ldap-8859-to-t61.php                      28-Sep-2020 11:09                2950
function.ldap-add-ext.php                          28-Sep-2020 11:09                3685
function.ldap-add.php                              28-Sep-2020 11:09               10053
function.ldap-bind-ext.php                         28-Sep-2020 11:09                3554
function.ldap-bind.php                             28-Sep-2020 11:09                9156
function.ldap-close.php                            28-Sep-2020 11:09                1579
function.ldap-compare.php                          28-Sep-2020 11:09               10511
function.ldap-connect.php                          28-Sep-2020 11:09                8509
function.ldap-control-paged-result-response.php    28-Sep-2020 11:09                4946
function.ldap-control-paged-result.php             28-Sep-2020 11:09               15171
function.ldap-count-entries.php                    28-Sep-2020 11:09                4146
function.ldap-delete-ext.php                       28-Sep-2020 11:09                3367
function.ldap-delete.php                           28-Sep-2020 11:09                4275
function.ldap-dn2ufn.php                           28-Sep-2020 11:09                2378
function.ldap-err2str.php                          28-Sep-2020 11:09                4621
function.ldap-errno.php                            28-Sep-2020 11:09                7104
function.ldap-error.php                            28-Sep-2020 11:09                3768
function.ldap-escape.php                           28-Sep-2020 11:09                6267
function.ldap-exop-passwd.php                      28-Sep-2020 11:09                9727
function.ldap-exop-refresh.php                     28-Sep-2020 11:09                3899
function.ldap-exop-whoami.php                      28-Sep-2020 11:09                2777
function.ldap-exop.php                             28-Sep-2020 11:09               11613
function.ldap-explode-dn.php                       28-Sep-2020 11:09                3335
function.ldap-first-attribute.php                  28-Sep-2020 11:09                5262
function.ldap-first-entry.php                      28-Sep-2020 11:09                3752
function.ldap-first-reference.php                  28-Sep-2020 11:09                2003
function.ldap-free-result.php                      28-Sep-2020 11:09                2880
function.ldap-get-attributes.php                   28-Sep-2020 11:09                5621
function.ldap-get-dn.php                           28-Sep-2020 11:09                2723
function.ldap-get-entries.php                      28-Sep-2020 11:09                4542
function.ldap-get-option.php                       28-Sep-2020 11:09               10365
function.ldap-get-values-len.php                   28-Sep-2020 11:09                3961
function.ldap-get-values.php                       28-Sep-2020 11:09                7538
function.ldap-list.php                             28-Sep-2020 11:09               10138
function.ldap-mod-add.php                          28-Sep-2020 11:09                5717
function.ldap-mod-del.php                          28-Sep-2020 11:09                5178
function.ldap-mod-replace.php                      28-Sep-2020 11:09                5641
function.ldap-mod_add-ext.php                      28-Sep-2020 11:09                3495
function.ldap-mod_del-ext.php                      28-Sep-2020 11:09                3499
function.ldap-mod_replace-ext.php                  28-Sep-2020 11:09                3564
function.ldap-modify-batch.php                     28-Sep-2020 11:09               19855
function.ldap-modify.php                           28-Sep-2020 11:09                1635
function.ldap-next-attribute.php                   28-Sep-2020 11:09                4679
function.ldap-next-entry.php                       28-Sep-2020 11:09                4059
function.ldap-next-reference.php                   28-Sep-2020 11:09                1991
function.ldap-parse-exop.php                       28-Sep-2020 11:09                3822
function.ldap-parse-reference.php                  28-Sep-2020 11:09                2146
function.ldap-parse-result.php                     28-Sep-2020 11:09                8022
function.ldap-read.php                             28-Sep-2020 11:09                9253
function.ldap-rename-ext.php                       28-Sep-2020 11:09                3670
function.ldap-rename.php                           28-Sep-2020 11:09                5882
function.ldap-sasl-bind.php                        28-Sep-2020 11:09                4028
function.ldap-search.php                           28-Sep-2020 11:09               11763
function.ldap-set-option.php                       28-Sep-2020 11:09               12137
function.ldap-set-rebind-proc.php                  28-Sep-2020 11:09                2095
function.ldap-sort.php                             28-Sep-2020 11:09                6740
function.ldap-start-tls.php                        28-Sep-2020 11:09                1816
function.ldap-t61-to-8859.php                      28-Sep-2020 11:09                1860
function.ldap-unbind.php                           28-Sep-2020 11:09                2816
function.levenshtein.php                           28-Sep-2020 11:09               12710
function.libxml-clear-errors.php                   28-Sep-2020 11:09                2590
function.libxml-disable-entity-loader.php          28-Sep-2020 11:09                3642
function.libxml-get-errors.php                     28-Sep-2020 11:09               11734
function.libxml-get-last-error.php                 28-Sep-2020 11:09                2768
function.libxml-set-external-entity-loader.php     28-Sep-2020 11:09                7999
function.libxml-set-streams-context.php            28-Sep-2020 11:09                5081
function.libxml-use-internal-errors.php            28-Sep-2020 11:09                5812
function.link.php                                  28-Sep-2020 11:09                6024
function.linkinfo.php                              28-Sep-2020 11:09                4893
function.list.php                                  28-Sep-2020 11:09               22171
function.localeconv.php                            28-Sep-2020 11:09                9332
function.localtime.php                             28-Sep-2020 11:09                8883
function.log-cmd-delete.php                        28-Sep-2020 11:08                6269
function.log-cmd-insert.php                        28-Sep-2020 11:08                5858
function.log-cmd-update.php                        28-Sep-2020 11:08                6538
function.log-getmore.php                           28-Sep-2020 11:08                4082
function.log-killcursor.php                        28-Sep-2020 11:08                3830
function.log-reply.php                             28-Sep-2020 11:08                5524
function.log-write-batch.php                       28-Sep-2020 11:08                5822
function.log.php                                   28-Sep-2020 11:09                3494
function.log10.php                                 28-Sep-2020 11:09                2568
function.log1p.php                                 28-Sep-2020 11:09                3821
function.long2ip.php                               28-Sep-2020 11:09                4208
function.lstat.php                                 28-Sep-2020 11:09                6201
function.ltrim.php                                 28-Sep-2020 11:09                9646
function.lzf-compress.php                          28-Sep-2020 11:08                2720
function.lzf-decompress.php                        28-Sep-2020 11:08                2806
function.lzf-optimized-for.php                     28-Sep-2020 11:08                1924
function.mail.php                                  28-Sep-2020 11:09               28681
function.mailparse-determine-best-xfer-encoding..> 28-Sep-2020 11:09                4083
function.mailparse-msg-create.php                  28-Sep-2020 11:09                2607
function.mailparse-msg-extract-part-file.php       28-Sep-2020 11:09                4890
function.mailparse-msg-extract-part.php            28-Sep-2020 11:09                3898
function.mailparse-msg-extract-whole-part-file.php 28-Sep-2020 11:09                3867
function.mailparse-msg-free.php                    28-Sep-2020 11:09                3362
function.mailparse-msg-get-part-data.php           28-Sep-2020 11:09                2369
function.mailparse-msg-get-part.php                28-Sep-2020 11:09                2599
function.mailparse-msg-get-structure.php           28-Sep-2020 11:09                2389
function.mailparse-msg-parse-file.php              28-Sep-2020 11:09                3529
function.mailparse-msg-parse.php                   28-Sep-2020 11:09                3199
function.mailparse-rfc822-parse-addresses.php      28-Sep-2020 11:09                5380
function.mailparse-stream-encode.php               28-Sep-2020 11:09                5610
function.mailparse-uudecode-all.php                28-Sep-2020 11:09                6830
function.main.php                                  28-Sep-2020 11:08                3783
function.max.php                                   28-Sep-2020 11:09               13088
function.maxdb-affected-rows.php                   28-Sep-2020 11:08               17211
function.maxdb-autocommit.php                      28-Sep-2020 11:08                7377
function.maxdb-bind-param.php                      28-Sep-2020 11:08                1912
function.maxdb-bind-result.php                     28-Sep-2020 11:08                1923
function.maxdb-change-user.php                     28-Sep-2020 11:08               13091
function.maxdb-character-set-name.php              28-Sep-2020 11:08                8340
function.maxdb-client-encoding.php                 28-Sep-2020 11:08                1979
function.maxdb-close-long-data.php                 28-Sep-2020 11:08                2072
function.maxdb-close.php                           28-Sep-2020 11:08                3352
function.maxdb-commit.php                          28-Sep-2020 11:08               11389
function.maxdb-connect-errno.php                   28-Sep-2020 11:08                5253
function.maxdb-connect-error.php                   28-Sep-2020 11:08                5515
function.maxdb-connect.php                         28-Sep-2020 11:08                9446
function.maxdb-data-seek.php                       28-Sep-2020 11:08               12074
function.maxdb-debug.php                           28-Sep-2020 11:08                5037
function.maxdb-disable-reads-from-master.php       28-Sep-2020 11:08                2436
function.maxdb-disable-rpl-parse.php               28-Sep-2020 11:08                1933
function.maxdb-dump-debug-info.php                 28-Sep-2020 11:08                1927
function.maxdb-embedded-connect.php                28-Sep-2020 11:08                1958
function.maxdb-enable-reads-from-master.php        28-Sep-2020 11:08                1973
function.maxdb-enable-rpl-parse.php                28-Sep-2020 11:08                1903
function.maxdb-errno.php                           28-Sep-2020 11:08                8625
function.maxdb-error.php                           28-Sep-2020 11:08                8896
function.maxdb-escape-string.php                   28-Sep-2020 11:08                1689
function.maxdb-execute.php                         28-Sep-2020 11:08                1889
function.maxdb-fetch-array.php                     28-Sep-2020 11:08               17421
function.maxdb-fetch-assoc.php                     28-Sep-2020 11:08               12427
function.maxdb-fetch-field-direct.php              28-Sep-2020 11:08               14937
function.maxdb-fetch-field.php                     28-Sep-2020 11:08               15183
function.maxdb-fetch-fields.php                    28-Sep-2020 11:08               15223
function.maxdb-fetch-lengths.php                   28-Sep-2020 11:08               11205
function.maxdb-fetch-object.php                    28-Sep-2020 11:08               11973
function.maxdb-fetch-row.php                       28-Sep-2020 11:08               12090
function.maxdb-fetch.php                           28-Sep-2020 11:08                1861
function.maxdb-field-count.php                     28-Sep-2020 11:08               11016
function.maxdb-field-seek.php                      28-Sep-2020 11:08               13958
function.maxdb-field-tell.php                      28-Sep-2020 11:08               15208
function.maxdb-free-result.php                     28-Sep-2020 11:08                4242
function.maxdb-get-client-info.php                 28-Sep-2020 11:08                4187
function.maxdb-get-client-version.php              28-Sep-2020 11:08                4344
function.maxdb-get-host-info.php                   28-Sep-2020 11:08                7450
function.maxdb-get-metadata.php                    28-Sep-2020 11:08                1957
function.maxdb-get-proto-info.php                  28-Sep-2020 11:08                7420
function.maxdb-get-server-info.php                 28-Sep-2020 11:08                7854
function.maxdb-get-server-version.php              28-Sep-2020 11:08                8075
function.maxdb-info.php                            28-Sep-2020 11:08               10213
function.maxdb-init.php                            28-Sep-2020 11:08                3454
function.maxdb-insert-id.php                       28-Sep-2020 11:08               11918
function.maxdb-kill.php                            28-Sep-2020 11:08                9792
function.maxdb-master-query.php                    28-Sep-2020 11:08                2008
function.maxdb-more-results.php                    28-Sep-2020 11:08                3580
function.maxdb-multi-query.php                     28-Sep-2020 11:08               13794
function.maxdb-next-result.php                     28-Sep-2020 11:08                3198
function.maxdb-num-fields.php                      28-Sep-2020 11:08                9333
function.maxdb-num-rows.php                        28-Sep-2020 11:08               10418
function.maxdb-options.php                         28-Sep-2020 11:08                6884
function.maxdb-param-count.php                     28-Sep-2020 11:08                1903
function.maxdb-ping.php                            28-Sep-2020 11:08                8291
function.maxdb-prepare.php                         28-Sep-2020 11:08               15349
function.maxdb-query.php                           28-Sep-2020 11:08               13412
function.maxdb-real-connect.php                    28-Sep-2020 11:08               12580
function.maxdb-real-escape-string.php              28-Sep-2020 11:08               12618
function.maxdb-real-query.php                      28-Sep-2020 11:08                3868
function.maxdb-report.php                          28-Sep-2020 11:08                5114
function.maxdb-rollback.php                        28-Sep-2020 11:08               16526
function.maxdb-rpl-parse-enabled.php               28-Sep-2020 11:08                1898
function.maxdb-rpl-probe.php                       28-Sep-2020 11:08                1851
function.maxdb-rpl-query-type.php                  28-Sep-2020 11:08                2282
function.maxdb-select-db.php                       28-Sep-2020 11:08               13760
function.maxdb-send-long-data.php                  28-Sep-2020 11:08                1955
function.maxdb-send-query.php                      28-Sep-2020 11:08                2434
function.maxdb-server-end.php                      28-Sep-2020 11:08                1822
function.maxdb-server-init.php                     28-Sep-2020 11:08                1966
function.maxdb-set-opt.php                         28-Sep-2020 11:08                1623
function.maxdb-sqlstate.php                        28-Sep-2020 11:08                8843
function.maxdb-ssl-set.php                         28-Sep-2020 11:08                3269
function.maxdb-stat.php                            28-Sep-2020 11:08                7063
function.maxdb-stmt-affected-rows.php              28-Sep-2020 11:08               12789
function.maxdb-stmt-bind-param.php                 28-Sep-2020 11:08               38228
function.maxdb-stmt-bind-result.php                28-Sep-2020 11:08               14765
function.maxdb-stmt-close-long-data.php            28-Sep-2020 11:08                3848
function.maxdb-stmt-close.php                      28-Sep-2020 11:08                3123
function.maxdb-stmt-data-seek.php                  28-Sep-2020 11:08               13504
function.maxdb-stmt-errno.php                      28-Sep-2020 11:08               12567
function.maxdb-stmt-error.php                      28-Sep-2020 11:08               12336
function.maxdb-stmt-execute.php                    28-Sep-2020 11:08               19528
function.maxdb-stmt-fetch.php                      28-Sep-2020 11:08               13366
function.maxdb-stmt-free-result.php                28-Sep-2020 11:08                3248
function.maxdb-stmt-init.php                       28-Sep-2020 11:08                3237
function.maxdb-stmt-num-rows.php                   28-Sep-2020 11:08               10843
function.maxdb-stmt-param-count.php                28-Sep-2020 11:08                9157
function.maxdb-stmt-prepare.php                    28-Sep-2020 11:08               16068
function.maxdb-stmt-reset.php                      28-Sep-2020 11:08                2277
function.maxdb-stmt-result-metadata.php            28-Sep-2020 11:08               14256
function.maxdb-stmt-send-long-data.php             28-Sep-2020 11:08                4540
function.maxdb-stmt-sqlstate.php                   28-Sep-2020 11:08               12521
function.maxdb-stmt-store-result.php               28-Sep-2020 11:08               11721
function.maxdb-store-result.php                    28-Sep-2020 11:08                3288
function.maxdb-thread-id.php                       28-Sep-2020 11:08               10282
function.maxdb-thread-safe.php                     28-Sep-2020 11:08                2087
function.maxdb-use-result.php                      28-Sep-2020 11:08               12986
function.maxdb-warning-count.php                   28-Sep-2020 11:08                9854
function.mb-check-encoding.php                     28-Sep-2020 11:09                4117
function.mb-chr.php                                28-Sep-2020 11:09                3115
function.mb-convert-case.php                       28-Sep-2020 11:09               11240
function.mb-convert-encoding.php                   28-Sep-2020 11:09                8338
function.mb-convert-kana.php                       28-Sep-2020 11:09                8669
function.mb-convert-variables.php                  28-Sep-2020 11:09                6214
function.mb-decode-mimeheader.php                  28-Sep-2020 11:09                3073
function.mb-decode-numericentity.php               28-Sep-2020 11:09               35934
function.mb-detect-encoding.php                    28-Sep-2020 11:09                6943
function.mb-detect-order.php                       28-Sep-2020 11:09                8124
function.mb-encode-mimeheader.php                  28-Sep-2020 11:09                8162
function.mb-encode-numericentity.php               28-Sep-2020 11:09               12699
function.mb-encoding-aliases.php                   28-Sep-2020 11:09                5573
function.mb-ereg-match.php                         28-Sep-2020 11:09                4359
function.mb-ereg-replace-callback.php              28-Sep-2020 11:09               11968
function.mb-ereg-replace.php                       28-Sep-2020 11:09                5916
function.mb-ereg-search-getpos.php                 28-Sep-2020 11:09                3797
function.mb-ereg-search-getregs.php                28-Sep-2020 11:09                4107
function.mb-ereg-search-init.php                   28-Sep-2020 11:09                4832
function.mb-ereg-search-pos.php                    28-Sep-2020 11:09                4669
function.mb-ereg-search-regs.php                   28-Sep-2020 11:09                4419
function.mb-ereg-search-setpos.php                 28-Sep-2020 11:09                4297
function.mb-ereg-search.php                        28-Sep-2020 11:09                4434
function.mb-ereg.php                               28-Sep-2020 11:09                5801
function.mb-eregi-replace.php                      28-Sep-2020 11:09                5792
function.mb-eregi.php                              28-Sep-2020 11:09                5844
function.mb-get-info.php                           28-Sep-2020 11:09                3915
function.mb-http-input.php                         28-Sep-2020 11:09                3748
function.mb-http-output.php                        28-Sep-2020 11:09                4063
function.mb-internal-encoding.php                  28-Sep-2020 11:09                5308
function.mb-language.php                           28-Sep-2020 11:09                5640
function.mb-list-encodings.php                     28-Sep-2020 11:09                4611
function.mb-ord.php                                28-Sep-2020 11:09                3155
function.mb-output-handler.php                     28-Sep-2020 11:09                5022
function.mb-parse-str.php                          28-Sep-2020 11:09                4379
function.mb-preferred-mime-name.php                28-Sep-2020 11:09                4083
function.mb-regex-encoding.php                     28-Sep-2020 11:09                4080
function.mb-regex-set-options.php                  28-Sep-2020 11:09                5897
function.mb-scrub.php                              28-Sep-2020 11:09                2498
function.mb-send-mail.php                          28-Sep-2020 11:09                9095
function.mb-split.php                              28-Sep-2020 11:09                4405
function.mb-str-split.php                          28-Sep-2020 11:09                4330
function.mb-strcut.php                             28-Sep-2020 11:09                6313
function.mb-strimwidth.php                         28-Sep-2020 11:09                6465
function.mb-stripos.php                            28-Sep-2020 11:09                5496
function.mb-stristr.php                            28-Sep-2020 11:09                5306
function.mb-strlen.php                             28-Sep-2020 11:09                4258
function.mb-strpos.php                             28-Sep-2020 11:09                5521
function.mb-strrchr.php                            28-Sep-2020 11:09                5083
function.mb-strrichr.php                           28-Sep-2020 11:09                5120
function.mb-strripos.php                           28-Sep-2020 11:09                5119
function.mb-strrpos.php                            28-Sep-2020 11:09                5908
function.mb-strstr.php                             28-Sep-2020 11:09                5113
function.mb-strtolower.php                         28-Sep-2020 11:09                7021
function.mb-strtoupper.php                         28-Sep-2020 11:09                7046
function.mb-strwidth.php                           28-Sep-2020 11:09                6816
function.mb-substitute-character.php               28-Sep-2020 11:09                6079
function.mb-substr-count.php                       28-Sep-2020 11:09                5281
function.mb-substr.php                             28-Sep-2020 11:09                5305
function.mcrypt-cbc.php                            28-Sep-2020 11:08                3707
function.mcrypt-cfb.php                            28-Sep-2020 11:08                3753
function.mcrypt-create-iv.php                      28-Sep-2020 11:08                6516
function.mcrypt-decrypt.php                        28-Sep-2020 11:08                5998
function.mcrypt-ecb.php                            28-Sep-2020 11:08                3696
function.mcrypt-enc-get-algorithms-name.php        28-Sep-2020 11:08                5192
function.mcrypt-enc-get-block-size.php             28-Sep-2020 11:08                2816
function.mcrypt-enc-get-iv-size.php                28-Sep-2020 11:08                2944
function.mcrypt-enc-get-key-size.php               28-Sep-2020 11:08                2822
function.mcrypt-enc-get-modes-name.php             28-Sep-2020 11:08                5127
function.mcrypt-enc-get-supported-key-sizes.php    28-Sep-2020 11:08                4877
function.mcrypt-enc-is-block-algorithm-mode.php    28-Sep-2020 11:08                3174
function.mcrypt-enc-is-block-algorithm.php         28-Sep-2020 11:08                3003
function.mcrypt-enc-is-block-mode.php              28-Sep-2020 11:08                3012
function.mcrypt-enc-self-test.php                  28-Sep-2020 11:08                2915
function.mcrypt-encrypt.php                        28-Sep-2020 11:08               16363
function.mcrypt-generic-deinit.php                 28-Sep-2020 11:08                3785
function.mcrypt-generic-end.php                    28-Sep-2020 11:08                3118
function.mcrypt-generic-init.php                   28-Sep-2020 11:08                4902
function.mcrypt-generic.php                        28-Sep-2020 11:08                5683
function.mcrypt-get-block-size.php                 28-Sep-2020 11:08                6154
function.mcrypt-get-cipher-name.php                28-Sep-2020 11:08                4731
function.mcrypt-get-iv-size.php                    28-Sep-2020 11:08                6351
function.mcrypt-get-key-size.php                   28-Sep-2020 11:08                6319
function.mcrypt-list-algorithms.php                28-Sep-2020 11:08                4607
function.mcrypt-list-modes.php                     28-Sep-2020 11:08                4624
function.mcrypt-module-close.php                   28-Sep-2020 11:08                3210
function.mcrypt-module-get-algo-block-size.php     28-Sep-2020 11:08                3241
function.mcrypt-module-get-algo-key-size.php       28-Sep-2020 11:08                3310
function.mcrypt-module-get-supported-key-sizes.php 28-Sep-2020 11:08                4389
function.mcrypt-module-is-block-algorithm-mode.php 28-Sep-2020 11:08                3817
function.mcrypt-module-is-block-algorithm.php      28-Sep-2020 11:08                3569
function.mcrypt-module-is-block-mode.php           28-Sep-2020 11:08                3868
function.mcrypt-module-open.php                    28-Sep-2020 11:08               14686
function.mcrypt-module-self-test.php               28-Sep-2020 11:08                4713
function.mcrypt-ofb.php                            28-Sep-2020 11:08                3780
function.md5-file.php                              28-Sep-2020 11:09                5647
function.md5.php                                   28-Sep-2020 11:09                5960
function.mdecrypt-generic.php                      28-Sep-2020 11:08               11562
function.memcache-debug.php                        28-Sep-2020 11:09                3122
function.memory-get-peak-usage.php                 28-Sep-2020 11:08                3178
function.memory-get-usage.php                      28-Sep-2020 11:08                5406
function.metaphone.php                             28-Sep-2020 11:09                6139
function.method-exists.php                         28-Sep-2020 11:09                6380
function.mhash-count.php                           28-Sep-2020 11:08                3845
function.mhash-get-block-size.php                  28-Sep-2020 11:08                3370
function.mhash-get-hash-name.php                   28-Sep-2020 11:08                3312
function.mhash-keygen-s2k.php                      28-Sep-2020 11:08                4187
function.mhash.php                                 28-Sep-2020 11:08                3298
function.microtime.php                             28-Sep-2020 11:09               10911
function.mime-content-type.php                     28-Sep-2020 11:09                4604
function.min.php                                   28-Sep-2020 11:09               13689
function.mkdir.php                                 28-Sep-2020 11:09                8045
function.mktime.php                                28-Sep-2020 11:09               22210
function.money-format.php                          28-Sep-2020 11:09               19460
function.mongodb.bson-fromjson.php                 28-Sep-2020 11:08                5804
function.mongodb.bson-fromphp.php                  28-Sep-2020 11:08                5842
function.mongodb.bson-tocanonicalextendedjson.php  28-Sep-2020 11:08               16148
function.mongodb.bson-tojson.php                   28-Sep-2020 11:08               17611
function.mongodb.bson-tophp.php                    28-Sep-2020 11:08                8859
function.mongodb.bson-torelaxedextendedjson.php    28-Sep-2020 11:08               15849
function.mongodb.driver.monitoring.addsubscribe..> 28-Sep-2020 11:08                4492
function.mongodb.driver.monitoring.removesubscr..> 28-Sep-2020 11:08                4569
function.move-uploaded-file.php                    28-Sep-2020 11:09                8857
function.mqseries-back.php                         28-Sep-2020 11:09                6405
function.mqseries-begin.php                        28-Sep-2020 11:09                7768
function.mqseries-close.php                        28-Sep-2020 11:09                6346
function.mqseries-cmit.php                         28-Sep-2020 11:09                6351
function.mqseries-conn.php                         28-Sep-2020 11:09                5758
function.mqseries-connx.php                        28-Sep-2020 11:09               14168
function.mqseries-disc.php                         28-Sep-2020 11:09                5595
function.mqseries-get.php                          28-Sep-2020 11:09               12858
function.mqseries-inq.php                          28-Sep-2020 11:09                8874
function.mqseries-open.php                         28-Sep-2020 11:09                7436
function.mqseries-put.php                          28-Sep-2020 11:09               13881
function.mqseries-put1.php                         28-Sep-2020 11:09                5672
function.mqseries-set.php                          28-Sep-2020 11:09                5341
function.mqseries-strerror.php                     28-Sep-2020 11:09                4243
function.msg-get-queue.php                         28-Sep-2020 11:09                4465
function.msg-queue-exists.php                      28-Sep-2020 11:09                3181
function.msg-receive.php                           28-Sep-2020 11:09                9681
function.msg-remove-queue.php                      28-Sep-2020 11:09                3645
function.msg-send.php                              28-Sep-2020 11:09                7463
function.msg-set-queue.php                         28-Sep-2020 11:09                4270
function.msg-stat-queue.php                        28-Sep-2020 11:09                5853
function.msql-affected-rows.php                    28-Sep-2020 11:09                3199
function.msql-close.php                            28-Sep-2020 11:09                3936
function.msql-connect.php                          28-Sep-2020 11:09                4222
function.msql-create-db.php                        28-Sep-2020 11:09                3513
function.msql-createdb.php                         28-Sep-2020 11:09                1623
function.msql-data-seek.php                        28-Sep-2020 11:09                4094
function.msql-db-query.php                         28-Sep-2020 11:09                3737
function.msql-dbname.php                           28-Sep-2020 11:09                1594
function.msql-drop-db.php                          28-Sep-2020 11:09                3457
function.msql-error.php                            28-Sep-2020 11:09                2101
function.msql-fetch-array.php                      28-Sep-2020 11:09                8798
function.msql-fetch-field.php                      28-Sep-2020 11:09                4390
function.msql-fetch-object.php                     28-Sep-2020 11:09                8459
function.msql-fetch-row.php                        28-Sep-2020 11:09                8074
function.msql-field-flags.php                      28-Sep-2020 11:09                3163
function.msql-field-len.php                        28-Sep-2020 11:09                2983
function.msql-field-name.php                       28-Sep-2020 11:09                3484
function.msql-field-seek.php                       28-Sep-2020 11:09                3520
function.msql-field-table.php                      28-Sep-2020 11:09                2964
function.msql-field-type.php                       28-Sep-2020 11:09                3211
function.msql-fieldflags.php                       28-Sep-2020 11:09                1640
function.msql-fieldlen.php                         28-Sep-2020 11:09                1622
function.msql-fieldname.php                        28-Sep-2020 11:09                1630
function.msql-fieldtable.php                       28-Sep-2020 11:09                1640
function.msql-fieldtype.php                        28-Sep-2020 11:09                1636
function.msql-free-result.php                      28-Sep-2020 11:09                2943
function.msql-list-dbs.php                         28-Sep-2020 11:09                3819
function.msql-list-fields.php                      28-Sep-2020 11:09                4237
function.msql-list-tables.php                      28-Sep-2020 11:09                4001
function.msql-num-fields.php                       28-Sep-2020 11:09                3386
function.msql-num-rows.php                         28-Sep-2020 11:09                2988
function.msql-numfields.php                        28-Sep-2020 11:09                1626
function.msql-numrows.php                          28-Sep-2020 11:09                1610
function.msql-pconnect.php                         28-Sep-2020 11:09                4505
function.msql-query.php                            28-Sep-2020 11:09                6698
function.msql-regcase.php                          28-Sep-2020 11:09                1588
function.msql-result.php                           28-Sep-2020 11:09                4590
function.msql-select-db.php                        28-Sep-2020 11:09                4173
function.msql-tablename.php                        28-Sep-2020 11:09                1594
function.msql.php                                  28-Sep-2020 11:09                1543
function.mt-getrandmax.php                         28-Sep-2020 11:09                5296
function.mt-rand.php                               28-Sep-2020 11:09               10624
function.mt-srand.php                              28-Sep-2020 11:09                8486
function.mysql-affected-rows.php                   28-Sep-2020 11:09               12857
function.mysql-client-encoding.php                 28-Sep-2020 11:09                6295
function.mysql-close.php                           28-Sep-2020 11:09                7432
function.mysql-connect.php                         28-Sep-2020 11:09               17872
function.mysql-create-db.php                       28-Sep-2020 11:09                8663
function.mysql-data-seek.php                       28-Sep-2020 11:09               12540
function.mysql-db-name.php                         28-Sep-2020 11:09                8471
function.mysql-db-query.php                        28-Sep-2020 11:09               10824
function.mysql-drop-db.php                         28-Sep-2020 11:09                7966
function.mysql-errno.php                           28-Sep-2020 11:09                8495
function.mysql-error.php                           28-Sep-2020 11:09                8448
function.mysql-escape-string.php                   28-Sep-2020 11:09                7829
function.mysql-fetch-array.php                     28-Sep-2020 11:09               15903
function.mysql-fetch-assoc.php                     28-Sep-2020 11:09               12529
function.mysql-fetch-field.php                     28-Sep-2020 11:09               13962
function.mysql-fetch-lengths.php                   28-Sep-2020 11:09                7694
function.mysql-fetch-object.php                    28-Sep-2020 11:09               11804
function.mysql-fetch-row.php                       28-Sep-2020 11:09                7771
function.mysql-field-flags.php                     28-Sep-2020 11:09                8574
function.mysql-field-len.php                       28-Sep-2020 11:09                7003
function.mysql-field-name.php                      28-Sep-2020 11:09                9260
function.mysql-field-seek.php                      28-Sep-2020 11:09                4925
function.mysql-field-table.php                     28-Sep-2020 11:09                7844
function.mysql-field-type.php                      28-Sep-2020 11:09               12095
function.mysql-free-result.php                     28-Sep-2020 11:09                7983
function.mysql-get-client-info.php                 28-Sep-2020 11:09                4897
function.mysql-get-host-info.php                   28-Sep-2020 11:09                6866
function.mysql-get-proto-info.php                  28-Sep-2020 11:09                6548
function.mysql-get-server-info.php                 28-Sep-2020 11:09                6900
function.mysql-info.php                            28-Sep-2020 11:09                6327
function.mysql-insert-id.php                       28-Sep-2020 11:09                8631
function.mysql-list-dbs.php                        28-Sep-2020 11:09                9002
function.mysql-list-fields.php                     28-Sep-2020 11:09                9074
function.mysql-list-processes.php                  28-Sep-2020 11:09                7589
function.mysql-list-tables.php                     28-Sep-2020 11:09                9827
function.mysql-num-fields.php                      28-Sep-2020 11:09                6677
function.mysql-num-rows.php                        28-Sep-2020 11:09                8174
function.mysql-pconnect.php                        28-Sep-2020 11:09                8587
function.mysql-ping.php                            28-Sep-2020 11:09                8555
function.mysql-query.php                           28-Sep-2020 11:09               15090
function.mysql-real-escape-string.php              28-Sep-2020 11:09               17212
function.mysql-result.php                          28-Sep-2020 11:09                9945
function.mysql-select-db.php                       28-Sep-2020 11:09                7821
function.mysql-set-charset.php                     28-Sep-2020 11:09                5828
function.mysql-stat.php                            28-Sep-2020 11:09                9358
function.mysql-tablename.php                       28-Sep-2020 11:09                8626
function.mysql-thread-id.php                       28-Sep-2020 11:09                6549
function.mysql-unbuffered-query.php                28-Sep-2020 11:09                7153
function.mysql-xdevapi-expression.php              28-Sep-2020 11:09                4714
function.mysql-xdevapi-getsession.php              28-Sep-2020 11:09               13057
function.mysqli-bind-param.php                     28-Sep-2020 11:09                2392
function.mysqli-bind-result.php                    28-Sep-2020 11:09                2435
function.mysqli-client-encoding.php                28-Sep-2020 11:09                2476
function.mysqli-connect.php                        28-Sep-2020 11:09                5336
function.mysqli-disable-reads-from-master.php      28-Sep-2020 11:09                2747
function.mysqli-disable-rpl-parse.php              28-Sep-2020 11:09                2251
function.mysqli-enable-reads-from-master.php       28-Sep-2020 11:09                2274
function.mysqli-enable-rpl-parse.php               28-Sep-2020 11:09                2218
function.mysqli-escape-string.php                  28-Sep-2020 11:09                1722
function.mysqli-execute.php                        28-Sep-2020 11:09                2363
function.mysqli-fetch.php                          28-Sep-2020 11:09                2305
function.mysqli-get-cache-stats.php                28-Sep-2020 11:09                3181
function.mysqli-get-client-stats.php               28-Sep-2020 11:09                8168
function.mysqli-get-links-stats.php                28-Sep-2020 11:09                3303
function.mysqli-get-metadata.php                   28-Sep-2020 11:09                2413
function.mysqli-master-query.php                   28-Sep-2020 11:09                2327
function.mysqli-param-count.php                    28-Sep-2020 11:09                2376
function.mysqli-report.php                         28-Sep-2020 11:09                1628
function.mysqli-rpl-parse-enabled.php              28-Sep-2020 11:09                2193
function.mysqli-rpl-probe.php                      28-Sep-2020 11:09                2150
function.mysqli-send-long-data.php                 28-Sep-2020 11:09                2370
function.mysqli-set-opt.php                        28-Sep-2020 11:09                1740
function.mysqli-slave-query.php                    28-Sep-2020 11:09                2288
function.mysqlnd-memcache-get-config.php           28-Sep-2020 11:09               11908
function.mysqlnd-memcache-set.php                  28-Sep-2020 11:09               10847
function.mysqlnd-ms-dump-servers.php               28-Sep-2020 11:09                9216
function.mysqlnd-ms-fabric-select-global.php       28-Sep-2020 11:09                3941
function.mysqlnd-ms-fabric-select-shard.php        28-Sep-2020 11:09                4242
function.mysqlnd-ms-get-last-gtid.php              28-Sep-2020 11:09                9571
function.mysqlnd-ms-get-last-used-connection.php   28-Sep-2020 11:09               10086
function.mysqlnd-ms-get-stats.php                  28-Sep-2020 11:09               31573
function.mysqlnd-ms-match-wild.php                 28-Sep-2020 11:09                6955
function.mysqlnd-ms-query-is-select.php            28-Sep-2020 11:09                9091
function.mysqlnd-ms-set-qos.php                    28-Sep-2020 11:09               15529
function.mysqlnd-ms-set-user-pick-server.php       28-Sep-2020 11:09               19066
function.mysqlnd-ms-xa-begin.php                   28-Sep-2020 11:09                8536
function.mysqlnd-ms-xa-commit.php                  28-Sep-2020 11:09                4589
function.mysqlnd-ms-xa-gc.php                      28-Sep-2020 11:09                6356
function.mysqlnd-ms-xa-rollback.php                28-Sep-2020 11:09                4336
function.mysqlnd-qc-clear-cache.php                28-Sep-2020 11:09                2975
function.mysqlnd-qc-get-available-handlers.php     28-Sep-2020 11:09                4878
function.mysqlnd-qc-get-cache-info.php             28-Sep-2020 11:09               20058
function.mysqlnd-qc-get-core-stats.php             28-Sep-2020 11:09               19350
function.mysqlnd-qc-get-normalized-query-trace-..> 28-Sep-2020 11:09               15506
function.mysqlnd-qc-get-query-trace-log.php        28-Sep-2020 11:09               16554
function.mysqlnd-qc-set-cache-condition.php        28-Sep-2020 11:09                9197
function.mysqlnd-qc-set-is-select.php              28-Sep-2020 11:09               11863
function.mysqlnd-qc-set-storage-handler.php        28-Sep-2020 11:09                6411
function.mysqlnd-qc-set-user-handlers.php          28-Sep-2020 11:09                5808
function.mysqlnd-uh-convert-to-mysqlnd.php         28-Sep-2020 11:09                8088
function.mysqlnd-uh-set-connection-proxy.php       28-Sep-2020 11:09               11137
function.mysqlnd-uh-set-statement-proxy.php        28-Sep-2020 11:09                4524
function.natcasesort.php                           28-Sep-2020 11:09                7048
function.natsort.php                               28-Sep-2020 11:09               10925
function.ncurses-addch.php                         28-Sep-2020 11:08                2547
function.ncurses-addchnstr.php                     28-Sep-2020 11:08                2813
function.ncurses-addchstr.php                      28-Sep-2020 11:08                2571
function.ncurses-addnstr.php                       28-Sep-2020 11:08                2788
function.ncurses-addstr.php                        28-Sep-2020 11:08                2575
function.ncurses-assume-default-colors.php         28-Sep-2020 11:08                2880
function.ncurses-attroff.php                       28-Sep-2020 11:08                2587
function.ncurses-attron.php                        28-Sep-2020 11:08                2552
function.ncurses-attrset.php                       28-Sep-2020 11:08                2552
function.ncurses-baudrate.php                      28-Sep-2020 11:08                2189
function.ncurses-beep.php                          28-Sep-2020 11:08                2502
function.ncurses-bkgd.php                          28-Sep-2020 11:08                2542
function.ncurses-bkgdset.php                       28-Sep-2020 11:08                2578
function.ncurses-border.php                        28-Sep-2020 11:08                4827
function.ncurses-bottom-panel.php                  28-Sep-2020 11:08                2263
function.ncurses-can-change-color.php              28-Sep-2020 11:08                3471
function.ncurses-cbreak.php                        28-Sep-2020 11:08                2865
function.ncurses-clear.php                         28-Sep-2020 11:08                3031
function.ncurses-clrtobot.php                      28-Sep-2020 11:08                3102
function.ncurses-clrtoeol.php                      28-Sep-2020 11:08                3109
function.ncurses-color-content.php                 28-Sep-2020 11:08                4534
function.ncurses-color-set.php                     28-Sep-2020 11:08                6011
function.ncurses-curs-set.php                      28-Sep-2020 11:08                2573
function.ncurses-def-prog-mode.php                 28-Sep-2020 11:08                2964
function.ncurses-def-shell-mode.php                28-Sep-2020 11:08                2981
function.ncurses-define-key.php                    28-Sep-2020 11:08                2824
function.ncurses-del-panel.php                     28-Sep-2020 11:08                2265
function.ncurses-delay-output.php                  28-Sep-2020 11:08                2626
function.ncurses-delch.php                         28-Sep-2020 11:08                2961
function.ncurses-deleteln.php                      28-Sep-2020 11:08                2905
function.ncurses-delwin.php                        28-Sep-2020 11:08                2550
function.ncurses-doupdate.php                      28-Sep-2020 11:08                2486
function.ncurses-echo.php                          28-Sep-2020 11:08                2845
function.ncurses-echochar.php                      28-Sep-2020 11:08                2566
function.ncurses-end.php                           28-Sep-2020 11:08                2169
function.ncurses-erase.php                         28-Sep-2020 11:08                3075
function.ncurses-erasechar.php                     28-Sep-2020 11:08                2663
function.ncurses-filter.php                        28-Sep-2020 11:08                2225
function.ncurses-flash.php                         28-Sep-2020 11:08                2720
function.ncurses-flushinp.php                      28-Sep-2020 11:08                2385
function.ncurses-getch.php                         28-Sep-2020 11:08                2180
function.ncurses-getmaxyx.php                      28-Sep-2020 11:08                3457
function.ncurses-getmouse.php                      28-Sep-2020 11:08                6497
function.ncurses-getyx.php                         28-Sep-2020 11:08                2689
function.ncurses-halfdelay.php                     28-Sep-2020 11:08                2573
function.ncurses-has-colors.php                    28-Sep-2020 11:08                5509
function.ncurses-has-ic.php                        28-Sep-2020 11:08                2793
function.ncurses-has-il.php                        28-Sep-2020 11:08                2797
function.ncurses-has-key.php                       28-Sep-2020 11:08                2588
function.ncurses-hide-panel.php                    28-Sep-2020 11:08                2227
function.ncurses-hline.php                         28-Sep-2020 11:08                2830
function.ncurses-inch.php                          28-Sep-2020 11:08                2276
function.ncurses-init-color.php                    28-Sep-2020 11:08                4664
function.ncurses-init-pair.php                     28-Sep-2020 11:08                7761
function.ncurses-init.php                          28-Sep-2020 11:08                2798
function.ncurses-insch.php                         28-Sep-2020 11:08                2587
function.ncurses-insdelln.php                      28-Sep-2020 11:08                2616
function.ncurses-insertln.php                      28-Sep-2020 11:08                2115
function.ncurses-insstr.php                        28-Sep-2020 11:08                2574
function.ncurses-instr.php                         28-Sep-2020 11:08                2782
function.ncurses-isendwin.php                      28-Sep-2020 11:08                3192
function.ncurses-keyok.php                         28-Sep-2020 11:08                2767
function.ncurses-keypad.php                        28-Sep-2020 11:08                2394
function.ncurses-killchar.php                      28-Sep-2020 11:08                2670
function.ncurses-longname.php                      28-Sep-2020 11:08                2746
function.ncurses-meta.php                          28-Sep-2020 11:08                2414
function.ncurses-mouse-trafo.php                   28-Sep-2020 11:08                2680
function.ncurses-mouseinterval.php                 28-Sep-2020 11:08                2632
function.ncurses-mousemask.php                     28-Sep-2020 11:08                8203
function.ncurses-move-panel.php                    28-Sep-2020 11:08                2703
function.ncurses-move.php                          28-Sep-2020 11:08                2735
function.ncurses-mvaddch.php                       28-Sep-2020 11:08                2992
function.ncurses-mvaddchnstr.php                   28-Sep-2020 11:08                3271
function.ncurses-mvaddchstr.php                    28-Sep-2020 11:08                3029
function.ncurses-mvaddnstr.php                     28-Sep-2020 11:08                3246
function.ncurses-mvaddstr.php                      28-Sep-2020 11:08                2990
function.ncurses-mvcur.php                         28-Sep-2020 11:08                3210
function.ncurses-mvdelch.php                       28-Sep-2020 11:08                2788
function.ncurses-mvgetch.php                       28-Sep-2020 11:08                2780
function.ncurses-mvhline.php                       28-Sep-2020 11:08                3281
function.ncurses-mvinch.php                        28-Sep-2020 11:08                2783
function.ncurses-mvvline.php                       28-Sep-2020 11:08                3283
function.ncurses-mvwaddstr.php                     28-Sep-2020 11:08                3241
function.ncurses-napms.php                         28-Sep-2020 11:08                2533
function.ncurses-new-panel.php                     28-Sep-2020 11:08                2223
function.ncurses-newpad.php                        28-Sep-2020 11:08                2401
function.ncurses-newwin.php                        28-Sep-2020 11:08                3656
function.ncurses-nl.php                            28-Sep-2020 11:08                2175
function.ncurses-nocbreak.php                      28-Sep-2020 11:08                3024
function.ncurses-noecho.php                        28-Sep-2020 11:08                2887
function.ncurses-nonl.php                          28-Sep-2020 11:08                2198
function.ncurses-noqiflush.php                     28-Sep-2020 11:08                2228
function.ncurses-noraw.php                         28-Sep-2020 11:08                3367
function.ncurses-pair-content.php                  28-Sep-2020 11:08                4740
function.ncurses-panel-above.php                   28-Sep-2020 11:08                2471
function.ncurses-panel-below.php                   28-Sep-2020 11:08                2465
function.ncurses-panel-window.php                  28-Sep-2020 11:08                2262
function.ncurses-pnoutrefresh.php                  28-Sep-2020 11:08                3637
function.ncurses-prefresh.php                      28-Sep-2020 11:08                3597
function.ncurses-putp.php                          28-Sep-2020 11:08                2554
function.ncurses-qiflush.php                       28-Sep-2020 11:08                2204
function.ncurses-raw.php                           28-Sep-2020 11:08                3333
function.ncurses-refresh.php                       28-Sep-2020 11:08                2535
function.ncurses-replace-panel.php                 28-Sep-2020 11:08                2497
function.ncurses-reset-prog-mode.php               28-Sep-2020 11:08                1920
function.ncurses-reset-shell-mode.php              28-Sep-2020 11:08                1915
function.ncurses-resetty.php                       28-Sep-2020 11:08                2806
function.ncurses-savetty.php                       28-Sep-2020 11:08                2802
function.ncurses-scr-dump.php                      28-Sep-2020 11:08                2569
function.ncurses-scr-init.php                      28-Sep-2020 11:08                2582
function.ncurses-scr-restore.php                   28-Sep-2020 11:08                2595
function.ncurses-scr-set.php                       28-Sep-2020 11:08                2563
function.ncurses-scrl.php                          28-Sep-2020 11:08                2571
function.ncurses-show-panel.php                    28-Sep-2020 11:08                2243
function.ncurses-slk-attr.php                      28-Sep-2020 11:08                2299
function.ncurses-slk-attroff.php                   28-Sep-2020 11:08                2622
function.ncurses-slk-attron.php                    28-Sep-2020 11:08                2621
function.ncurses-slk-attrset.php                   28-Sep-2020 11:08                2615
function.ncurses-slk-clear.php                     28-Sep-2020 11:08                2441
function.ncurses-slk-color.php                     28-Sep-2020 11:08                2576
function.ncurses-slk-init.php                      28-Sep-2020 11:08                3533
function.ncurses-slk-noutrefresh.php               28-Sep-2020 11:08                2266
function.ncurses-slk-refresh.php                   28-Sep-2020 11:08                2141
function.ncurses-slk-restore.php                   28-Sep-2020 11:08                2224
function.ncurses-slk-set.php                       28-Sep-2020 11:08                2652
function.ncurses-slk-touch.php                     28-Sep-2020 11:08                2262
function.ncurses-standend.php                      28-Sep-2020 11:08                2214
function.ncurses-standout.php                      28-Sep-2020 11:08                2219
function.ncurses-start-color.php                   28-Sep-2020 11:08                5686
function.ncurses-termattrs.php                     28-Sep-2020 11:08                2250
function.ncurses-termname.php                      28-Sep-2020 11:08                2736
function.ncurses-timeout.php                       28-Sep-2020 11:08                2604
function.ncurses-top-panel.php                     28-Sep-2020 11:08                2224
function.ncurses-typeahead.php                     28-Sep-2020 11:08                2592
function.ncurses-ungetch.php                       28-Sep-2020 11:08                2579
function.ncurses-ungetmouse.php                    28-Sep-2020 11:08                3985
function.ncurses-update-panels.php                 28-Sep-2020 11:08                1974
function.ncurses-use-default-colors.php            28-Sep-2020 11:08                2295
function.ncurses-use-env.php                       28-Sep-2020 11:08                2656
function.ncurses-use-extended-names.php            28-Sep-2020 11:08                2664
function.ncurses-vidattr.php                       28-Sep-2020 11:08                2604
function.ncurses-vline.php                         28-Sep-2020 11:08                2826
function.ncurses-waddch.php                        28-Sep-2020 11:08                2434
function.ncurses-waddstr.php                       28-Sep-2020 11:08                2647
function.ncurses-wattroff.php                      28-Sep-2020 11:08                2428
function.ncurses-wattron.php                       28-Sep-2020 11:08                2423
function.ncurses-wattrset.php                      28-Sep-2020 11:08                2426
function.ncurses-wborder.php                       28-Sep-2020 11:08                5138
function.ncurses-wclear.php                        28-Sep-2020 11:08                2172
function.ncurses-wcolor-set.php                    28-Sep-2020 11:08                2444
function.ncurses-werase.php                        28-Sep-2020 11:08                2178
function.ncurses-wgetch.php                        28-Sep-2020 11:08                2189
function.ncurses-whline.php                        28-Sep-2020 11:08                2723
function.ncurses-wmouse-trafo.php                  28-Sep-2020 11:08                2923
function.ncurses-wmove.php                         28-Sep-2020 11:08                2630
function.ncurses-wnoutrefresh.php                  28-Sep-2020 11:08                2230
function.ncurses-wrefresh.php                      28-Sep-2020 11:08                2585
function.ncurses-wstandend.php                     28-Sep-2020 11:08                2213
function.ncurses-wstandout.php                     28-Sep-2020 11:08                2211
function.ncurses-wvline.php                        28-Sep-2020 11:08                2699
function.next.php                                  28-Sep-2020 11:09                8394
function.ngettext.php                              28-Sep-2020 11:09                5609
function.nl-langinfo.php                           28-Sep-2020 11:09               14268
function.nl2br.php                                 28-Sep-2020 11:09                7444
function.nsapi-request-headers.php                 28-Sep-2020 11:09                4203
function.nsapi-response-headers.php                28-Sep-2020 11:09                2579
function.nsapi-virtual.php                         28-Sep-2020 11:09                3988
function.number-format.php                         28-Sep-2020 11:09                9747
function.oauth-get-sbs.php                         28-Sep-2020 11:09                2801
function.oauth-urlencode.php                       28-Sep-2020 11:09                2411
function.ob-clean.php                              28-Sep-2020 11:08                3697
function.ob-end-clean.php                          28-Sep-2020 11:08                5178
function.ob-end-flush.php                          28-Sep-2020 11:08                6098
function.ob-flush.php                              28-Sep-2020 11:08                3518
function.ob-get-clean.php                          28-Sep-2020 11:08                5010
function.ob-get-contents.php                       28-Sep-2020 11:08                4551
function.ob-get-flush.php                          28-Sep-2020 11:08                5388
function.ob-get-length.php                         28-Sep-2020 11:08                4348
function.ob-get-level.php                          28-Sep-2020 11:08                2764
function.ob-get-status.php                         28-Sep-2020 11:08                6654
function.ob-gzhandler.php                          28-Sep-2020 11:08                5582
function.ob-iconv-handler.php                      28-Sep-2020 11:09                5040
function.ob-implicit-flush.php                     28-Sep-2020 11:08                3673
function.ob-list-handlers.php                      28-Sep-2020 11:08                5655
function.ob-start.php                              28-Sep-2020 11:08               20128
function.ob-tidyhandler.php                        28-Sep-2020 11:09                4119
function.oci-bind-array-by-name.php                28-Sep-2020 11:09               13577
function.oci-bind-by-name.php                      28-Sep-2020 11:09               84452
function.oci-cancel.php                            28-Sep-2020 11:09                2426
function.oci-client-version.php                    28-Sep-2020 11:09                3904
function.oci-close.php                             28-Sep-2020 11:09               20764
function.oci-commit.php                            28-Sep-2020 11:09               11376
function.oci-connect.php                           28-Sep-2020 11:09               37126
function.oci-define-by-name.php                    28-Sep-2020 11:09               25440
function.oci-error.php                             28-Sep-2020 11:09               11454
function.oci-execute.php                           28-Sep-2020 11:09               21885
function.oci-fetch-all.php                         28-Sep-2020 11:09               27565
function.oci-fetch-array.php                       28-Sep-2020 11:09               72870
function.oci-fetch-assoc.php                       28-Sep-2020 11:09                8845
function.oci-fetch-object.php                      28-Sep-2020 11:09               19951
function.oci-fetch-row.php                         28-Sep-2020 11:09                8994
function.oci-fetch.php                             28-Sep-2020 11:09               14307
function.oci-field-is-null.php                     28-Sep-2020 11:09                8439
function.oci-field-name.php                        28-Sep-2020 11:09               10854
function.oci-field-precision.php                   28-Sep-2020 11:09                9499
function.oci-field-scale.php                       28-Sep-2020 11:09                9465
function.oci-field-size.php                        28-Sep-2020 11:09               11570
function.oci-field-type-raw.php                    28-Sep-2020 11:09                8617
function.oci-field-type.php                        28-Sep-2020 11:09               11795
function.oci-free-descriptor.php                   28-Sep-2020 11:09                2810
function.oci-free-statement.php                    28-Sep-2020 11:09                2719
function.oci-get-implicit-resultset.php            28-Sep-2020 11:09               32253
function.oci-internal-debug.php                    28-Sep-2020 11:09                3088
function.oci-lob-copy.php                          28-Sep-2020 11:09                3314
function.oci-lob-is-equal.php                      28-Sep-2020 11:09                2690
function.oci-new-collection.php                    28-Sep-2020 11:09                4014
function.oci-new-connect.php                       28-Sep-2020 11:09               15504
function.oci-new-cursor.php                        28-Sep-2020 11:09                8393
function.oci-new-descriptor.php                    28-Sep-2020 11:09               21132
function.oci-num-fields.php                        28-Sep-2020 11:09                7681
function.oci-num-rows.php                          28-Sep-2020 11:09                8310
function.oci-parse.php                             28-Sep-2020 11:09               13077
function.oci-password-change.php                   28-Sep-2020 11:09               13650
function.oci-pconnect.php                          28-Sep-2020 11:09               13970
function.oci-register-taf-callback.php             28-Sep-2020 11:09                5194
function.oci-result.php                            28-Sep-2020 11:09                9384
function.oci-rollback.php                          28-Sep-2020 11:09               14958
function.oci-server-version.php                    28-Sep-2020 11:09                5056
function.oci-set-action.php                        28-Sep-2020 11:09                8371
function.oci-set-call-timout.php                   28-Sep-2020 11:09                5660
function.oci-set-client-identifier.php             28-Sep-2020 11:09                8090
function.oci-set-client-info.php                   28-Sep-2020 11:09                8293
function.oci-set-db-operation.php                  28-Sep-2020 11:09                7657
function.oci-set-edition.php                       28-Sep-2020 11:09                9725
function.oci-set-module-name.php                   28-Sep-2020 11:09                8478
function.oci-set-prefetch.php                      28-Sep-2020 11:09               22805
function.oci-statement-type.php                    28-Sep-2020 11:09                6899
function.oci-unregister-taf-callback.php           28-Sep-2020 11:09                3330
function.ocibindbyname.php                         28-Sep-2020 11:09                1916
function.ocicancel.php                             28-Sep-2020 11:09                1854
function.ocicloselob.php                           28-Sep-2020 11:09                1863
function.ocicollappend.php                         28-Sep-2020 11:09                1918
function.ocicollassign.php                         28-Sep-2020 11:09                1922
function.ocicollassignelem.php                     28-Sep-2020 11:09                1964
function.ocicollgetelem.php                        28-Sep-2020 11:09                1934
function.ocicollmax.php                            28-Sep-2020 11:09                1890
function.ocicollsize.php                           28-Sep-2020 11:09                1892
function.ocicolltrim.php                           28-Sep-2020 11:09                1902
function.ocicolumnisnull.php                       28-Sep-2020 11:09                1918
function.ocicolumnname.php                         28-Sep-2020 11:09                1912
function.ocicolumnprecision.php                    28-Sep-2020 11:09                1950
function.ocicolumnscale.php                        28-Sep-2020 11:09                1918
function.ocicolumnsize.php                         28-Sep-2020 11:09                1900
function.ocicolumntype.php                         28-Sep-2020 11:09                1904
function.ocicolumntyperaw.php                      28-Sep-2020 11:09                1924
function.ocicommit.php                             28-Sep-2020 11:09                1868
function.ocidefinebyname.php                       28-Sep-2020 11:09                1908
function.ocierror.php                              28-Sep-2020 11:09                1846
function.ociexecute.php                            28-Sep-2020 11:09                1848
function.ocifetch.php                              28-Sep-2020 11:09                1840
function.ocifetchinto.php                          28-Sep-2020 11:09                2603
function.ocifetchstatement.php                     28-Sep-2020 11:09                1924
function.ocifreecollection.php                     28-Sep-2020 11:09                1946
function.ocifreecursor.php                         28-Sep-2020 11:09                1918
function.ocifreedesc.php                           28-Sep-2020 11:09                1868
function.ocifreestatement.php                      28-Sep-2020 11:09                1934
function.ociinternaldebug.php                      28-Sep-2020 11:09                1932
function.ociloadlob.php                            28-Sep-2020 11:09                1854
function.ocilogoff.php                             28-Sep-2020 11:09                1838
function.ocilogon.php                              28-Sep-2020 11:09                1854
function.ocinewcollection.php                      28-Sep-2020 11:09                1932
function.ocinewcursor.php                          28-Sep-2020 11:09                1904
function.ocinewdescriptor.php                      28-Sep-2020 11:09                1922
function.ocinlogon.php                             28-Sep-2020 11:09                1878
function.ocinumcols.php                            28-Sep-2020 11:09                1862
function.ociparse.php                              28-Sep-2020 11:09                1834
function.ociplogon.php                             28-Sep-2020 11:09                1848
function.ociresult.php                             28-Sep-2020 11:09                1846
function.ocirollback.php                           28-Sep-2020 11:09                1866
function.ocirowcount.php                           28-Sep-2020 11:09                1868
function.ocisavelob.php                            28-Sep-2020 11:09                1854
function.ocisavelobfile.php                        28-Sep-2020 11:09                1888
function.ociserverversion.php                      28-Sep-2020 11:09                1936
function.ocisetprefetch.php                        28-Sep-2020 11:09                1924
function.ocistatementtype.php                      28-Sep-2020 11:09                1942
function.ociwritelobtofile.php                     28-Sep-2020 11:09                1926
function.ociwritetemporarylob.php                  28-Sep-2020 11:09                1952
function.octdec.php                                28-Sep-2020 11:09                5932
function.odbc-autocommit.php                       28-Sep-2020 11:08                4241
function.odbc-binmode.php                          28-Sep-2020 11:08                6153
function.odbc-close-all.php                        28-Sep-2020 11:08                2554
function.odbc-close.php                            28-Sep-2020 11:08                2784
function.odbc-columnprivileges.php                 28-Sep-2020 11:08                4787
function.odbc-columns.php                          28-Sep-2020 11:08                9813
function.odbc-commit.php                           28-Sep-2020 11:08                2468
function.odbc-connect.php                          28-Sep-2020 11:08                8551
function.odbc-cursor.php                           28-Sep-2020 11:08                2315
function.odbc-data-source.php                      28-Sep-2020 11:08                5538
function.odbc-do.php                               28-Sep-2020 11:08                1560
function.odbc-error.php                            28-Sep-2020 11:08                3297
function.odbc-errormsg.php                         28-Sep-2020 11:08                3344
function.odbc-exec.php                             28-Sep-2020 11:08                3605
function.odbc-execute.php                          28-Sep-2020 11:08                7139
function.odbc-fetch-array.php                      28-Sep-2020 11:08                3950
function.odbc-fetch-into.php                       28-Sep-2020 11:08                4928
function.odbc-fetch-object.php                     28-Sep-2020 11:08                3956
function.odbc-fetch-row.php                        28-Sep-2020 11:08                4061
function.odbc-field-len.php                        28-Sep-2020 11:08                3125
function.odbc-field-name.php                       28-Sep-2020 11:08                2697
function.odbc-field-num.php                        28-Sep-2020 11:08                2686
function.odbc-field-precision.php                  28-Sep-2020 11:08                2090
function.odbc-field-scale.php                      28-Sep-2020 11:08                2671
function.odbc-field-type.php                       28-Sep-2020 11:08                2695
function.odbc-foreignkeys.php                      28-Sep-2020 11:08                8197
function.odbc-free-result.php                      28-Sep-2020 11:08                3258
function.odbc-gettypeinfo.php                      28-Sep-2020 11:08                4138
function.odbc-longreadlen.php                      28-Sep-2020 11:08                3256
function.odbc-next-result.php                      28-Sep-2020 11:08                8950
function.odbc-num-fields.php                       28-Sep-2020 11:08                2446
function.odbc-num-rows.php                         28-Sep-2020 11:08                3181
function.odbc-pconnect.php                         28-Sep-2020 11:08                4164
function.odbc-prepare.php                          28-Sep-2020 11:08                6351
function.odbc-primarykeys.php                      28-Sep-2020 11:08                7392
function.odbc-procedurecolumns.php                 28-Sep-2020 11:08               10276
function.odbc-procedures.php                       28-Sep-2020 11:08                8364
function.odbc-result-all.php                       28-Sep-2020 11:08                2825
function.odbc-result.php                           28-Sep-2020 11:08                5318
function.odbc-rollback.php                         28-Sep-2020 11:08                2477
function.odbc-setoption.php                        28-Sep-2020 11:08                7155
function.odbc-specialcolumns.php                   28-Sep-2020 11:08                6645
function.odbc-statistics.php                       28-Sep-2020 11:08                9143
function.odbc-tableprivileges.php                  28-Sep-2020 11:08                7763
function.odbc-tables.php                           28-Sep-2020 11:08               10726
function.opcache-compile-file.php                  28-Sep-2020 11:08                3492
function.opcache-get-configuration.php             28-Sep-2020 11:08                2844
function.opcache-get-status.php                    28-Sep-2020 11:08                3383
function.opcache-invalidate.php                    28-Sep-2020 11:08                3809
function.opcache-is-script-cached.php              28-Sep-2020 11:08                3047
function.opcache-reset.php                         28-Sep-2020 11:08                2773
function.openal-buffer-create.php                  28-Sep-2020 11:08                2518
function.openal-buffer-data.php                    28-Sep-2020 11:08                4213
function.openal-buffer-destroy.php                 28-Sep-2020 11:08                2899
function.openal-buffer-get.php                     28-Sep-2020 11:08                3369
function.openal-buffer-loadwav.php                 28-Sep-2020 11:08                3420
function.openal-context-create.php                 28-Sep-2020 11:08                3141
function.openal-context-current.php                28-Sep-2020 11:08                2953
function.openal-context-destroy.php                28-Sep-2020 11:08                2939
function.openal-context-process.php                28-Sep-2020 11:08                3357
function.openal-context-suspend.php                28-Sep-2020 11:08                3351
function.openal-device-close.php                   28-Sep-2020 11:08                2908
function.openal-device-open.php                    28-Sep-2020 11:08                3106
function.openal-listener-get.php                   28-Sep-2020 11:08                3049
function.openal-listener-set.php                   28-Sep-2020 11:08                3352
function.openal-source-create.php                  28-Sep-2020 11:08                2725
function.openal-source-destroy.php                 28-Sep-2020 11:08                2907
function.openal-source-get.php                     28-Sep-2020 11:08                4549
function.openal-source-pause.php                   28-Sep-2020 11:08                3240
function.openal-source-play.php                    28-Sep-2020 11:08                3240
function.openal-source-rewind.php                  28-Sep-2020 11:08                3248
function.openal-source-set.php                     28-Sep-2020 11:08                5083
function.openal-source-stop.php                    28-Sep-2020 11:08                3222
function.openal-stream.php                         28-Sep-2020 11:08                3744
function.opendir.php                               28-Sep-2020 11:09                7381
function.openlog.php                               28-Sep-2020 11:09                8713
function.openssl-cipher-iv-length.php              28-Sep-2020 11:08                4073
function.openssl-csr-export-to-file.php            28-Sep-2020 11:08                7408
function.openssl-csr-export.php                    28-Sep-2020 11:08                7228
function.openssl-csr-get-public-key.php            28-Sep-2020 11:08                7329
function.openssl-csr-get-subject.php               28-Sep-2020 11:08                8682
function.openssl-csr-new.php                       28-Sep-2020 11:08               21533
function.openssl-csr-sign.php                      28-Sep-2020 11:08               10019
function.openssl-decrypt.php                       28-Sep-2020 11:08                6538
function.openssl-dh-compute-key.php                28-Sep-2020 11:08               15337
function.openssl-digest.php                        28-Sep-2020 11:08                4024
function.openssl-encrypt.php                       28-Sep-2020 11:08               18228
function.openssl-error-string.php                  28-Sep-2020 11:08                3520
function.openssl-free-key.php                      28-Sep-2020 11:08                2483
function.openssl-get-cert-locations.php            28-Sep-2020 11:08                3929
function.openssl-get-cipher-methods.php            28-Sep-2020 11:08               12249
function.openssl-get-curve-names.php               28-Sep-2020 11:08                6885
function.openssl-get-md-methods.php                28-Sep-2020 11:08                6891
function.openssl-get-privatekey.php                28-Sep-2020 11:08                1768
function.openssl-get-publickey.php                 28-Sep-2020 11:08                1741
function.openssl-open.php                          28-Sep-2020 11:08                8960
function.openssl-pbkdf2.php                        28-Sep-2020 11:08                6961
function.openssl-pkcs12-export-to-file.php         28-Sep-2020 11:08                4993
function.openssl-pkcs12-export.php                 28-Sep-2020 11:08                4978
function.openssl-pkcs12-read.php                   28-Sep-2020 11:08                5673
function.openssl-pkcs7-decrypt.php                 28-Sep-2020 11:08                6141
function.openssl-pkcs7-encrypt.php                 28-Sep-2020 11:08                9238
function.openssl-pkcs7-read.php                    28-Sep-2020 11:08                2778
function.openssl-pkcs7-sign.php                    28-Sep-2020 11:08                9920
function.openssl-pkcs7-verify.php                  28-Sep-2020 11:08                6584
function.openssl-pkey-export-to-file.php           28-Sep-2020 11:08                4541
function.openssl-pkey-export.php                   28-Sep-2020 11:08                4411
function.openssl-pkey-free.php                     28-Sep-2020 11:08                2532
function.openssl-pkey-get-details.php              28-Sep-2020 11:08                8471
function.openssl-pkey-get-private.php              28-Sep-2020 11:08                3638
function.openssl-pkey-get-public.php               28-Sep-2020 11:08                3378
function.openssl-pkey-new.php                      28-Sep-2020 11:08                3998
function.openssl-private-decrypt.php               28-Sep-2020 11:08                4875
function.openssl-private-encrypt.php               28-Sep-2020 11:08                4809
function.openssl-public-decrypt.php                28-Sep-2020 11:08                4831
function.openssl-public-encrypt.php                28-Sep-2020 11:08                5067
function.openssl-random-pseudo-bytes.php           28-Sep-2020 11:08                8165
function.openssl-seal.php                          28-Sep-2020 11:08               10372
function.openssl-sign.php                          28-Sep-2020 11:08               11596
function.openssl-spki-export-challenge.php         28-Sep-2020 11:08                7346
function.openssl-spki-export.php                   28-Sep-2020 11:08                8004
function.openssl-spki-new.php                      28-Sep-2020 11:08                7935
function.openssl-spki-verify.php                   28-Sep-2020 11:08                7698
function.openssl-verify.php                        28-Sep-2020 11:08               12901
function.openssl-x509-check-private-key.php        28-Sep-2020 11:08                3854
function.openssl-x509-checkpurpose.php             28-Sep-2020 11:08                5904
function.openssl-x509-export-to-file.php           28-Sep-2020 11:08                3773
function.openssl-x509-export.php                   28-Sep-2020 11:08                3705
function.openssl-x509-fingerprint.php              28-Sep-2020 11:08                3946
function.openssl-x509-free.php                     28-Sep-2020 11:08                2500
function.openssl-x509-parse.php                    28-Sep-2020 11:08                3590
function.openssl-x509-read.php                     28-Sep-2020 11:08                2807
function.openssl-x509-verify.php                   28-Sep-2020 11:08               11223
function.ord.php                                   28-Sep-2020 11:09                7215
function.output-add-rewrite-var.php                28-Sep-2020 11:08                8224
function.output-reset-rewrite-vars.php             28-Sep-2020 11:08                6205
function.pack.php                                  28-Sep-2020 11:09               14271
function.parse-ini-file.php                        28-Sep-2020 11:09               18069
function.parse-ini-string.php                      28-Sep-2020 11:09                6524
function.parse-str.php                             28-Sep-2020 11:09               11204
function.parse-url.php                             28-Sep-2020 11:09               15017
function.passthru.php                              28-Sep-2020 11:09                6603
function.password-algos.php                        28-Sep-2020 11:08                3246
function.password-get-info.php                     28-Sep-2020 11:08                3357
function.password-hash.php                         28-Sep-2020 11:08               21934
function.password-needs-rehash.php                 28-Sep-2020 11:08                8068
function.password-verify.php                       28-Sep-2020 11:08                5763
function.pathinfo.php                              28-Sep-2020 11:09               12301
function.pclose.php                                28-Sep-2020 11:09                4780
function.pcntl-alarm.php                           28-Sep-2020 11:09                2831
function.pcntl-async-signals.php                   28-Sep-2020 11:09                3132
function.pcntl-errno.php                           28-Sep-2020 11:09                1644
function.pcntl-exec.php                            28-Sep-2020 11:09                3574
function.pcntl-fork.php                            28-Sep-2020 11:09                4889
function.pcntl-get-last-error.php                  28-Sep-2020 11:09                2670
function.pcntl-getpriority.php                     28-Sep-2020 11:09                4322
function.pcntl-setpriority.php                     28-Sep-2020 11:09                4201
function.pcntl-signal-dispatch.php                 28-Sep-2020 11:09                5422
function.pcntl-signal-get-handler.php              28-Sep-2020 11:09                6481
function.pcntl-signal.php                          28-Sep-2020 11:09               11936
function.pcntl-sigprocmask.php                     28-Sep-2020 11:09                5520
function.pcntl-sigtimedwait.php                    28-Sep-2020 11:09                4458
function.pcntl-sigwaitinfo.php                     28-Sep-2020 11:09                7045
function.pcntl-strerror.php                        28-Sep-2020 11:09                2851
function.pcntl-wait.php                            28-Sep-2020 11:09                8087
function.pcntl-waitpid.php                         28-Sep-2020 11:09                9258
function.pcntl-wexitstatus.php                     28-Sep-2020 11:09                3367
function.pcntl-wifexited.php                       28-Sep-2020 11:09                3319
function.pcntl-wifsignaled.php                     28-Sep-2020 11:09                3350
function.pcntl-wifstopped.php                      28-Sep-2020 11:09                3327
function.pcntl-wstopsig.php                        28-Sep-2020 11:09                3389
function.pcntl-wtermsig.php                        28-Sep-2020 11:09                3635
function.pdf-3ddata.php                            28-Sep-2020 11:09                2000
function.pdf-activate-item.php                     28-Sep-2020 11:09                2057
function.pdf-add-annotation.php                    28-Sep-2020 11:09                1677
function.pdf-add-bookmark.php                      28-Sep-2020 11:09                1681
function.pdf-add-launchlink.php                    28-Sep-2020 11:09                2879
function.pdf-add-locallink.php                     28-Sep-2020 11:09                3172
function.pdf-add-nameddest.php                     28-Sep-2020 11:09                2138
function.pdf-add-note.php                          28-Sep-2020 11:09                3040
function.pdf-add-outline.php                       28-Sep-2020 11:09                1619
function.pdf-add-pdflink.php                       28-Sep-2020 11:09                3173
function.pdf-add-table-cell.php                    28-Sep-2020 11:09                2371
function.pdf-add-textflow.php                      28-Sep-2020 11:09                2188
function.pdf-add-thumbnail.php                     28-Sep-2020 11:09                2073
function.pdf-add-weblink.php                       28-Sep-2020 11:09                2998
function.pdf-arc.php                               28-Sep-2020 11:09                2226
function.pdf-arcn.php                              28-Sep-2020 11:09                2338
function.pdf-attach-file.php                       28-Sep-2020 11:09                3222
function.pdf-begin-document.php                    28-Sep-2020 11:09                1995
function.pdf-begin-font.php                        28-Sep-2020 11:09                2579
function.pdf-begin-glyph.php                       28-Sep-2020 11:09                2413
function.pdf-begin-item.php                        28-Sep-2020 11:09                2045
function.pdf-begin-layer.php                       28-Sep-2020 11:09                2048
function.pdf-begin-page-ext.php                    28-Sep-2020 11:09                3607
function.pdf-begin-page.php                        28-Sep-2020 11:09                2351
function.pdf-begin-pattern.php                     28-Sep-2020 11:09                2321
function.pdf-begin-template-ext.php                28-Sep-2020 11:09                2115
function.pdf-begin-template.php                    28-Sep-2020 11:09                2256
function.pdf-circle.php                            28-Sep-2020 11:09                2114
function.pdf-clip.php                              28-Sep-2020 11:09                1844
function.pdf-close-image.php                       28-Sep-2020 11:09                1968
function.pdf-close-pdi-page.php                    28-Sep-2020 11:09                2030
function.pdf-close-pdi.php                         28-Sep-2020 11:09                2217
function.pdf-close.php                             28-Sep-2020 11:09                2144
function.pdf-closepath-fill-stroke.php             28-Sep-2020 11:09                1957
function.pdf-closepath-stroke.php                  28-Sep-2020 11:09                1914
function.pdf-closepath.php                         28-Sep-2020 11:09                1839
function.pdf-concat.php                            28-Sep-2020 11:09                2500
function.pdf-continue-text.php                     28-Sep-2020 11:09                2015
function.pdf-create-3dview.php                     28-Sep-2020 11:09                2010
function.pdf-create-action.php                     28-Sep-2020 11:09                2037
function.pdf-create-annotation.php                 28-Sep-2020 11:09                2450
function.pdf-create-bookmark.php                   28-Sep-2020 11:09                1997
function.pdf-create-field.php                      28-Sep-2020 11:09                2551
function.pdf-create-fieldgroup.php                 28-Sep-2020 11:09                2026
function.pdf-create-gstate.php                     28-Sep-2020 11:09                1894
function.pdf-create-pvf.php                        28-Sep-2020 11:09                2095
function.pdf-create-textflow.php                   28-Sep-2020 11:09                2003
function.pdf-curveto.php                           28-Sep-2020 11:09                2537
function.pdf-define-layer.php                      28-Sep-2020 11:09                1997
function.pdf-delete-pvf.php                        28-Sep-2020 11:09                1925
function.pdf-delete-table.php                      28-Sep-2020 11:09                1971
function.pdf-delete-textflow.php                   28-Sep-2020 11:09                1878
function.pdf-delete.php                            28-Sep-2020 11:09                1881
function.pdf-encoding-set-char.php                 28-Sep-2020 11:09                2275
function.pdf-end-document.php                      28-Sep-2020 11:09                1879
function.pdf-end-font.php                          28-Sep-2020 11:09                1707
function.pdf-end-glyph.php                         28-Sep-2020 11:09                1704
function.pdf-end-item.php                          28-Sep-2020 11:09                1877
function.pdf-end-layer.php                         28-Sep-2020 11:09                1899
function.pdf-end-page-ext.php                      28-Sep-2020 11:09                1970
function.pdf-end-page.php                          28-Sep-2020 11:09                1805
function.pdf-end-pattern.php                       28-Sep-2020 11:09                1854
function.pdf-end-template.php                      28-Sep-2020 11:09                1853
function.pdf-endpath.php                           28-Sep-2020 11:09                1731
function.pdf-fill-imageblock.php                   28-Sep-2020 11:09                2352
function.pdf-fill-pdfblock.php                     28-Sep-2020 11:09                2349
function.pdf-fill-stroke.php                       28-Sep-2020 11:09                1901
function.pdf-fill-textblock.php                    28-Sep-2020 11:09                2335
function.pdf-fill.php                              28-Sep-2020 11:09                1835
function.pdf-findfont.php                          28-Sep-2020 11:09                2962
function.pdf-fit-image.php                         28-Sep-2020 11:09                2326
function.pdf-fit-pdi-page.php                      28-Sep-2020 11:09                2338
function.pdf-fit-table.php                         28-Sep-2020 11:09                2389
function.pdf-fit-textflow.php                      28-Sep-2020 11:09                2437
function.pdf-fit-textline.php                      28-Sep-2020 11:09                2350
function.pdf-get-apiname.php                       28-Sep-2020 11:09                1800
function.pdf-get-buffer.php                        28-Sep-2020 11:09                1728
function.pdf-get-errmsg.php                        28-Sep-2020 11:09                1782
function.pdf-get-errnum.php                        28-Sep-2020 11:09                1783
function.pdf-get-font.php                          28-Sep-2020 11:09                1633
function.pdf-get-fontname.php                      28-Sep-2020 11:09                1670
function.pdf-get-fontsize.php                      28-Sep-2020 11:09                1673
function.pdf-get-image-height.php                  28-Sep-2020 11:09                1700
function.pdf-get-image-width.php                   28-Sep-2020 11:09                1704
function.pdf-get-majorversion.php                  28-Sep-2020 11:09                1948
function.pdf-get-minorversion.php                  28-Sep-2020 11:09                2030
function.pdf-get-parameter.php                     28-Sep-2020 11:09                2016
function.pdf-get-pdi-parameter.php                 28-Sep-2020 11:09                2483
function.pdf-get-pdi-value.php                     28-Sep-2020 11:09                2454
function.pdf-get-value.php                         28-Sep-2020 11:09                1965
function.pdf-info-font.php                         28-Sep-2020 11:09                2076
function.pdf-info-matchbox.php                     28-Sep-2020 11:09                2093
function.pdf-info-table.php                        28-Sep-2020 11:09                1992
function.pdf-info-textflow.php                     28-Sep-2020 11:09                1988
function.pdf-info-textline.php                     28-Sep-2020 11:09                2138
function.pdf-initgraphics.php                      28-Sep-2020 11:09                1936
function.pdf-lineto.php                            28-Sep-2020 11:09                2047
function.pdf-load-font.php                         28-Sep-2020 11:09                2084
function.pdf-load-iccprofile.php                   28-Sep-2020 11:09                2013
function.pdf-load-image.php                        28-Sep-2020 11:09                2125
function.pdf-makespotcolor.php                     28-Sep-2020 11:09                2063
function.pdf-moveto.php                            28-Sep-2020 11:09                2024
function.pdf-new.php                               28-Sep-2020 11:09                1625
function.pdf-open-ccitt.php                        28-Sep-2020 11:09                2571
function.pdf-open-file.php                         28-Sep-2020 11:09                2214
function.pdf-open-gif.php                          28-Sep-2020 11:09                1581
function.pdf-open-image-file.php                   28-Sep-2020 11:09                2471
function.pdf-open-image.php                        28-Sep-2020 11:09                2968
function.pdf-open-jpeg.php                         28-Sep-2020 11:09                1590
function.pdf-open-memory-image.php                 28-Sep-2020 11:09                1949
function.pdf-open-pdi-document.php                 28-Sep-2020 11:09                2065
function.pdf-open-pdi-page.php                     28-Sep-2020 11:09                2203
function.pdf-open-pdi.php                          28-Sep-2020 11:09                2362
function.pdf-open-tiff.php                         28-Sep-2020 11:09                1586
function.pdf-pcos-get-number.php                   28-Sep-2020 11:09                2059
function.pdf-pcos-get-stream.php                   28-Sep-2020 11:09                2209
function.pdf-pcos-get-string.php                   28-Sep-2020 11:09                2045
function.pdf-place-image.php                       28-Sep-2020 11:09                2522
function.pdf-place-pdi-page.php                    28-Sep-2020 11:09                2646
function.pdf-process-pdi.php                       28-Sep-2020 11:09                2091
function.pdf-rect.php                              28-Sep-2020 11:09                2200
function.pdf-restore.php                           28-Sep-2020 11:09                1843
function.pdf-resume-page.php                       28-Sep-2020 11:09                1828
function.pdf-rotate.php                            28-Sep-2020 11:09                1901
function.pdf-save.php                              28-Sep-2020 11:09                1787
function.pdf-scale.php                             28-Sep-2020 11:09                2014
function.pdf-set-border-color.php                  28-Sep-2020 11:09                2535
function.pdf-set-border-dash.php                   28-Sep-2020 11:09                2489
function.pdf-set-border-style.php                  28-Sep-2020 11:09                2507
function.pdf-set-char-spacing.php                  28-Sep-2020 11:09                1711
function.pdf-set-duration.php                      28-Sep-2020 11:09                1809
function.pdf-set-gstate.php                        28-Sep-2020 11:09                1839
function.pdf-set-horiz-scaling.php                 28-Sep-2020 11:09                1720
function.pdf-set-info-author.php                   28-Sep-2020 11:09                1659
function.pdf-set-info-creator.php                  28-Sep-2020 11:09                1663
function.pdf-set-info-keywords.php                 28-Sep-2020 11:09                1672
function.pdf-set-info-subject.php                  28-Sep-2020 11:09                1657
function.pdf-set-info-title.php                    28-Sep-2020 11:09                1631
function.pdf-set-info.php                          28-Sep-2020 11:09                2157
function.pdf-set-layer-dependency.php              28-Sep-2020 11:09                2233
function.pdf-set-leading.php                       28-Sep-2020 11:09                1685
function.pdf-set-parameter.php                     28-Sep-2020 11:09                2090
function.pdf-set-text-matrix.php                   28-Sep-2020 11:09                1915
function.pdf-set-text-pos.php                      28-Sep-2020 11:09                2128
function.pdf-set-text-rendering.php                28-Sep-2020 11:09                1727
function.pdf-set-text-rise.php                     28-Sep-2020 11:09                1691
function.pdf-set-value.php                         28-Sep-2020 11:09                2110
function.pdf-set-word-spacing.php                  28-Sep-2020 11:09                1682
function.pdf-setcolor.php                          28-Sep-2020 11:09                2519
function.pdf-setdash.php                           28-Sep-2020 11:09                2149
function.pdf-setdashpattern.php                    28-Sep-2020 11:09                2002
function.pdf-setflat.php                           28-Sep-2020 11:09                1945
function.pdf-setfont.php                           28-Sep-2020 11:09                2326
function.pdf-setgray-fill.php                      28-Sep-2020 11:09                2251
function.pdf-setgray-stroke.php                    28-Sep-2020 11:09                2254
function.pdf-setgray.php                           28-Sep-2020 11:09                2215
function.pdf-setlinecap.php                        28-Sep-2020 11:09                1887
function.pdf-setlinejoin.php                       28-Sep-2020 11:09                2033
function.pdf-setlinewidth.php                      28-Sep-2020 11:09                1973
function.pdf-setmatrix.php                         28-Sep-2020 11:09                2525
function.pdf-setmiterlimit.php                     28-Sep-2020 11:09                1975
function.pdf-setpolydash.php                       28-Sep-2020 11:09                1645
function.pdf-setrgbcolor-fill.php                  28-Sep-2020 11:09                2481
function.pdf-setrgbcolor-stroke.php                28-Sep-2020 11:09                2495
function.pdf-setrgbcolor.php                       28-Sep-2020 11:09                2480
function.pdf-shading-pattern.php                   28-Sep-2020 11:09                2073
function.pdf-shading.php                           28-Sep-2020 11:09                2878
function.pdf-shfill.php                            28-Sep-2020 11:09                1921
function.pdf-show-boxed.php                        28-Sep-2020 11:09                2827
function.pdf-show-xy.php                           28-Sep-2020 11:09                2189
function.pdf-show.php                              28-Sep-2020 11:09                1997
function.pdf-skew.php                              28-Sep-2020 11:09                2120
function.pdf-stringwidth.php                       28-Sep-2020 11:09                2085
function.pdf-stroke.php                            28-Sep-2020 11:09                1856
function.pdf-suspend-page.php                      28-Sep-2020 11:09                1981
function.pdf-translate.php                         28-Sep-2020 11:09                1963
function.pdf-utf16-to-utf8.php                     28-Sep-2020 11:09                1887
function.pdf-utf32-to-utf16.php                    28-Sep-2020 11:09                2023
function.pdf-utf8-to-utf16.php                     28-Sep-2020 11:09                1986
function.pfsockopen.php                            28-Sep-2020 11:09                3392
function.pg-affected-rows.php                      28-Sep-2020 11:09                6277
function.pg-cancel-query.php                       28-Sep-2020 11:09                7062
function.pg-client-encoding.php                    28-Sep-2020 11:09                5667
function.pg-close.php                              28-Sep-2020 11:09                5131
function.pg-connect-poll.php                       28-Sep-2020 11:09                2803
function.pg-connect.php                            28-Sep-2020 11:09               11229
function.pg-connection-busy.php                    28-Sep-2020 11:09                5091
function.pg-connection-reset.php                   28-Sep-2020 11:09                5120
function.pg-connection-status.php                  28-Sep-2020 11:09                4797
function.pg-consume-input.php                      28-Sep-2020 11:09                2565
function.pg-convert.php                            28-Sep-2020 11:09                9147
function.pg-copy-from.php                          28-Sep-2020 11:09                7003
function.pg-copy-to.php                            28-Sep-2020 11:09                6352
function.pg-dbname.php                             28-Sep-2020 11:09                4044
function.pg-delete.php                             28-Sep-2020 11:09                8373
function.pg-end-copy.php                           28-Sep-2020 11:09                6147
function.pg-escape-bytea.php                       28-Sep-2020 11:09                7872
function.pg-escape-identifier.php                  28-Sep-2020 11:09                6939
function.pg-escape-literal.php                     28-Sep-2020 11:09                7599
function.pg-escape-string.php                      28-Sep-2020 11:09                7516
function.pg-execute.php                            28-Sep-2020 11:09                9350
function.pg-fetch-all-columns.php                  28-Sep-2020 11:09                6692
function.pg-fetch-all.php                          28-Sep-2020 11:09                7490
function.pg-fetch-array.php                        28-Sep-2020 11:09               12050
function.pg-fetch-assoc.php                        28-Sep-2020 11:09                8544
function.pg-fetch-object.php                       28-Sep-2020 11:09               10735
function.pg-fetch-result.php                       28-Sep-2020 11:09                7727
function.pg-fetch-row.php                          28-Sep-2020 11:09                7820
function.pg-field-is-null.php                      28-Sep-2020 11:09                7887
function.pg-field-name.php                         28-Sep-2020 11:09                8878
function.pg-field-num.php                          28-Sep-2020 11:09                5916
function.pg-field-prtlen.php                       28-Sep-2020 11:09               10438
function.pg-field-size.php                         28-Sep-2020 11:09                9153
function.pg-field-table.php                        28-Sep-2020 11:09                7813
function.pg-field-type-oid.php                     28-Sep-2020 11:09                6992
function.pg-field-type.php                         28-Sep-2020 11:09                6801
function.pg-flush.php                              28-Sep-2020 11:09                2624
function.pg-free-result.php                        28-Sep-2020 11:09                6816
function.pg-get-notify.php                         28-Sep-2020 11:09                6581
function.pg-get-pid.php                            28-Sep-2020 11:09                4379
function.pg-get-result.php                         28-Sep-2020 11:09                7745
function.pg-host.php                               28-Sep-2020 11:09                5167
function.pg-insert.php                             28-Sep-2020 11:09                8709
function.pg-last-error.php                         28-Sep-2020 11:09                6356
function.pg-last-notice.php                        28-Sep-2020 11:09                7768
function.pg-last-oid.php                           28-Sep-2020 11:09                6903
function.pg-lo-close.php                           28-Sep-2020 11:09                6805
function.pg-lo-create.php                          28-Sep-2020 11:09                8493
function.pg-lo-export.php                          28-Sep-2020 11:09                7284
function.pg-lo-import.php                          28-Sep-2020 11:09                7449
function.pg-lo-open.php                            28-Sep-2020 11:09                7554
function.pg-lo-read-all.php                        28-Sep-2020 11:09                5942
function.pg-lo-read.php                            28-Sep-2020 11:09                6381
function.pg-lo-seek.php                            28-Sep-2020 11:09                7902
function.pg-lo-tell.php                            28-Sep-2020 11:09                7285
function.pg-lo-truncate.php                        28-Sep-2020 11:09                6454
function.pg-lo-unlink.php                          28-Sep-2020 11:09                6178
function.pg-lo-write.php                           28-Sep-2020 11:09                7186
function.pg-meta-data.php                          28-Sep-2020 11:09                7183
function.pg-num-fields.php                         28-Sep-2020 11:09                5251
function.pg-num-rows.php                           28-Sep-2020 11:09                5203
function.pg-options.php                            28-Sep-2020 11:09                4454
function.pg-parameter-status.php                   28-Sep-2020 11:09                7449
function.pg-pconnect.php                           28-Sep-2020 11:09                9410
function.pg-ping.php                               28-Sep-2020 11:09                4741
function.pg-port.php                               28-Sep-2020 11:09                4638
function.pg-prepare.php                            28-Sep-2020 11:09                9491
function.pg-put-line.php                           28-Sep-2020 11:09                7820
function.pg-query-params.php                       28-Sep-2020 11:09                9680
function.pg-query.php                              28-Sep-2020 11:09               11431
function.pg-result-error-field.php                 28-Sep-2020 11:09                7749
function.pg-result-error.php                       28-Sep-2020 11:09                7557
function.pg-result-seek.php                        28-Sep-2020 11:09                6621
function.pg-result-status.php                      28-Sep-2020 11:09                7254
function.pg-select.php                             28-Sep-2020 11:09                9115
function.pg-send-execute.php                       28-Sep-2020 11:09               10409
function.pg-send-prepare.php                       28-Sep-2020 11:09               10876
function.pg-send-query-params.php                  28-Sep-2020 11:09                7364
function.pg-send-query.php                         28-Sep-2020 11:09                9466
function.pg-set-client-encoding.php                28-Sep-2020 11:09                8119
function.pg-set-error-verbosity.php                28-Sep-2020 11:09                7654
function.pg-socket.php                             28-Sep-2020 11:09                2739
function.pg-trace.php                              28-Sep-2020 11:09                7146
function.pg-transaction-status.php                 28-Sep-2020 11:09                5806
function.pg-tty.php                                28-Sep-2020 11:09                4876
function.pg-unescape-bytea.php                     28-Sep-2020 11:09                7279
function.pg-untrace.php                            28-Sep-2020 11:09                5195
function.pg-update.php                             28-Sep-2020 11:09                9391
function.pg-version.php                            28-Sep-2020 11:09                5465
function.php-ini-loaded-file.php                   28-Sep-2020 11:08                4502
function.php-ini-scanned-files.php                 28-Sep-2020 11:08                6353
function.php-sapi-name.php                         28-Sep-2020 11:08                6178
function.php-strip-whitespace.php                  28-Sep-2020 11:09                4988
function.php-uname.php                             28-Sep-2020 11:08                9354
function.phpcredits.php                            28-Sep-2020 11:08                7951
function.phpdbg-break-file.php                     28-Sep-2020 11:08                3565
function.phpdbg-break-function.php                 28-Sep-2020 11:08                3346
function.phpdbg-break-method.php                   28-Sep-2020 11:08                3630
function.phpdbg-break-next.php                     28-Sep-2020 11:08                3085
function.phpdbg-clear.php                          28-Sep-2020 11:08                3371
function.phpdbg-color.php                          28-Sep-2020 11:08                3460
function.phpdbg-end-oplog.php                      28-Sep-2020 11:08                2274
function.phpdbg-exec.php                           28-Sep-2020 11:08                2715
function.phpdbg-get-executable.php                 28-Sep-2020 11:08                2321
function.phpdbg-prompt.php                         28-Sep-2020 11:08                2652
function.phpdbg-start-oplog.php                    28-Sep-2020 11:08                2199
function.phpinfo.php                               28-Sep-2020 11:08               10847
function.phpversion.php                            28-Sep-2020 11:08               10345
function.pi.php                                    28-Sep-2020 11:09                2875
function.png2wbmp.php                              28-Sep-2020 11:09                6367
function.popen.php                                 28-Sep-2020 11:09                8749
function.pos.php                                   28-Sep-2020 11:09                1504
function.posix-access.php                          28-Sep-2020 11:09                6653
function.posix-ctermid.php                         28-Sep-2020 11:09                4113
function.posix-errno.php                           28-Sep-2020 11:09                1660
function.posix-get-last-error.php                  28-Sep-2020 11:09                4103
function.posix-getcwd.php                          28-Sep-2020 11:09                3985
function.posix-getegid.php                         28-Sep-2020 11:09                5190
function.posix-geteuid.php                         28-Sep-2020 11:09                5169
function.posix-getgid.php                          28-Sep-2020 11:09                4569
function.posix-getgrgid.php                        28-Sep-2020 11:09                6492
function.posix-getgrnam.php                        28-Sep-2020 11:09                6530
function.posix-getgroups.php                       28-Sep-2020 11:09                3703
function.posix-getlogin.php                        28-Sep-2020 11:09                3170
function.posix-getpgid.php                         28-Sep-2020 11:09                4407
function.posix-getpgrp.php                         28-Sep-2020 11:09                2302
function.posix-getpid.php                          28-Sep-2020 11:09                3054
function.posix-getppid.php                         28-Sep-2020 11:09                2699
function.posix-getpwnam.php                        28-Sep-2020 11:09                6807
function.posix-getpwuid.php                        28-Sep-2020 11:09                6672
function.posix-getrlimit.php                       28-Sep-2020 11:09                6914
function.posix-getsid.php                          28-Sep-2020 11:09                4412
function.posix-getuid.php                          28-Sep-2020 11:09                3136
function.posix-initgroups.php                      28-Sep-2020 11:09                2989
function.posix-isatty.php                          28-Sep-2020 11:09                3834
function.posix-kill.php                            28-Sep-2020 11:09                3079
function.posix-mkfifo.php                          28-Sep-2020 11:09                3699
function.posix-mknod.php                           28-Sep-2020 11:09                7050
function.posix-setegid.php                         28-Sep-2020 11:09                5078
function.posix-seteuid.php                         28-Sep-2020 11:09                3377
function.posix-setgid.php                          28-Sep-2020 11:09                5350
function.posix-setpgid.php                         28-Sep-2020 11:09                3058
function.posix-setrlimit.php                       28-Sep-2020 11:09                4147
function.posix-setsid.php                          28-Sep-2020 11:09                2265
function.posix-setuid.php                          28-Sep-2020 11:09                5428
function.posix-strerror.php                        28-Sep-2020 11:09                4726
function.posix-times.php                           28-Sep-2020 11:09                4345
function.posix-ttyname.php                         28-Sep-2020 11:09                3452
function.posix-uname.php                           28-Sep-2020 11:09                4436
function.pow.php                                   28-Sep-2020 11:09                7246
function.preg-filter.php                           28-Sep-2020 11:09                8965
function.preg-grep.php                             28-Sep-2020 11:09                5433
function.preg-last-error.php                       28-Sep-2020 11:09                4127
function.preg-match-all.php                        28-Sep-2020 11:09               27167
function.preg-match.php                            28-Sep-2020 11:09               24768
function.preg-quote.php                            28-Sep-2020 11:09                8897
function.preg-replace-callback-array.php           28-Sep-2020 11:09                9810
function.preg-replace-callback.php                 28-Sep-2020 11:09               17540
function.preg-replace.php                          28-Sep-2020 11:09               23809
function.preg-split.php                            28-Sep-2020 11:09               12604
function.prev.php                                  28-Sep-2020 11:09                7959
function.print-r.php                               28-Sep-2020 11:09                9483
function.print.php                                 28-Sep-2020 11:09                8080
function.printf.php                                28-Sep-2020 11:09               24936
function.proc-close.php                            28-Sep-2020 11:09                3550
function.proc-get-status.php                       28-Sep-2020 11:09                6488
function.proc-nice.php                             28-Sep-2020 11:09                7239
function.proc-open.php                             28-Sep-2020 11:09               23501
function.proc-terminate.php                        28-Sep-2020 11:09                5335
function.property-exists.php                       28-Sep-2020 11:09                9115
function.ps-add-bookmark.php                       28-Sep-2020 11:09                4718
function.ps-add-launchlink.php                     28-Sep-2020 11:09                5178
function.ps-add-locallink.php                      28-Sep-2020 11:09                5886
function.ps-add-note.php                           28-Sep-2020 11:09                6474
function.ps-add-pdflink.php                        28-Sep-2020 11:09                6182
function.ps-add-weblink.php                        28-Sep-2020 11:09                5267
function.ps-arc.php                                28-Sep-2020 11:09                4624
function.ps-arcn.php                               28-Sep-2020 11:09                4629
function.ps-begin-page.php                         28-Sep-2020 11:09                6628
function.ps-begin-pattern.php                      28-Sep-2020 11:09               12973
function.ps-begin-template.php                     28-Sep-2020 11:09               11292
function.ps-circle.php                             28-Sep-2020 11:09                4309
function.ps-clip.php                               28-Sep-2020 11:09                2838
function.ps-close-image.php                        28-Sep-2020 11:09                3605
function.ps-close.php                              28-Sep-2020 11:09                3490
function.ps-closepath-stroke.php                   28-Sep-2020 11:09                2899
function.ps-closepath.php                          28-Sep-2020 11:09                3082
function.ps-continue-text.php                      28-Sep-2020 11:09                3853
function.ps-curveto.php                            28-Sep-2020 11:09                4418
function.ps-delete.php                             28-Sep-2020 11:09                3353
function.ps-end-page.php                           28-Sep-2020 11:09                3078
function.ps-end-pattern.php                        28-Sep-2020 11:09                3005
function.ps-end-template.php                       28-Sep-2020 11:09                3011
function.ps-fill-stroke.php                        28-Sep-2020 11:09                3128
function.ps-fill.php                               28-Sep-2020 11:09                3065
function.ps-findfont.php                           28-Sep-2020 11:09                6661
function.ps-get-buffer.php                         28-Sep-2020 11:09                3071
function.ps-get-parameter.php                      28-Sep-2020 11:09                7378
function.ps-get-value.php                          28-Sep-2020 11:09                9214
function.ps-hyphenate.php                          28-Sep-2020 11:09                7015
function.ps-include-file.php                       28-Sep-2020 11:09                2864
function.ps-lineto.php                             28-Sep-2020 11:09                8115
function.ps-makespotcolor.php                      28-Sep-2020 11:09               10201
function.ps-moveto.php                             28-Sep-2020 11:09                3547
function.ps-new.php                                28-Sep-2020 11:09                2610
function.ps-open-file.php                          28-Sep-2020 11:09                3398
function.ps-open-image-file.php                    28-Sep-2020 11:09                4434
function.ps-open-image.php                         28-Sep-2020 11:09                6172
function.ps-open-memory-image.php                  28-Sep-2020 11:09                2631
function.ps-place-image.php                        28-Sep-2020 11:09                4718
function.ps-rect.php                               28-Sep-2020 11:09                4460
function.ps-restore.php                            28-Sep-2020 11:09                3191
function.ps-rotate.php                             28-Sep-2020 11:09               12281
function.ps-save.php                               28-Sep-2020 11:09                2941
function.ps-scale.php                              28-Sep-2020 11:09                3472
function.ps-set-border-color.php                   28-Sep-2020 11:09                4416
function.ps-set-border-dash.php                    28-Sep-2020 11:09                4168
function.ps-set-border-style.php                   28-Sep-2020 11:09                4229
function.ps-set-info.php                           28-Sep-2020 11:09                5710
function.ps-set-parameter.php                      28-Sep-2020 11:09                3640
function.ps-set-text-pos.php                       28-Sep-2020 11:09                9271
function.ps-set-value.php                          28-Sep-2020 11:09                4480
function.ps-setcolor.php                           28-Sep-2020 11:09                5183
function.ps-setdash.php                            28-Sep-2020 11:09                3342
function.ps-setflat.php                            28-Sep-2020 11:09                2858
function.ps-setfont.php                            28-Sep-2020 11:09                3775
function.ps-setgray.php                            28-Sep-2020 11:09                3065
function.ps-setlinecap.php                         28-Sep-2020 11:09                3618
function.ps-setlinejoin.php                        28-Sep-2020 11:09                3635
function.ps-setlinewidth.php                       28-Sep-2020 11:09                3498
function.ps-setmiterlimit.php                      28-Sep-2020 11:09                3917
function.ps-setoverprintmode.php                   28-Sep-2020 11:09                2886
function.ps-setpolydash.php                        28-Sep-2020 11:09                7671
function.ps-shading-pattern.php                    28-Sep-2020 11:09                3886
function.ps-shading.php                            28-Sep-2020 11:09                6101
function.ps-shfill.php                             28-Sep-2020 11:09                3730
function.ps-show-boxed.php                         28-Sep-2020 11:09               11108
function.ps-show-xy.php                            28-Sep-2020 11:09                3793
function.ps-show-xy2.php                           28-Sep-2020 11:09                2548
function.ps-show.php                               28-Sep-2020 11:09                5555
function.ps-show2.php                              28-Sep-2020 11:09                2995
function.ps-string-geometry.php                    28-Sep-2020 11:09                4484
function.ps-stringwidth.php                        28-Sep-2020 11:09                3950
function.ps-stroke.php                             28-Sep-2020 11:09                3275
function.ps-symbol-name.php                        28-Sep-2020 11:09                3654
function.ps-symbol-width.php                       28-Sep-2020 11:09                4038
function.ps-symbol.php                             28-Sep-2020 11:09                3476
function.ps-translate.php                          28-Sep-2020 11:09               14317
function.pspell-add-to-personal.php                28-Sep-2020 11:09                5426
function.pspell-add-to-session.php                 28-Sep-2020 11:09                2975
function.pspell-check.php                          28-Sep-2020 11:09                4063
function.pspell-clear-session.php                  28-Sep-2020 11:09                4874
function.pspell-config-create.php                  28-Sep-2020 11:09                6964
function.pspell-config-data-dir.php                28-Sep-2020 11:09                2383
function.pspell-config-dict-dir.php                28-Sep-2020 11:09                2359
function.pspell-config-ignore.php                  28-Sep-2020 11:09                4757
function.pspell-config-mode.php                    28-Sep-2020 11:09                5405
function.pspell-config-personal.php                28-Sep-2020 11:09                5613
function.pspell-config-repl.php                    28-Sep-2020 11:09                5933
function.pspell-config-runtogether.php             28-Sep-2020 11:09                5384
function.pspell-config-save-repl.php               28-Sep-2020 11:09                4206
function.pspell-new-config.php                     28-Sep-2020 11:09                5031
function.pspell-new-personal.php                   28-Sep-2020 11:09                9468
function.pspell-new.php                            28-Sep-2020 11:09                7909
function.pspell-save-wordlist.php                  28-Sep-2020 11:09                5248
function.pspell-store-replacement.php              28-Sep-2020 11:09                6917
function.pspell-suggest.php                        28-Sep-2020 11:09                4620
function.putenv.php                                28-Sep-2020 11:08                5377
function.px-close.php                              28-Sep-2020 11:09                3108
function.px-create-fp.php                          28-Sep-2020 11:09                9799
function.px-date2string.php                        28-Sep-2020 11:09                6885
function.px-delete-record.php                      28-Sep-2020 11:09                3218
function.px-delete.php                             28-Sep-2020 11:09                2478
function.px-get-field.php                          28-Sep-2020 11:09                2949
function.px-get-info.php                           28-Sep-2020 11:09                5368
function.px-get-parameter.php                      28-Sep-2020 11:09                3893
function.px-get-record.php                         28-Sep-2020 11:09                4750
function.px-get-schema.php                         28-Sep-2020 11:09                3761
function.px-get-value.php                          28-Sep-2020 11:09                3054
function.px-insert-record.php                      28-Sep-2020 11:09               14318
function.px-new.php                                28-Sep-2020 11:09                6544
function.px-numfields.php                          28-Sep-2020 11:09                2620
function.px-numrecords.php                         28-Sep-2020 11:09                2639
function.px-open-fp.php                            28-Sep-2020 11:09                3882
function.px-put-record.php                         28-Sep-2020 11:09                3721
function.px-retrieve-record.php                    28-Sep-2020 11:09                4836
function.px-set-blob-file.php                      28-Sep-2020 11:09                4017
function.px-set-parameter.php                      28-Sep-2020 11:09                4376
function.px-set-tablename.php                      28-Sep-2020 11:09                3497
function.px-set-targetencoding.php                 28-Sep-2020 11:09                4157
function.px-set-value.php                          28-Sep-2020 11:09                3596
function.px-timestamp2string.php                   28-Sep-2020 11:09                8280
function.px-update-record.php                      28-Sep-2020 11:09                4103
function.quoted-printable-decode.php               28-Sep-2020 11:09                3438
function.quoted-printable-encode.php               28-Sep-2020 11:09                3365
function.quotemeta.php                             28-Sep-2020 11:09                4877
function.rad2deg.php                               28-Sep-2020 11:09                3430
function.radius-acct-open.php                      28-Sep-2020 11:08                2926
function.radius-add-server.php                     28-Sep-2020 11:08                7168
function.radius-auth-open.php                      28-Sep-2020 11:08                2934
function.radius-close.php                          28-Sep-2020 11:08                2079
function.radius-config.php                         28-Sep-2020 11:08                3745
function.radius-create-request.php                 28-Sep-2020 11:08                4925
function.radius-cvt-addr.php                       28-Sep-2020 11:08                6119
function.radius-cvt-int.php                        28-Sep-2020 11:08                5341
function.radius-cvt-string.php                     28-Sep-2020 11:08                5395
function.radius-demangle-mppe-key.php              28-Sep-2020 11:08                2451
function.radius-demangle.php                       28-Sep-2020 11:08                2194
function.radius-get-attr.php                       28-Sep-2020 11:08                6380
function.radius-get-tagged-attr-data.php           28-Sep-2020 11:08                6571
function.radius-get-tagged-attr-tag.php            28-Sep-2020 11:08                6627
function.radius-get-vendor-attr.php                28-Sep-2020 11:08                8420
function.radius-put-addr.php                       28-Sep-2020 11:08                4742
function.radius-put-attr.php                       28-Sep-2020 11:08                8165
function.radius-put-int.php                        28-Sep-2020 11:08                6840
function.radius-put-string.php                     28-Sep-2020 11:08                7225
function.radius-put-vendor-addr.php                28-Sep-2020 11:08                4814
function.radius-put-vendor-attr.php                28-Sep-2020 11:08                6962
function.radius-put-vendor-int.php                 28-Sep-2020 11:08                5413
function.radius-put-vendor-string.php              28-Sep-2020 11:08                5801
function.radius-request-authenticator.php          28-Sep-2020 11:08                2588
function.radius-salt-encrypt-attr.php              28-Sep-2020 11:08                3806
function.radius-send-request.php                   28-Sep-2020 11:08                3226
function.radius-server-secret.php                  28-Sep-2020 11:08                2122
function.radius-strerror.php                       28-Sep-2020 11:08                2081
function.rand.php                                  28-Sep-2020 11:09                9988
function.random-bytes.php                          28-Sep-2020 11:08                6814
function.random-int.php                            28-Sep-2020 11:08                6932
function.range.php                                 28-Sep-2020 11:09                7714
function.rar-wrapper-cache-stats.php               28-Sep-2020 11:08                2235
function.rawurldecode.php                          28-Sep-2020 11:09                4553
function.rawurlencode.php                          28-Sep-2020 11:09                7389
function.read-exif-data.php                        28-Sep-2020 11:09                2099
function.readdir.php                               28-Sep-2020 11:09               10328
function.readfile.php                              28-Sep-2020 11:09               10030
function.readgzfile.php                            28-Sep-2020 11:08                4119
function.readline-add-history.php                  28-Sep-2020 11:08                2485
function.readline-callback-handler-install.php     28-Sep-2020 11:08               10213
function.readline-callback-handler-remove.php      28-Sep-2020 11:08                3669
function.readline-callback-read-char.php           28-Sep-2020 11:08                3673
function.readline-clear-history.php                28-Sep-2020 11:08                2085
function.readline-completion-function.php          28-Sep-2020 11:08                2879
function.readline-info.php                         28-Sep-2020 11:08                3159
function.readline-list-history.php                 28-Sep-2020 11:08                2043
function.readline-on-new-line.php                  28-Sep-2020 11:08                2043
function.readline-read-history.php                 28-Sep-2020 11:08                2494
function.readline-redisplay.php                    28-Sep-2020 11:08                1981
function.readline-write-history.php                28-Sep-2020 11:08                2472
function.readline.php                              28-Sep-2020 11:08                4943
function.readlink.php                              28-Sep-2020 11:09                4807
function.realpath-cache-get.php                    28-Sep-2020 11:09                3870
function.realpath-cache-size.php                   28-Sep-2020 11:09                3355
function.realpath.php                              28-Sep-2020 11:09                9362
function.recode-file.php                           28-Sep-2020 11:09                5641
function.recode-string.php                         28-Sep-2020 11:09                4443
function.recode.php                                28-Sep-2020 11:09                1606
function.register-shutdown-function.php            28-Sep-2020 11:09                7233
function.register-tick-function.php                28-Sep-2020 11:09                5717
function.rename.php                                28-Sep-2020 11:09                5766
function.require-once.php                          28-Sep-2020 11:08                1751
function.require.php                               28-Sep-2020 11:08                1752
function.reset.php                                 28-Sep-2020 11:09                8370
function.restore-error-handler.php                 28-Sep-2020 11:08                5704
function.restore-exception-handler.php             28-Sep-2020 11:08                6512
function.restore-include-path.php                  28-Sep-2020 11:08                4762
function.return.php                                28-Sep-2020 11:08                3667
function.rewind.php                                28-Sep-2020 11:09                6171
function.rewinddir.php                             28-Sep-2020 11:09                2892
function.rmdir.php                                 28-Sep-2020 11:09                5199
function.round.php                                 28-Sep-2020 11:09               25883
function.rpmaddtag.php                             28-Sep-2020 11:09                3053
function.rpmdbinfo.php                             28-Sep-2020 11:09                4762
function.rpmdbsearch.php                           28-Sep-2020 11:09                5444
function.rpminfo.php                               28-Sep-2020 11:09                4859
function.rpmvercmp.php                             28-Sep-2020 11:09                2470
function.rrd-create.php                            28-Sep-2020 11:09                2582
function.rrd-error.php                             28-Sep-2020 11:09                1969
function.rrd-fetch.php                             28-Sep-2020 11:09                2670
function.rrd-first.php                             28-Sep-2020 11:09                2594
function.rrd-graph.php                             28-Sep-2020 11:09                2843
function.rrd-info.php                              28-Sep-2020 11:09                2224
function.rrd-last.php                              28-Sep-2020 11:09                2230
function.rrd-lastupdate.php                        28-Sep-2020 11:09                2349
function.rrd-restore.php                           28-Sep-2020 11:09                2849
function.rrd-tune.php                              28-Sep-2020 11:09                2622
function.rrd-update.php                            28-Sep-2020 11:09                2701
function.rrd-version.php                           28-Sep-2020 11:09                2061
function.rrd-xport.php                             28-Sep-2020 11:09                2404
function.rrdc-disconnect.php                       28-Sep-2020 11:09                2454
function.rsort.php                                 28-Sep-2020 11:09                6315
function.rtrim.php                                 28-Sep-2020 11:09                9676
function.runkit7-constant-add.php                  28-Sep-2020 11:08                4083
function.runkit7-constant-redefine.php             28-Sep-2020 11:08                3945
function.runkit7-constant-remove.php               28-Sep-2020 11:08                3341
function.runkit7-function-add.php                  28-Sep-2020 11:08                8282
function.runkit7-function-copy.php                 28-Sep-2020 11:08                5194
function.runkit7-function-redefine.php             28-Sep-2020 11:08                8703
function.runkit7-function-remove.php               28-Sep-2020 11:08                3832
function.runkit7-function-rename.php               28-Sep-2020 11:08                4053
function.runkit7-import.php                        28-Sep-2020 11:08                3196
function.runkit7-method-add.php                    28-Sep-2020 11:08               10112
function.runkit7-method-copy.php                   28-Sep-2020 11:08                6733
function.runkit7-method-redefine.php               28-Sep-2020 11:08               10573
function.runkit7-method-remove.php                 28-Sep-2020 11:08                6411
function.runkit7-method-rename.php                 28-Sep-2020 11:08                6416
function.runkit7-object-id.php                     28-Sep-2020 11:08                2977
function.runkit7-superglobals.php                  28-Sep-2020 11:08                2498
function.runkit7-zval-inspect.php                  28-Sep-2020 11:08                2053
function.sapi-windows-cp-conv.php                  28-Sep-2020 11:09                4104
function.sapi-windows-cp-get.php                   28-Sep-2020 11:09                2742
function.sapi-windows-cp-is-utf8.php               28-Sep-2020 11:09                2597
function.sapi-windows-cp-set.php                   28-Sep-2020 11:09                2739
function.sapi-windows-generate-ctrl-event.php      28-Sep-2020 11:09                7562
function.sapi-windows-set-ctrl-handler.php         28-Sep-2020 11:09                7240
function.sapi-windows-vt100-support.php            28-Sep-2020 11:09                9139
function.scandir.php                               28-Sep-2020 11:09                8845
function.scoutapm-get-calls.php                    28-Sep-2020 11:09                4312
function.scoutapm-list-instrumented-functions.php  28-Sep-2020 11:09                3630
function.seaslog-get-author.php                    28-Sep-2020 11:09                2968
function.seaslog-get-version.php                   28-Sep-2020 11:09                2964
function.sem-acquire.php                           28-Sep-2020 11:09                4806
function.sem-get.php                               28-Sep-2020 11:09                5590
function.sem-release.php                           28-Sep-2020 11:09                3355
function.sem-remove.php                            28-Sep-2020 11:09                3414
function.serialize.php                             28-Sep-2020 11:09               11485
function.session-abort.php                         28-Sep-2020 11:09                3790
function.session-cache-expire.php                  28-Sep-2020 11:09                6756
function.session-cache-limiter.php                 28-Sep-2020 11:09                8171
function.session-commit.php                        28-Sep-2020 11:09                1697
function.session-create-id.php                     28-Sep-2020 11:09               10653
function.session-decode.php                        28-Sep-2020 11:09                3605
function.session-destroy.php                       28-Sep-2020 11:09                9487
function.session-encode.php                        28-Sep-2020 11:09                3483
function.session-gc.php                            28-Sep-2020 11:09                7788
function.session-get-cookie-params.php             28-Sep-2020 11:09                5459
function.session-id.php                            28-Sep-2020 11:09                5033
function.session-is-registered.php                 28-Sep-2020 11:09                4165
function.session-module-name.php                   28-Sep-2020 11:09                3569
function.session-name.php                          28-Sep-2020 11:09                7038
function.session-regenerate-id.php                 28-Sep-2020 11:09               19900
function.session-register-shutdown.php             28-Sep-2020 11:09                2616
function.session-register.php                      28-Sep-2020 11:09               10313
function.session-reset.php                         28-Sep-2020 11:09                3858
function.session-save-path.php                     28-Sep-2020 11:09                3676
function.session-set-cookie-params.php             28-Sep-2020 11:09                8900
function.session-set-save-handler.php              28-Sep-2020 11:09               30370
function.session-start.php                         28-Sep-2020 11:09               15691
function.session-status.php                        28-Sep-2020 11:09                2841
function.session-unregister.php                    28-Sep-2020 11:09                4862
function.session-unset.php                         28-Sep-2020 11:09                4171
function.session-write-close.php                   28-Sep-2020 11:09                3747
function.set-error-handler.php                     28-Sep-2020 11:08               28939
function.set-exception-handler.php                 28-Sep-2020 11:08                8870
function.set-file-buffer.php                       28-Sep-2020 11:09                1640
function.set-include-path.php                      28-Sep-2020 11:08                6032
function.set-time-limit.php                        28-Sep-2020 11:08                4872
function.setcookie.php                             28-Sep-2020 11:09               26979
function.setlocale.php                             28-Sep-2020 11:09               15652
function.setproctitle.php                          28-Sep-2020 11:09                4204
function.setrawcookie.php                          28-Sep-2020 11:09                5333
function.setthreadtitle.php                        28-Sep-2020 11:09                3932
function.settype.php                               28-Sep-2020 11:09                6305
function.sha1-file.php                             28-Sep-2020 11:09                6133
function.sha1.php                                  28-Sep-2020 11:09                5812
function.shell-exec.php                            28-Sep-2020 11:09                5281
function.shm-attach.php                            28-Sep-2020 11:09                8042
function.shm-detach.php                            28-Sep-2020 11:09                3642
function.shm-get-var.php                           28-Sep-2020 11:09                3529
function.shm-has-var.php                           28-Sep-2020 11:09                3308
function.shm-put-var.php                           28-Sep-2020 11:09                4464
function.shm-remove-var.php                        28-Sep-2020 11:09                3279
function.shm-remove.php                            28-Sep-2020 11:09                3049
function.shmop-close.php                           28-Sep-2020 11:09                4344
function.shmop-delete.php                          28-Sep-2020 11:09                4034
function.shmop-open.php                            28-Sep-2020 11:09                8474
function.shmop-read.php                            28-Sep-2020 11:09                5304
function.shmop-size.php                            28-Sep-2020 11:09                4190
function.shmop-write.php                           28-Sep-2020 11:09                5445
function.show-source.php                           28-Sep-2020 11:09                1621
function.shuffle.php                               28-Sep-2020 11:09                5565
function.similar-text.php                          28-Sep-2020 11:09                7304
function.simplexml-import-dom.php                  28-Sep-2020 11:09                6737
function.simplexml-load-file.php                   28-Sep-2020 11:09               10474
function.simplexml-load-string.php                 28-Sep-2020 11:09                9781
function.sin.php                                   28-Sep-2020 11:09                4530
function.sinh.php                                  28-Sep-2020 11:09                3071
function.sizeof.php                                28-Sep-2020 11:09                1520
function.sleep.php                                 28-Sep-2020 11:09                6480
function.snmp-get-quick-print.php                  28-Sep-2020 11:09                3113
function.snmp-get-valueretrieval.php               28-Sep-2020 11:09                4074
function.snmp-read-mib.php                         28-Sep-2020 11:09                4282
function.snmp-set-enum-print.php                   28-Sep-2020 11:09                4729
function.snmp-set-oid-numeric-print.php            28-Sep-2020 11:09                2415
function.snmp-set-oid-output-format.php            28-Sep-2020 11:09                7355
function.snmp-set-quick-print.php                  28-Sep-2020 11:09                6561
function.snmp-set-valueretrieval.php               28-Sep-2020 11:09                8830
function.snmp2-get.php                             28-Sep-2020 11:09                5130
function.snmp2-getnext.php                         28-Sep-2020 11:09                5501
function.snmp2-real-walk.php                       28-Sep-2020 11:09                5773
function.snmp2-set.php                             28-Sep-2020 11:09                9998
function.snmp2-walk.php                            28-Sep-2020 11:09                6303
function.snmp3-get.php                             28-Sep-2020 11:09                7002
function.snmp3-getnext.php                         28-Sep-2020 11:09                7337
function.snmp3-real-walk.php                       28-Sep-2020 11:09                7991
function.snmp3-set.php                             28-Sep-2020 11:09               12403
function.snmp3-walk.php                            28-Sep-2020 11:09                8296
function.snmpget.php                               28-Sep-2020 11:09                5166
function.snmpgetnext.php                           28-Sep-2020 11:09                5382
function.snmprealwalk.php                          28-Sep-2020 11:09                5654
function.snmpset.php                               28-Sep-2020 11:09               10241
function.snmpwalk.php                              28-Sep-2020 11:09                6404
function.snmpwalkoid.php                           28-Sep-2020 11:09                7277
function.socket-accept.php                         28-Sep-2020 11:09                5930
function.socket-addrinfo-bind.php                  28-Sep-2020 11:09                3747
function.socket-addrinfo-connect.php               28-Sep-2020 11:09                3506
function.socket-addrinfo-explain.php               28-Sep-2020 11:09                3498
function.socket-addrinfo-lookup.php                28-Sep-2020 11:09                4163
function.socket-bind.php                           28-Sep-2020 11:09               10565
function.socket-clear-error.php                    28-Sep-2020 11:09                3646
function.socket-close.php                          28-Sep-2020 11:09                3818
function.socket-cmsg-space.php                     28-Sep-2020 11:09                3354
function.socket-connect.php                        28-Sep-2020 11:09                6082
function.socket-create-listen.php                  28-Sep-2020 11:09                6266
function.socket-create-pair.php                    28-Sep-2020 11:09               20671
function.socket-create.php                         28-Sep-2020 11:09               11858
function.socket-export-stream.php                  28-Sep-2020 11:09                2513
function.socket-get-option.php                     28-Sep-2020 11:09               25130
function.socket-get-status.php                     28-Sep-2020 11:09                1686
function.socket-getopt.php                         28-Sep-2020 11:09                1670
function.socket-getpeername.php                    28-Sep-2020 11:09                7173
function.socket-getsockname.php                    28-Sep-2020 11:09                6495
function.socket-import-stream.php                  28-Sep-2020 11:09                4202
function.socket-last-error.php                     28-Sep-2020 11:09                6204
function.socket-listen.php                         28-Sep-2020 11:09                6789
function.socket-read.php                           28-Sep-2020 11:09                7003
function.socket-recv.php                           28-Sep-2020 11:09               15890
function.socket-recvfrom.php                       28-Sep-2020 11:09               12556
function.socket-recvmsg.php                        28-Sep-2020 11:09                3385
function.socket-select.php                         28-Sep-2020 11:09               15875
function.socket-send.php                           28-Sep-2020 11:09                5501
function.socket-sendmsg.php                        28-Sep-2020 11:09                3475
function.socket-sendto.php                         28-Sep-2020 11:09                8419
function.socket-set-block.php                      28-Sep-2020 11:09                5240
function.socket-set-blocking.php                   28-Sep-2020 11:09                1702
function.socket-set-nonblock.php                   28-Sep-2020 11:09                5639
function.socket-set-option.php                     28-Sep-2020 11:09               10760
function.socket-set-timeout.php                    28-Sep-2020 11:09                1672
function.socket-setopt.php                         28-Sep-2020 11:09                1664
function.socket-shutdown.php                       28-Sep-2020 11:09                4047
function.socket-strerror.php                       28-Sep-2020 11:09                7320
function.socket-write.php                          28-Sep-2020 11:09                6338
function.socket-wsaprotocol-info-export.php        28-Sep-2020 11:09                3982
function.socket-wsaprotocol-info-import.php        28-Sep-2020 11:09                3294
function.socket-wsaprotocol-info-release.php       28-Sep-2020 11:09                3305
function.sodium-add.php                            28-Sep-2020 11:08                2560
function.sodium-base642bin.php                     28-Sep-2020 11:08                2772
function.sodium-bin2base64.php                     28-Sep-2020 11:08                2547
function.sodium-bin2hex.php                        28-Sep-2020 11:08                2310
function.sodium-compare.php                        28-Sep-2020 11:08                2574
function.sodium-crypto-aead-aes256gcm-decrypt.php  28-Sep-2020 11:08                3260
function.sodium-crypto-aead-aes256gcm-encrypt.php  28-Sep-2020 11:08                3300
function.sodium-crypto-aead-aes256gcm-is-availa..> 28-Sep-2020 11:08                2510
function.sodium-crypto-aead-aes256gcm-keygen.php   28-Sep-2020 11:08                2471
function.sodium-crypto-aead-chacha20poly1305-de..> 28-Sep-2020 11:08                3382
function.sodium-crypto-aead-chacha20poly1305-en..> 28-Sep-2020 11:08                3364
function.sodium-crypto-aead-chacha20poly1305-ie..> 28-Sep-2020 11:08                3453
function.sodium-crypto-aead-chacha20poly1305-ie..> 28-Sep-2020 11:08                3417
function.sodium-crypto-aead-chacha20poly1305-ie..> 28-Sep-2020 11:08                2591
function.sodium-crypto-aead-chacha20poly1305-ke..> 28-Sep-2020 11:08                2558
function.sodium-crypto-aead-xchacha20poly1305-i..> 28-Sep-2020 11:08                3426
function.sodium-crypto-aead-xchacha20poly1305-i..> 28-Sep-2020 11:08                3424
function.sodium-crypto-aead-xchacha20poly1305-i..> 28-Sep-2020 11:08                2555
function.sodium-crypto-auth-keygen.php             28-Sep-2020 11:08                2359
function.sodium-crypto-auth-verify.php             28-Sep-2020 11:08                2918
function.sodium-crypto-auth.php                    28-Sep-2020 11:08                2675
function.sodium-crypto-box-keypair-from-secretk..> 28-Sep-2020 11:08                2937
function.sodium-crypto-box-keypair.php             28-Sep-2020 11:08                2402
function.sodium-crypto-box-open.php                28-Sep-2020 11:08                2932
function.sodium-crypto-box-publickey-from-secre..> 28-Sep-2020 11:08                2588
function.sodium-crypto-box-publickey.php           28-Sep-2020 11:08                2493
function.sodium-crypto-box-seal-open.php           28-Sep-2020 11:08                2703
function.sodium-crypto-box-seal.php                28-Sep-2020 11:08                2649
function.sodium-crypto-box-secretkey.php           28-Sep-2020 11:08                2459
function.sodium-crypto-box-seed-keypair.php        28-Sep-2020 11:08                2514
function.sodium-crypto-box.php                     28-Sep-2020 11:08                2847
function.sodium-crypto-generichash-final.php       28-Sep-2020 11:08                2803
function.sodium-crypto-generichash-init.php        28-Sep-2020 11:08                2813
function.sodium-crypto-generichash-keygen.php      28-Sep-2020 11:08                2400
function.sodium-crypto-generichash-update.php      28-Sep-2020 11:08                2762
function.sodium-crypto-generichash.php             28-Sep-2020 11:08                3005
function.sodium-crypto-kdf-derive-from-key.php     28-Sep-2020 11:08                3214
function.sodium-crypto-kdf-keygen.php              28-Sep-2020 11:08                2342
function.sodium-crypto-kx-client-session-keys.php  28-Sep-2020 11:08                2792
function.sodium-crypto-kx-keypair.php              28-Sep-2020 11:08                4897
function.sodium-crypto-kx-publickey.php            28-Sep-2020 11:08                2446
function.sodium-crypto-kx-secretkey.php            28-Sep-2020 11:08                2456
function.sodium-crypto-kx-seed-keypair.php         28-Sep-2020 11:08                2503
function.sodium-crypto-kx-server-session-keys.php  28-Sep-2020 11:08                2858
function.sodium-crypto-pwhash-scryptsalsa208sha..> 28-Sep-2020 11:08                3030
function.sodium-crypto-pwhash-scryptsalsa208sha..> 28-Sep-2020 11:08                3191
function.sodium-crypto-pwhash-scryptsalsa208sha..> 28-Sep-2020 11:08                3592
function.sodium-crypto-pwhash-str-needs-rehash.php 28-Sep-2020 11:08                3061
function.sodium-crypto-pwhash-str-verify.php       28-Sep-2020 11:08                4459
function.sodium-crypto-pwhash-str.php              28-Sep-2020 11:08                8026
function.sodium-crypto-pwhash.php                  28-Sep-2020 11:08                9116
function.sodium-crypto-scalarmult-base.php         28-Sep-2020 11:08                1866
function.sodium-crypto-scalarmult.php              28-Sep-2020 11:08                2741
function.sodium-crypto-secretbox-keygen.php        28-Sep-2020 11:08                2362
function.sodium-crypto-secretbox-open.php          28-Sep-2020 11:08                2958
function.sodium-crypto-secretbox.php               28-Sep-2020 11:08                2949
function.sodium-crypto-secretstream-xchacha20po..> 28-Sep-2020 11:08                2983
function.sodium-crypto-secretstream-xchacha20po..> 28-Sep-2020 11:08                2807
function.sodium-crypto-secretstream-xchacha20po..> 28-Sep-2020 11:08                2640
function.sodium-crypto-secretstream-xchacha20po..> 28-Sep-2020 11:08                3213
function.sodium-crypto-secretstream-xchacha20po..> 28-Sep-2020 11:08                3440
function.sodium-crypto-secretstream-xchacha20po..> 28-Sep-2020 11:08                2764
function.sodium-crypto-shorthash-keygen.php        28-Sep-2020 11:08                2404
function.sodium-crypto-shorthash.php               28-Sep-2020 11:08                2695
function.sodium-crypto-sign-detached.php           28-Sep-2020 11:08                2729
function.sodium-crypto-sign-ed25519-pk-to-curve..> 28-Sep-2020 11:08                2684
function.sodium-crypto-sign-ed25519-sk-to-curve..> 28-Sep-2020 11:08                2740
function.sodium-crypto-sign-keypair-from-secret..> 28-Sep-2020 11:08                2998
function.sodium-crypto-sign-keypair.php            28-Sep-2020 11:08                2415
function.sodium-crypto-sign-open.php               28-Sep-2020 11:08                2742
function.sodium-crypto-sign-publickey-from-secr..> 28-Sep-2020 11:08                2632
function.sodium-crypto-sign-publickey.php          28-Sep-2020 11:08                2514
function.sodium-crypto-sign-secretkey.php          28-Sep-2020 11:08                2482
function.sodium-crypto-sign-seed-keypair.php       28-Sep-2020 11:08                2559
function.sodium-crypto-sign-verify-detached.php    28-Sep-2020 11:08                3011
function.sodium-crypto-sign.php                    28-Sep-2020 11:08                2638
function.sodium-crypto-stream-keygen.php           28-Sep-2020 11:08                2315
function.sodium-crypto-stream-xor.php              28-Sep-2020 11:08                2882
function.sodium-crypto-stream.php                  28-Sep-2020 11:08                2868
function.sodium-hex2bin.php                        28-Sep-2020 11:08                2954
function.sodium-increment.php                      28-Sep-2020 11:08                2361
function.sodium-memcmp.php                         28-Sep-2020 11:08                2538
function.sodium-memzero.php                        28-Sep-2020 11:08                2337
function.sodium-pad.php                            28-Sep-2020 11:08                2497
function.sodium-unpad.php                          28-Sep-2020 11:08                2508
function.solr-get-version.php                      28-Sep-2020 11:09                3807
function.sort.php                                  28-Sep-2020 11:09               12472
function.soundex.php                               28-Sep-2020 11:09                6884
function.spl-autoload-call.php                     28-Sep-2020 11:09                2463
function.spl-autoload-extensions.php               28-Sep-2020 11:09                4089
function.spl-autoload-functions.php                28-Sep-2020 11:09                2472
function.spl-autoload-register.php                 28-Sep-2020 11:09                9801
function.spl-autoload-unregister.php               28-Sep-2020 11:09                2857
function.spl-autoload.php                          28-Sep-2020 11:09                3620
function.spl-classes.php                           28-Sep-2020 11:09                3695
function.spl-object-hash.php                       28-Sep-2020 11:09                3890
function.spl-object-id.php                         28-Sep-2020 11:09                3964
function.split.php                                 28-Sep-2020 11:09               11678
function.spliti.php                                28-Sep-2020 11:09                8433
function.sprintf.php                               28-Sep-2020 11:09               25404
function.sql-regcase.php                           28-Sep-2020 11:09                4726
function.sqlite-array-query.php                    28-Sep-2020 11:09               12988
function.sqlite-busy-timeout.php                   28-Sep-2020 11:09                7416
function.sqlite-changes.php                        28-Sep-2020 11:09                6991
function.sqlite-close.php                          28-Sep-2020 11:09                4268
function.sqlite-column.php                         28-Sep-2020 11:09                6199
function.sqlite-create-aggregate.php               28-Sep-2020 11:09               15490
function.sqlite-create-function.php                28-Sep-2020 11:09               12844
function.sqlite-current.php                        28-Sep-2020 11:09                7124
function.sqlite-error-string.php                   28-Sep-2020 11:09                3290
function.sqlite-escape-string.php                  28-Sep-2020 11:09                5482
function.sqlite-exec.php                           28-Sep-2020 11:09               11291
function.sqlite-fetch-all.php                      28-Sep-2020 11:09               12415
function.sqlite-fetch-array.php                    28-Sep-2020 11:09               11584
function.sqlite-fetch-single.php                   28-Sep-2020 11:09                7678
function.sqlite-fetch-string.php                   28-Sep-2020 11:09                1722
function.sqlite-field-name.php                     28-Sep-2020 11:09                4258
function.sqlite-has-more.php                       28-Sep-2020 11:09                3189
function.sqlite-last-error.php                     28-Sep-2020 11:09                3862
function.sqlite-last-insert-rowid.php              28-Sep-2020 11:09                3590
function.sqlite-libencoding.php                    28-Sep-2020 11:09                4127
function.sqlite-libversion.php                     28-Sep-2020 11:09                2378
function.sqlite-next.php                           28-Sep-2020 11:09                4065
function.sqlite-num-fields.php                     28-Sep-2020 11:09                3880
function.sqlite-num-rows.php                       28-Sep-2020 11:09                7039
function.sqlite-open.php                           28-Sep-2020 11:09               10292
function.sqlite-popen.php                          28-Sep-2020 11:09                6518
function.sqlite-query.php                          28-Sep-2020 11:09                9929
function.sqlite-rewind.php                         28-Sep-2020 11:09                3912
function.sqlite-seek.php                           28-Sep-2020 11:09                4522
function.sqlite-single-query.php                   28-Sep-2020 11:09                3068
function.sqlite-udf-decode-binary.php              28-Sep-2020 11:09               10369
function.sqlite-udf-encode-binary.php              28-Sep-2020 11:09                5140
function.sqlite-unbuffered-query.php               28-Sep-2020 11:09                8993
function.sqlsrv-begin-transaction.php              28-Sep-2020 11:09               11984
function.sqlsrv-cancel.php                         28-Sep-2020 11:09               10668
function.sqlsrv-client-info.php                    28-Sep-2020 11:09                6847
function.sqlsrv-close.php                          28-Sep-2020 11:09                5483
function.sqlsrv-commit.php                         28-Sep-2020 11:09               11827
function.sqlsrv-configure.php                      28-Sep-2020 11:09                4376
function.sqlsrv-connect.php                        28-Sep-2020 11:09               12622
function.sqlsrv-errors.php                         28-Sep-2020 11:09               10535
function.sqlsrv-execute.php                        28-Sep-2020 11:09               10785
function.sqlsrv-fetch-array.php                    28-Sep-2020 11:09               14945
function.sqlsrv-fetch-object.php                   28-Sep-2020 11:09               12092
function.sqlsrv-fetch.php                          28-Sep-2020 11:09               11024
function.sqlsrv-field-metadata.php                 28-Sep-2020 11:09                8914
function.sqlsrv-free-stmt.php                      28-Sep-2020 11:09                7690
function.sqlsrv-get-config.php                     28-Sep-2020 11:09                3155
function.sqlsrv-get-field.php                      28-Sep-2020 11:09               10573
function.sqlsrv-has-rows.php                       28-Sep-2020 11:09                6380
function.sqlsrv-next-result.php                    28-Sep-2020 11:09                9526
function.sqlsrv-num-fields.php                     28-Sep-2020 11:09                8480
function.sqlsrv-num-rows.php                       28-Sep-2020 11:09                7997
function.sqlsrv-prepare.php                        28-Sep-2020 11:09               14685
function.sqlsrv-query.php                          28-Sep-2020 11:09               11425
function.sqlsrv-rollback.php                       28-Sep-2020 11:09               11295
function.sqlsrv-rows-affected.php                  28-Sep-2020 11:09                8038
function.sqlsrv-send-stream-data.php               28-Sep-2020 11:09                8878
function.sqlsrv-server-info.php                    28-Sep-2020 11:09                6232
function.sqrt.php                                  28-Sep-2020 11:09                3808
function.srand.php                                 28-Sep-2020 11:09                6406
function.sscanf.php                                28-Sep-2020 11:09               11989
function.ssdeep-fuzzy-compare.php                  28-Sep-2020 11:09                2947
function.ssdeep-fuzzy-hash-filename.php            28-Sep-2020 11:09                2712
function.ssdeep-fuzzy-hash.php                     28-Sep-2020 11:09                2569
function.ssh2-auth-agent.php                       28-Sep-2020 11:09                4491
function.ssh2-auth-hostbased-file.php              28-Sep-2020 11:09                7419
function.ssh2-auth-none.php                        28-Sep-2020 11:09                4716
function.ssh2-auth-password.php                    28-Sep-2020 11:09                4699
function.ssh2-auth-pubkey-file.php                 28-Sep-2020 11:09                6926
function.ssh2-connect.php                          28-Sep-2020 11:09               15499
function.ssh2-disconnect.php                       28-Sep-2020 11:09                2804
function.ssh2-exec.php                             28-Sep-2020 11:09                6667
function.ssh2-fetch-stream.php                     28-Sep-2020 11:09                5310
function.ssh2-fingerprint.php                      28-Sep-2020 11:09                5233
function.ssh2-methods-negotiated.php               28-Sep-2020 11:09                8061
function.ssh2-publickey-add.php                    28-Sep-2020 11:09                7918
function.ssh2-publickey-init.php                   28-Sep-2020 11:09                4361
function.ssh2-publickey-list.php                   28-Sep-2020 11:09                8890
function.ssh2-publickey-remove.php                 28-Sep-2020 11:09                4419
function.ssh2-scp-recv.php                         28-Sep-2020 11:09                5141
function.ssh2-scp-send.php                         28-Sep-2020 11:09                5600
function.ssh2-sftp-chmod.php                       28-Sep-2020 11:09                5694
function.ssh2-sftp-lstat.php                       28-Sep-2020 11:09                7250
function.ssh2-sftp-mkdir.php                       28-Sep-2020 11:09                6235
function.ssh2-sftp-readlink.php                    28-Sep-2020 11:09                5194
function.ssh2-sftp-realpath.php                    28-Sep-2020 11:09                5444
function.ssh2-sftp-rename.php                      28-Sep-2020 11:09                5241
function.ssh2-sftp-rmdir.php                       28-Sep-2020 11:09                5311
function.ssh2-sftp-stat.php                        28-Sep-2020 11:09                7149
function.ssh2-sftp-symlink.php                     28-Sep-2020 11:09                5446
function.ssh2-sftp-unlink.php                      28-Sep-2020 11:09                4750
function.ssh2-sftp.php                             28-Sep-2020 11:09                5212
function.ssh2-shell.php                            28-Sep-2020 11:09                6904
function.ssh2-tunnel.php                           28-Sep-2020 11:09                5117
function.stat.php                                  28-Sep-2020 11:09               16487
function.stomp-connect-error.php                   28-Sep-2020 11:09                3577
function.stomp-version.php                         28-Sep-2020 11:09                3006
function.str-getcsv.php                            28-Sep-2020 11:09                5999
function.str-ireplace.php                          28-Sep-2020 11:09                8487
function.str-pad.php                               28-Sep-2020 11:09                7806
function.str-repeat.php                            28-Sep-2020 11:09                4633
function.str-replace.php                           28-Sep-2020 11:09               17798
function.str-rot13.php                             28-Sep-2020 11:09                3561
function.str-shuffle.php                           28-Sep-2020 11:09                5504
function.str-split.php                             28-Sep-2020 11:09                6971
function.str-word-count.php                        28-Sep-2020 11:09                9218
function.strcasecmp.php                            28-Sep-2020 11:09                5996
function.strchr.php                                28-Sep-2020 11:09                1533
function.strcmp.php                                28-Sep-2020 11:09                5629
function.strcoll.php                               28-Sep-2020 11:09                5232
function.strcspn.php                               28-Sep-2020 11:09               10595
function.stream-bucket-append.php                  28-Sep-2020 11:09                2034
function.stream-bucket-make-writeable.php          28-Sep-2020 11:09                1983
function.stream-bucket-new.php                     28-Sep-2020 11:09                2032
function.stream-bucket-prepend.php                 28-Sep-2020 11:09                6532
function.stream-context-create.php                 28-Sep-2020 11:09                6623
function.stream-context-get-default.php            28-Sep-2020 11:09                8607
function.stream-context-get-options.php            28-Sep-2020 11:09                4348
function.stream-context-get-params.php             28-Sep-2020 11:09                5377
function.stream-context-set-default.php            28-Sep-2020 11:09                6340
function.stream-context-set-option.php             28-Sep-2020 11:09                4234
function.stream-context-set-params.php             28-Sep-2020 11:09                4482
function.stream-copy-to-stream.php                 28-Sep-2020 11:09                6497
function.stream-filter-append.php                  28-Sep-2020 11:09               10607
function.stream-filter-prepend.php                 28-Sep-2020 11:09                7369
function.stream-filter-register.php                28-Sep-2020 11:09               19706
function.stream-filter-remove.php                  28-Sep-2020 11:09                6503
function.stream-get-contents.php                   28-Sep-2020 11:09                7768
function.stream-get-filters.php                    28-Sep-2020 11:09                3753
function.stream-get-line.php                       28-Sep-2020 11:09                4418
function.stream-get-meta-data.php                  28-Sep-2020 11:09                9924
function.stream-get-transports.php                 28-Sep-2020 11:09                3733
function.stream-get-wrappers.php                   28-Sep-2020 11:09                4637
function.stream-is-local.php                       28-Sep-2020 11:09                3949
function.stream-isatty.php                         28-Sep-2020 11:09                3747
function.stream-notification-callback.php          28-Sep-2020 11:09               25007
function.stream-register-wrapper.php               28-Sep-2020 11:09                1783
function.stream-resolve-include-path.php           28-Sep-2020 11:09                3978
function.stream-select.php                         28-Sep-2020 11:09               14577
function.stream-set-blocking.php                   28-Sep-2020 11:09                4753
function.stream-set-chunk-size.php                 28-Sep-2020 11:09                3108
function.stream-set-read-buffer.php                28-Sep-2020 11:09                3476
function.stream-set-timeout.php                    28-Sep-2020 11:09                8080
function.stream-set-write-buffer.php               28-Sep-2020 11:09                5766
function.stream-socket-accept.php                  28-Sep-2020 11:09                6441
function.stream-socket-client.php                  28-Sep-2020 11:09               15897
function.stream-socket-enable-crypto.php           28-Sep-2020 11:09               11389
function.stream-socket-get-name.php                28-Sep-2020 11:09                3301
function.stream-socket-pair.php                    28-Sep-2020 11:09                8990
function.stream-socket-recvfrom.php                28-Sep-2020 11:09               10249
function.stream-socket-sendto.php                  28-Sep-2020 11:09                6922
function.stream-socket-server.php                  28-Sep-2020 11:09               14151
function.stream-socket-shutdown.php                28-Sep-2020 11:09                6147
function.stream-supports-lock.php                  28-Sep-2020 11:09                2942
function.stream-wrapper-register.php               28-Sep-2020 11:09                9008
function.stream-wrapper-restore.php                28-Sep-2020 11:09                2609
function.stream-wrapper-unregister.php             28-Sep-2020 11:09                2807
function.strftime.php                              28-Sep-2020 11:09               61857
function.strip-tags.php                            28-Sep-2020 11:09                9599
function.stripcslashes.php                         28-Sep-2020 11:09                2943
function.stripos.php                               28-Sep-2020 11:09               11026
function.stripslashes.php                          28-Sep-2020 11:09                8133
function.stristr.php                               28-Sep-2020 11:09                9853
function.strlen.php                                28-Sep-2020 11:09                6067
function.strnatcasecmp.php                         28-Sep-2020 11:09                5388
function.strnatcmp.php                             28-Sep-2020 11:09                8481
function.strncasecmp.php                           28-Sep-2020 11:09                4873
function.strncmp.php                               28-Sep-2020 11:09                4833
function.strpbrk.php                               28-Sep-2020 11:09                5296
function.strpos.php                                28-Sep-2020 11:09               13824
function.strptime.php                              28-Sep-2020 11:09               10579
function.strrchr.php                               28-Sep-2020 11:09                6509
function.strrev.php                                28-Sep-2020 11:09                3048
function.strripos.php                              28-Sep-2020 11:09                9769
function.strrpos.php                               28-Sep-2020 11:09               12869
function.strspn.php                                28-Sep-2020 11:09               10018
function.strstr.php                                28-Sep-2020 11:09                8391
function.strtok.php                                28-Sep-2020 11:09                8815
function.strtolower.php                            28-Sep-2020 11:09                5115
function.strtotime.php                             28-Sep-2020 11:09               15913
function.strtoupper.php                            28-Sep-2020 11:09                5100
function.strtr.php                                 28-Sep-2020 11:09               12114
function.strval.php                                28-Sep-2020 11:09                6610
function.substr-compare.php                        28-Sep-2020 11:09               10750
function.substr-count.php                          28-Sep-2020 11:09                9738
function.substr-replace.php                        28-Sep-2020 11:09               16373
function.substr.php                                28-Sep-2020 11:09               22965
function.svn-add.php                               28-Sep-2020 11:09                5995
function.svn-auth-get-parameter.php                28-Sep-2020 11:09                3798
function.svn-auth-set-parameter.php                28-Sep-2020 11:09                5310
function.svn-blame.php                             28-Sep-2020 11:09                4800
function.svn-cat.php                               28-Sep-2020 11:09                4623
function.svn-checkout.php                          28-Sep-2020 11:09                7071
function.svn-cleanup.php                           28-Sep-2020 11:09                5080
function.svn-client-version.php                    28-Sep-2020 11:09                3243
function.svn-commit.php                            28-Sep-2020 11:09                7818
function.svn-delete.php                            28-Sep-2020 11:09                4405
function.svn-diff.php                              28-Sep-2020 11:09               13299
function.svn-export.php                            28-Sep-2020 11:09                4776
function.svn-fs-abort-txn.php                      28-Sep-2020 11:09                2485
function.svn-fs-apply-text.php                     28-Sep-2020 11:09                2588
function.svn-fs-begin-txn2.php                     28-Sep-2020 11:09                2533
function.svn-fs-change-node-prop.php               28-Sep-2020 11:09                2833
function.svn-fs-check-path.php                     28-Sep-2020 11:09                2639
function.svn-fs-contents-changed.php               28-Sep-2020 11:09                2834
function.svn-fs-copy.php                           28-Sep-2020 11:09                2806
function.svn-fs-delete.php                         28-Sep-2020 11:09                2574
function.svn-fs-dir-entries.php                    28-Sep-2020 11:09                2651
function.svn-fs-file-contents.php                  28-Sep-2020 11:09                2666
function.svn-fs-file-length.php                    28-Sep-2020 11:09                2597
function.svn-fs-is-dir.php                         28-Sep-2020 11:09                2560
function.svn-fs-is-file.php                        28-Sep-2020 11:09                2550
function.svn-fs-make-dir.php                       28-Sep-2020 11:09                2594
function.svn-fs-make-file.php                      28-Sep-2020 11:09                2608
function.svn-fs-node-created-rev.php               28-Sep-2020 11:09                2635
function.svn-fs-node-prop.php                      28-Sep-2020 11:09                2682
function.svn-fs-props-changed.php                  28-Sep-2020 11:09                2824
function.svn-fs-revision-prop.php                  28-Sep-2020 11:09                2693
function.svn-fs-revision-root.php                  28-Sep-2020 11:09                2613
function.svn-fs-txn-root.php                       28-Sep-2020 11:09                2437
function.svn-fs-youngest-rev.php                   28-Sep-2020 11:09                2481
function.svn-import.php                            28-Sep-2020 11:09                5826
function.svn-log.php                               28-Sep-2020 11:09                8531
function.svn-ls.php                                28-Sep-2020 11:09                6896
function.svn-mkdir.php                             28-Sep-2020 11:09                2921
function.svn-repos-create.php                      28-Sep-2020 11:09                2682
function.svn-repos-fs-begin-txn-for-commit.php     28-Sep-2020 11:09                2880
function.svn-repos-fs-commit-txn.php               28-Sep-2020 11:09                2532
function.svn-repos-fs.php                          28-Sep-2020 11:09                2437
function.svn-repos-hotcopy.php                     28-Sep-2020 11:09                2699
function.svn-repos-open.php                        28-Sep-2020 11:09                2411
function.svn-repos-recover.php                     28-Sep-2020 11:09                2457
function.svn-revert.php                            28-Sep-2020 11:09                3247
function.svn-status.php                            28-Sep-2020 11:09               14616
function.svn-update.php                            28-Sep-2020 11:09                5951
function.swoole-async-dns-lookup.php               28-Sep-2020 11:09                3496
function.swoole-async-read.php                     28-Sep-2020 11:09                3990
function.swoole-async-readfile.php                 28-Sep-2020 11:09                3521
function.swoole-async-set.php                      28-Sep-2020 11:09                2045
function.swoole-async-write.php                    28-Sep-2020 11:09                3182
function.swoole-async-writefile.php                28-Sep-2020 11:09                3243
function.swoole-client-select.php                  28-Sep-2020 11:09                3035
function.swoole-cpu-num.php                        28-Sep-2020 11:09                2013
function.swoole-errno.php                          28-Sep-2020 11:09                1996
function.swoole-event-add.php                      28-Sep-2020 11:09                3072
function.swoole-event-defer.php                    28-Sep-2020 11:09                2398
function.swoole-event-del.php                      28-Sep-2020 11:09                2308
function.swoole-event-exit.php                     28-Sep-2020 11:09                2086
function.swoole-event-set.php                      28-Sep-2020 11:09                3071
function.swoole-event-wait.php                     28-Sep-2020 11:09                2057
function.swoole-event-write.php                    28-Sep-2020 11:09                2530
function.swoole-get-local-ip.php                   28-Sep-2020 11:09                2079
function.swoole-last-error.php                     28-Sep-2020 11:09                2040
function.swoole-load-module.php                    28-Sep-2020 11:09                2180
function.swoole-select.php                         28-Sep-2020 11:09                2964
function.swoole-set-process-name.php               28-Sep-2020 11:09                2400
function.swoole-strerror.php                       28-Sep-2020 11:09                2329
function.swoole-timer-after.php                    28-Sep-2020 11:09                2807
function.swoole-timer-exists.php                   28-Sep-2020 11:09                2215
function.swoole-timer-tick.php                     28-Sep-2020 11:09                2681
function.swoole-version.php                        28-Sep-2020 11:09                2016
function.symlink.php                               28-Sep-2020 11:09                5681
function.sys-get-temp-dir.php                      28-Sep-2020 11:08                3942
function.sys-getloadavg.php                        28-Sep-2020 11:09                3852
function.syslog.php                                28-Sep-2020 11:09                9398
function.system.php                                28-Sep-2020 11:09                8711
function.taint.php                                 28-Sep-2020 11:09                2411
function.tan.php                                   28-Sep-2020 11:09                4113
function.tanh.php                                  28-Sep-2020 11:09                3071
function.tcpwrap-check.php                         28-Sep-2020 11:09                5163
function.tempnam.php                               28-Sep-2020 11:09                6362
function.textdomain.php                            28-Sep-2020 11:09                2741
function.tidy-access-count.php                     28-Sep-2020 11:09                6423
function.tidy-config-count.php                     28-Sep-2020 11:09                4241
function.tidy-error-count.php                      28-Sep-2020 11:09                5222
function.tidy-get-output.php                       28-Sep-2020 11:09                4120
function.tidy-warning-count.php                    28-Sep-2020 11:09                4801
function.time-nanosleep.php                        28-Sep-2020 11:09                9483
function.time-sleep-until.php                      28-Sep-2020 11:09                6280
function.time.php                                  28-Sep-2020 11:09                5791
function.timezone-abbreviations-list.php           28-Sep-2020 11:09                1780
function.timezone-identifiers-list.php             28-Sep-2020 11:09                1798
function.timezone-location-get.php                 28-Sep-2020 11:09                1758
function.timezone-name-from-abbr.php               28-Sep-2020 11:09                5872
function.timezone-name-get.php                     28-Sep-2020 11:09                1706
function.timezone-offset-get.php                   28-Sep-2020 11:09                1702
function.timezone-open.php                         28-Sep-2020 11:09                1696
function.timezone-transitions-get.php              28-Sep-2020 11:09                1758
function.timezone-version-get.php                  28-Sep-2020 11:09                3182
function.tmpfile.php                               28-Sep-2020 11:09                5162
function.token-get-all.php                         28-Sep-2020 11:09               12715
function.token-name.php                            28-Sep-2020 11:09                3993
function.touch.php                                 28-Sep-2020 11:09                7134
function.trader-acos.php                           28-Sep-2020 11:09                2268
function.trader-ad.php                             28-Sep-2020 11:09                2920
function.trader-add.php                            28-Sep-2020 11:09                2549
function.trader-adosc.php                          28-Sep-2020 11:09                3553
function.trader-adx.php                            28-Sep-2020 11:09                2970
function.trader-adxr.php                           28-Sep-2020 11:09                2980
function.trader-apo.php                            28-Sep-2020 11:09                3100
function.trader-aroon.php                          28-Sep-2020 11:09                2699
function.trader-aroonosc.php                       28-Sep-2020 11:09                2733
function.trader-asin.php                           28-Sep-2020 11:09                2282
function.trader-atan.php                           28-Sep-2020 11:09                2275
function.trader-atr.php                            28-Sep-2020 11:09                2960
function.trader-avgprice.php                       28-Sep-2020 11:09                2971
function.trader-bbands.php                         28-Sep-2020 11:09                3744
function.trader-beta.php                           28-Sep-2020 11:09                2668
function.trader-bop.php                            28-Sep-2020 11:09                2925
function.trader-cci.php                            28-Sep-2020 11:09                2965
function.trader-cdl2crows.php                      28-Sep-2020 11:09                2992
function.trader-cdl3blackcrows.php                 28-Sep-2020 11:09                3049
function.trader-cdl3inside.php                     28-Sep-2020 11:09                3034
function.trader-cdl3linestrike.php                 28-Sep-2020 11:09                3053
function.trader-cdl3outside.php                    28-Sep-2020 11:09                3048
function.trader-cdl3starsinsouth.php               28-Sep-2020 11:09                3092
function.trader-cdl3whitesoldiers.php              28-Sep-2020 11:09                3115
function.trader-cdlabandonedbaby.php               28-Sep-2020 11:09                3392
function.trader-cdladvanceblock.php                28-Sep-2020 11:09                3070
function.trader-cdlbelthold.php                    28-Sep-2020 11:09                3030
function.trader-cdlbreakaway.php                   28-Sep-2020 11:09                3043
function.trader-cdlclosingmarubozu.php             28-Sep-2020 11:09                3108
function.trader-cdlconcealbabyswall.php            28-Sep-2020 11:09                3130
function.trader-cdlcounterattack.php               28-Sep-2020 11:09                3097
function.trader-cdldarkcloudcover.php              28-Sep-2020 11:09                3385
function.trader-cdldoji.php                        28-Sep-2020 11:09                2991
function.trader-cdldojistar.php                    28-Sep-2020 11:09                3022
function.trader-cdldragonflydoji.php               28-Sep-2020 11:09                3072
function.trader-cdlengulfing.php                   28-Sep-2020 11:09                3061
function.trader-cdleveningdojistar.php             28-Sep-2020 11:09                3401
function.trader-cdleveningstar.php                 28-Sep-2020 11:09                3382
function.trader-cdlgapsidesidewhite.php            28-Sep-2020 11:09                3137
function.trader-cdlgravestonedoji.php              28-Sep-2020 11:09                3092
function.trader-cdlhammer.php                      28-Sep-2020 11:09                3015
function.trader-cdlhangingman.php                  28-Sep-2020 11:09                3032
function.trader-cdlharami.php                      28-Sep-2020 11:09                3017
function.trader-cdlharamicross.php                 28-Sep-2020 11:09                3054
function.trader-cdlhighwave.php                    28-Sep-2020 11:09                3031
function.trader-cdlhikkake.php                     28-Sep-2020 11:09                3021
function.trader-cdlhikkakemod.php                  28-Sep-2020 11:09                3059
function.trader-cdlhomingpigeon.php                28-Sep-2020 11:09                3078
function.trader-cdlidentical3crows.php             28-Sep-2020 11:09                3099
function.trader-cdlinneck.php                      28-Sep-2020 11:09                3034
function.trader-cdlinvertedhammer.php              28-Sep-2020 11:09                3074
function.trader-cdlkicking.php                     28-Sep-2020 11:09                3035
function.trader-cdlkickingbylength.php             28-Sep-2020 11:09                3133
function.trader-cdlladderbottom.php                28-Sep-2020 11:09                3086
function.trader-cdllongleggeddoji.php              28-Sep-2020 11:09                3089
function.trader-cdllongline.php                    28-Sep-2020 11:09                3039
function.trader-cdlmarubozu.php                    28-Sep-2020 11:09                3025
function.trader-cdlmatchinglow.php                 28-Sep-2020 11:09                3048
function.trader-cdlmathold.php                     28-Sep-2020 11:09                3332
function.trader-cdlmorningdojistar.php             28-Sep-2020 11:09                3397
function.trader-cdlmorningstar.php                 28-Sep-2020 11:09                3362
function.trader-cdlonneck.php                      28-Sep-2020 11:09                3014
function.trader-cdlpiercing.php                    28-Sep-2020 11:09                3029
function.trader-cdlrickshawman.php                 28-Sep-2020 11:09                3066
function.trader-cdlrisefall3methods.php            28-Sep-2020 11:09                3131
function.trader-cdlseparatinglines.php             28-Sep-2020 11:09                3114
function.trader-cdlshootingstar.php                28-Sep-2020 11:09                3076
function.trader-cdlshortline.php                   28-Sep-2020 11:09                3051
function.trader-cdlspinningtop.php                 28-Sep-2020 11:09                3064
function.trader-cdlstalledpattern.php              28-Sep-2020 11:09                3096
function.trader-cdlsticksandwich.php               28-Sep-2020 11:09                3078
function.trader-cdltakuri.php                      28-Sep-2020 11:09                3056
function.trader-cdltasukigap.php                   28-Sep-2020 11:09                3028
function.trader-cdlthrusting.php                   28-Sep-2020 11:09                3037
function.trader-cdltristar.php                     28-Sep-2020 11:09                3027
function.trader-cdlunique3river.php                28-Sep-2020 11:09                3073
function.trader-cdlupsidegap2crows.php             28-Sep-2020 11:09                3118
function.trader-cdlxsidegap3methods.php            28-Sep-2020 11:09                3116
function.trader-ceil.php                           28-Sep-2020 11:09                2299
function.trader-cmo.php                            28-Sep-2020 11:09                2432
function.trader-correl.php                         28-Sep-2020 11:09                2718
function.trader-cos.php                            28-Sep-2020 11:09                2266
function.trader-cosh.php                           28-Sep-2020 11:09                2281
function.trader-dema.php                           28-Sep-2020 11:09                2442
function.trader-div.php                            28-Sep-2020 11:09                2565
function.trader-dx.php                             28-Sep-2020 11:09                2947
function.trader-ema.php                            28-Sep-2020 11:09                2426
function.trader-errno.php                          28-Sep-2020 11:09                1890
function.trader-exp.php                            28-Sep-2020 11:09                2310
function.trader-floor.php                          28-Sep-2020 11:09                2290
function.trader-get-compat.php                     28-Sep-2020 11:09                2070
function.trader-get-unstable-period.php            28-Sep-2020 11:09                2498
function.trader-ht-dcperiod.php                    28-Sep-2020 11:09                2272
function.trader-ht-dcphase.php                     28-Sep-2020 11:09                2244
function.trader-ht-phasor.php                      28-Sep-2020 11:09                2226
function.trader-ht-sine.php                        28-Sep-2020 11:09                2207
function.trader-ht-trendline.php                   28-Sep-2020 11:09                2263
function.trader-ht-trendmode.php                   28-Sep-2020 11:09                2253
function.trader-kama.php                           28-Sep-2020 11:09                2480
function.trader-linearreg-angle.php                28-Sep-2020 11:09                2563
function.trader-linearreg-intercept.php            28-Sep-2020 11:09                2617
function.trader-linearreg-slope.php                28-Sep-2020 11:09                2573
function.trader-linearreg.php                      28-Sep-2020 11:09                2491
function.trader-ln.php                             28-Sep-2020 11:09                2269
function.trader-log10.php                          28-Sep-2020 11:09                2270
function.trader-ma.php                             28-Sep-2020 11:09                2763
function.trader-macd.php                           28-Sep-2020 11:09                3084
function.trader-macdext.php                        28-Sep-2020 11:09                4238
function.trader-macdfix.php                        28-Sep-2020 11:09                2523
function.trader-mama.php                           28-Sep-2020 11:09                2782
function.trader-mavp.php                           28-Sep-2020 11:09                3414
function.trader-max.php                            28-Sep-2020 11:09                2447
function.trader-maxindex.php                       28-Sep-2020 11:09                2499
function.trader-medprice.php                       28-Sep-2020 11:09                2448
function.trader-mfi.php                            28-Sep-2020 11:09                3232
function.trader-midpoint.php                       28-Sep-2020 11:09                2473
function.trader-midprice.php                       28-Sep-2020 11:09                2747
function.trader-min.php                            28-Sep-2020 11:09                2454
function.trader-minindex.php                       28-Sep-2020 11:09                2494
function.trader-minmax.php                         28-Sep-2020 11:09                2500
function.trader-minmaxindex.php                    28-Sep-2020 11:09                2546
function.trader-minus-di.php                       28-Sep-2020 11:09                3028
function.trader-minus-dm.php                       28-Sep-2020 11:09                2747
function.trader-mom.php                            28-Sep-2020 11:09                2418
function.trader-mult.php                           28-Sep-2020 11:09                2564
function.trader-natr.php                           28-Sep-2020 11:09                2970
function.trader-obv.php                            28-Sep-2020 11:09                2406
function.trader-plus-di.php                        28-Sep-2020 11:09                3000
function.trader-plus-dm.php                        28-Sep-2020 11:09                2735
function.trader-ppo.php                            28-Sep-2020 11:09                3104
function.trader-roc.php                            28-Sep-2020 11:09                2442
function.trader-rocp.php                           28-Sep-2020 11:09                2469
function.trader-rocr.php                           28-Sep-2020 11:09                2454
function.trader-rocr100.php                        28-Sep-2020 11:09                2491
function.trader-rsi.php                            28-Sep-2020 11:09                2423
function.trader-sar.php                            28-Sep-2020 11:09                3185
function.trader-sarext.php                         28-Sep-2020 11:09                5922
function.trader-set-compat.php                     28-Sep-2020 11:09                2456
function.trader-set-unstable-period.php            28-Sep-2020 11:09                2985
function.trader-sin.php                            28-Sep-2020 11:09                2290
function.trader-sinh.php                           28-Sep-2020 11:09                2277
function.trader-sma.php                            28-Sep-2020 11:09                2423
function.trader-sqrt.php                           28-Sep-2020 11:09                2270
function.trader-stddev.php                         28-Sep-2020 11:09                2679
function.trader-stoch.php                          28-Sep-2020 11:09                4388
function.trader-stochf.php                         28-Sep-2020 11:09                3718
function.trader-stochrsi.php                       28-Sep-2020 11:09                3500
function.trader-sub.php                            28-Sep-2020 11:09                2570
function.trader-sum.php                            28-Sep-2020 11:09                2405
function.trader-t3.php                             28-Sep-2020 11:09                2700
function.trader-tan.php                            28-Sep-2020 11:09                2259
function.trader-tanh.php                           28-Sep-2020 11:09                2282
function.trader-tema.php                           28-Sep-2020 11:09                2448
function.trader-trange.php                         28-Sep-2020 11:09                2688
function.trader-trima.php                          28-Sep-2020 11:09                2449
function.trader-trix.php                           28-Sep-2020 11:09                2460
function.trader-tsf.php                            28-Sep-2020 11:09                2430
function.trader-typprice.php                       28-Sep-2020 11:09                2709
function.trader-ultosc.php                         28-Sep-2020 11:09                3601
function.trader-var.php                            28-Sep-2020 11:09                2652
function.trader-wclprice.php                       28-Sep-2020 11:09                2714
function.trader-willr.php                          28-Sep-2020 11:09                2975
function.trader-wma.php                            28-Sep-2020 11:09                2439
function.trait-exists.php                          28-Sep-2020 11:09                2578
function.trigger-error.php                         28-Sep-2020 11:08                6393
function.trim.php                                  28-Sep-2020 11:09               14162
function.uasort.php                                28-Sep-2020 11:09                8346
function.ucfirst.php                               28-Sep-2020 11:09                5704
function.ucwords.php                               28-Sep-2020 11:09               10434
function.ui-draw-text-font-fontfamilies.php        28-Sep-2020 11:09                1948
function.ui-quit.php                               28-Sep-2020 11:09                1971
function.ui-run.php                                28-Sep-2020 11:09                2224
function.uksort.php                                28-Sep-2020 11:09                8232
function.umask.php                                 28-Sep-2020 11:09                4867
function.uniqid.php                                28-Sep-2020 11:09                7635
function.unixtojd.php                              28-Sep-2020 11:09                2987
function.unlink.php                                28-Sep-2020 11:09                5371
function.unpack.php                                28-Sep-2020 11:09               10641
function.unregister-tick-function.php              28-Sep-2020 11:09                3046
function.unserialize.php                           28-Sep-2020 11:09               17258
function.unset.php                                 28-Sep-2020 11:09               15378
function.untaint.php                               28-Sep-2020 11:09                2265
function.uopz-add-function.php                     28-Sep-2020 11:08                6324
function.uopz-allow-exit.php                       28-Sep-2020 11:08                4465
function.uopz-backup.php                           28-Sep-2020 11:08                4323
function.uopz-compose.php                          28-Sep-2020 11:08                6571
function.uopz-copy.php                             28-Sep-2020 11:08                5037
function.uopz-del-function.php                     28-Sep-2020 11:08                6019
function.uopz-delete.php                           28-Sep-2020 11:08                5821
function.uopz-extend.php                           28-Sep-2020 11:08                4646
function.uopz-flags.php                            28-Sep-2020 11:08               10645
function.uopz-function.php                         28-Sep-2020 11:08                6862
function.uopz-get-exit-status.php                  28-Sep-2020 11:08                4096
function.uopz-get-hook.php                         28-Sep-2020 11:08                5095
function.uopz-get-mock.php                         28-Sep-2020 11:08                5045
function.uopz-get-property.php                     28-Sep-2020 11:08                6004
function.uopz-get-return.php                       28-Sep-2020 11:08                4228
function.uopz-get-static.php                       28-Sep-2020 11:08                4778
function.uopz-implement.php                        28-Sep-2020 11:08                4668
function.uopz-overload.php                         28-Sep-2020 11:08                3811
function.uopz-redefine.php                         28-Sep-2020 11:08                4737
function.uopz-rename.php                           28-Sep-2020 11:08                6522
function.uopz-restore.php                          28-Sep-2020 11:08                4681
function.uopz-set-hook.php                         28-Sep-2020 11:08                5283
function.uopz-set-mock.php                         28-Sep-2020 11:08               12320
function.uopz-set-property.php                     28-Sep-2020 11:08                7479
function.uopz-set-return.php                       28-Sep-2020 11:08                9232
function.uopz-set-static.php                       28-Sep-2020 11:08                5453
function.uopz-undefine.php                         28-Sep-2020 11:08                4229
function.uopz-unset-hook.php                       28-Sep-2020 11:08                5165
function.uopz-unset-mock.php                       28-Sep-2020 11:08                5157
function.uopz-unset-return.php                     28-Sep-2020 11:08                4558
function.urldecode.php                             28-Sep-2020 11:09                6403
function.urlencode.php                             28-Sep-2020 11:09                8297
function.use-soap-error-handler.php                28-Sep-2020 11:09                3641
function.user-error.php                            28-Sep-2020 11:08                1609
function.usleep.php                                28-Sep-2020 11:09                5318
function.usort.php                                 28-Sep-2020 11:09               22130
function.utf8-decode.php                           28-Sep-2020 11:09                5656
function.utf8-encode.php                           28-Sep-2020 11:09                5336
function.var-dump.php                              28-Sep-2020 11:09                7015
function.var-export.php                            28-Sep-2020 11:09               18332
function.variant-abs.php                           28-Sep-2020 11:09                4026
function.variant-add.php                           28-Sep-2020 11:09                5381
function.variant-and.php                           28-Sep-2020 11:09                6085
function.variant-cast.php                          28-Sep-2020 11:09                3394
function.variant-cat.php                           28-Sep-2020 11:09                4605
function.variant-cmp.php                           28-Sep-2020 11:09                6824
function.variant-date-from-timestamp.php           28-Sep-2020 11:09                3483
function.variant-date-to-timestamp.php             28-Sep-2020 11:09                3422
function.variant-div.php                           28-Sep-2020 11:09                6115
function.variant-eqv.php                           28-Sep-2020 11:09                4204
function.variant-fix.php                           28-Sep-2020 11:09                5407
function.variant-get-type.php                      28-Sep-2020 11:09                3319
function.variant-idiv.php                          28-Sep-2020 11:09                5568
function.variant-imp.php                           28-Sep-2020 11:09                5624
function.variant-int.php                           28-Sep-2020 11:09                4899
function.variant-mod.php                           28-Sep-2020 11:09                4676
function.variant-mul.php                           28-Sep-2020 11:09                5685
function.variant-neg.php                           28-Sep-2020 11:09                3685
function.variant-not.php                           28-Sep-2020 11:09                3851
function.variant-or.php                            28-Sep-2020 11:09                6261
function.variant-pow.php                           28-Sep-2020 11:09                4498
function.variant-round.php                         28-Sep-2020 11:09                4175
function.variant-set-type.php                      28-Sep-2020 11:09                3521
function.variant-set.php                           28-Sep-2020 11:09                2808
function.variant-sub.php                           28-Sep-2020 11:09                5343
function.variant-xor.php                           28-Sep-2020 11:09                5612
function.version-compare.php                       28-Sep-2020 11:08               11987
function.vfprintf.php                              28-Sep-2020 11:09               16166
function.virtual.php                               28-Sep-2020 11:09                5400
function.vprintf.php                               28-Sep-2020 11:09               15562
function.vsprintf.php                              28-Sep-2020 11:09               15485
function.wddx-add-vars.php                         28-Sep-2020 11:09                3637
function.wddx-deserialize.php                      28-Sep-2020 11:09                3648
function.wddx-packet-end.php                       28-Sep-2020 11:09                2701
function.wddx-packet-start.php                     28-Sep-2020 11:09                2793
function.wddx-serialize-value.php                  28-Sep-2020 11:09                3040
function.wddx-serialize-vars.php                   28-Sep-2020 11:09                5916
function.win32-continue-service.php                28-Sep-2020 11:09                4630
function.win32-create-service.php                  28-Sep-2020 11:09               28967
function.win32-delete-service.php                  28-Sep-2020 11:09                4787
function.win32-get-last-control-message.php        28-Sep-2020 11:09                5143
function.win32-pause-service.php                   28-Sep-2020 11:09                4626
function.win32-query-service-status.php            28-Sep-2020 11:09                6506
function.win32-send-custom-control.php             28-Sep-2020 11:09                4701
function.win32-set-service-exit-code.php           28-Sep-2020 11:09                4234
function.win32-set-service-exit-mode.php           28-Sep-2020 11:09                4275
function.win32-set-service-status.php              28-Sep-2020 11:09                6602
function.win32-start-service-ctrl-dispatcher.php   28-Sep-2020 11:09                9538
function.win32-start-service.php                   28-Sep-2020 11:09                4634
function.win32-stop-service.php                    28-Sep-2020 11:09                4557
function.wincache-fcache-fileinfo.php              28-Sep-2020 11:08                9009
function.wincache-fcache-meminfo.php               28-Sep-2020 11:08                6751
function.wincache-lock.php                         28-Sep-2020 11:08                8483
function.wincache-ocache-fileinfo.php              28-Sep-2020 11:08                9674
function.wincache-ocache-meminfo.php               28-Sep-2020 11:08                6960
function.wincache-refresh-if-changed.php           28-Sep-2020 11:08                7741
function.wincache-rplist-fileinfo.php              28-Sep-2020 11:08                7038
function.wincache-rplist-meminfo.php               28-Sep-2020 11:08                6866
function.wincache-scache-info.php                  28-Sep-2020 11:08                9264
function.wincache-scache-meminfo.php               28-Sep-2020 11:08                6324
function.wincache-ucache-add.php                   28-Sep-2020 11:08               13164
function.wincache-ucache-cas.php                   28-Sep-2020 11:08                6024
function.wincache-ucache-clear.php                 28-Sep-2020 11:08                7328
function.wincache-ucache-dec.php                   28-Sep-2020 11:08                5997
function.wincache-ucache-delete.php                28-Sep-2020 11:08               11404
function.wincache-ucache-exists.php                28-Sep-2020 11:08                5995
function.wincache-ucache-get.php                   28-Sep-2020 11:08               10405
function.wincache-ucache-inc.php                   28-Sep-2020 11:08                5989
function.wincache-ucache-info.php                  28-Sep-2020 11:08               10989
function.wincache-ucache-meminfo.php               28-Sep-2020 11:08                6528
function.wincache-ucache-set.php                   28-Sep-2020 11:08               13373
function.wincache-unlock.php                       28-Sep-2020 11:08                7844
function.wordwrap.php                              28-Sep-2020 11:09                7727
function.xattr-get.php                             28-Sep-2020 11:09                5771
function.xattr-list.php                            28-Sep-2020 11:09                6381
function.xattr-remove.php                          28-Sep-2020 11:09                5966
function.xattr-set.php                             28-Sep-2020 11:09                7476
function.xattr-supported.php                       28-Sep-2020 11:09                4992
function.xdiff-file-bdiff-size.php                 28-Sep-2020 11:09                4736
function.xdiff-file-bdiff.php                      28-Sep-2020 11:09                5619
function.xdiff-file-bpatch.php                     28-Sep-2020 11:09                6280
function.xdiff-file-diff-binary.php                28-Sep-2020 11:09                5957
function.xdiff-file-diff.php                       28-Sep-2020 11:09                6722
function.xdiff-file-merge3.php                     28-Sep-2020 11:09                6449
function.xdiff-file-patch-binary.php               28-Sep-2020 11:09                6332
function.xdiff-file-patch.php                      28-Sep-2020 11:09                8537
function.xdiff-file-rabdiff.php                    28-Sep-2020 11:09                6189
function.xdiff-string-bdiff-size.php               28-Sep-2020 11:09                5058
function.xdiff-string-bdiff.php                    28-Sep-2020 11:09                3556
function.xdiff-string-bpatch.php                   28-Sep-2020 11:09                3668
function.xdiff-string-diff-binary.php              28-Sep-2020 11:09                3960
function.xdiff-string-diff.php                     28-Sep-2020 11:09                7220
function.xdiff-string-merge3.php                   28-Sep-2020 11:09                4281
function.xdiff-string-patch-binary.php             28-Sep-2020 11:09                4115
function.xdiff-string-patch.php                    28-Sep-2020 11:09                7828
function.xdiff-string-rabdiff.php                  28-Sep-2020 11:09                4171
function.xhprof-disable.php                        28-Sep-2020 11:08                3881
function.xhprof-enable.php                         28-Sep-2020 11:08                7682
function.xhprof-sample-disable.php                 28-Sep-2020 11:08                4680
function.xhprof-sample-enable.php                  28-Sep-2020 11:08                3406
function.xml-error-string.php                      28-Sep-2020 11:09                2960
function.xml-get-current-byte-index.php            28-Sep-2020 11:09                3657
function.xml-get-current-column-number.php         28-Sep-2020 11:09                3491
function.xml-get-current-line-number.php           28-Sep-2020 11:09                3297
function.xml-get-error-code.php                    28-Sep-2020 11:09                2957
function.xml-parse-into-struct.php                 28-Sep-2020 11:09               20115
function.xml-parse.php                             28-Sep-2020 11:09                7223
function.xml-parser-create-ns.php                  28-Sep-2020 11:09                4070
function.xml-parser-create.php                     28-Sep-2020 11:09                3895
function.xml-parser-free.php                       28-Sep-2020 11:09                2970
function.xml-parser-get-option.php                 28-Sep-2020 11:09                3992
function.xml-parser-set-option.php                 28-Sep-2020 11:09                5127
function.xml-set-character-data-handler.php        28-Sep-2020 11:09                4967
function.xml-set-default-handler.php               28-Sep-2020 11:09                4853
function.xml-set-element-handler.php               28-Sep-2020 11:09                7702
function.xml-set-end-namespace-decl-handler.php    28-Sep-2020 11:09                5950
function.xml-set-external-entity-ref-handler.php   28-Sep-2020 11:09                7598
function.xml-set-notation-decl-handler.php         28-Sep-2020 11:09                6607
function.xml-set-object.php                        28-Sep-2020 11:09                9798
function.xml-set-processing-instruction-handler..> 28-Sep-2020 11:09                5960
function.xml-set-start-namespace-decl-handler.php  28-Sep-2020 11:09                6148
function.xml-set-unparsed-entity-decl-handler.php  28-Sep-2020 11:09                7201
function.xmlrpc-decode-request.php                 28-Sep-2020 11:09                2568
function.xmlrpc-decode.php                         28-Sep-2020 11:09                3988
function.xmlrpc-encode-request.php                 28-Sep-2020 11:09                8682
function.xmlrpc-encode.php                         28-Sep-2020 11:09                2302
function.xmlrpc-get-type.php                       28-Sep-2020 11:09                6446
function.xmlrpc-is-fault.php                       28-Sep-2020 11:09                3644
function.xmlrpc-parse-method-descriptions.php      28-Sep-2020 11:09                2400
function.xmlrpc-server-add-introspection-data.php  28-Sep-2020 11:09                2536
function.xmlrpc-server-call-method.php             28-Sep-2020 11:09                2775
function.xmlrpc-server-create.php                  28-Sep-2020 11:09                2223
function.xmlrpc-server-destroy.php                 28-Sep-2020 11:09                2334
function.xmlrpc-server-register-introspection-c..> 28-Sep-2020 11:09                2608
function.xmlrpc-server-register-method.php         28-Sep-2020 11:09                2645
function.xmlrpc-set-type.php                       28-Sep-2020 11:09                5198
function.xmlwriter-end-attribute.php               28-Sep-2020 11:09                4328
function.xmlwriter-end-cdata.php                   28-Sep-2020 11:09                3850
function.xmlwriter-end-comment.php                 28-Sep-2020 11:09                3866
function.xmlwriter-end-document.php                28-Sep-2020 11:09                3682
function.xmlwriter-end-dtd-attlist.php             28-Sep-2020 11:09                3972
function.xmlwriter-end-dtd-element.php             28-Sep-2020 11:09                3953
function.xmlwriter-end-dtd-entity.php              28-Sep-2020 11:09                3933
function.xmlwriter-end-dtd.php                     28-Sep-2020 11:09                3794
function.xmlwriter-end-element.php                 28-Sep-2020 11:09                3845
function.xmlwriter-end-pi.php                      28-Sep-2020 11:09                3834
function.xmlwriter-flush.php                       28-Sep-2020 11:09                3969
function.xmlwriter-full-end-element.php            28-Sep-2020 11:09                3773
function.xmlwriter-open-memory.php                 28-Sep-2020 11:09                3529
function.xmlwriter-open-uri.php                    28-Sep-2020 11:09                3800
function.xmlwriter-output-memory.php               28-Sep-2020 11:09                4158
function.xmlwriter-set-indent-string.php           28-Sep-2020 11:09                4197
function.xmlwriter-set-indent.php                  28-Sep-2020 11:09                4128
function.xmlwriter-start-attribute-ns.php          28-Sep-2020 11:09                5470
function.xmlwriter-start-attribute.php             28-Sep-2020 11:09                4694
function.xmlwriter-start-cdata.php                 28-Sep-2020 11:09                3872
function.xmlwriter-start-comment.php               28-Sep-2020 11:09                3890
function.xmlwriter-start-document.php              28-Sep-2020 11:09                5095
function.xmlwriter-start-dtd-attlist.php           28-Sep-2020 11:09                4318
function.xmlwriter-start-dtd-element.php           28-Sep-2020 11:09                4356
function.xmlwriter-start-dtd-entity.php            28-Sep-2020 11:09                4614
function.xmlwriter-start-dtd.php                   28-Sep-2020 11:09                4970
function.xmlwriter-start-element-ns.php            28-Sep-2020 11:09                5015
function.xmlwriter-start-element.php               28-Sep-2020 11:09                4191
function.xmlwriter-start-pi.php                    28-Sep-2020 11:09                4189
function.xmlwriter-text.php                        28-Sep-2020 11:09                3507
function.xmlwriter-write-attribute-ns.php          28-Sep-2020 11:09                5840
function.xmlwriter-write-attribute.php             28-Sep-2020 11:09                5076
function.xmlwriter-write-cdata.php                 28-Sep-2020 11:09                4221
function.xmlwriter-write-comment.php               28-Sep-2020 11:09                4244
function.xmlwriter-write-dtd-attlist.php           28-Sep-2020 11:09                4716
function.xmlwriter-write-dtd-element.php           28-Sep-2020 11:09                4688
function.xmlwriter-write-dtd-entity.php            28-Sep-2020 11:09                5527
function.xmlwriter-write-dtd.php                   28-Sep-2020 11:09                5296
function.xmlwriter-write-element-ns.php            28-Sep-2020 11:09                6132
function.xmlwriter-write-element.php               28-Sep-2020 11:09                5336
function.xmlwriter-write-pi.php                    28-Sep-2020 11:09                4608
function.xmlwriter-write-raw.php                   28-Sep-2020 11:09                3920
function.yaml-emit-file.php                        28-Sep-2020 11:09                5709
function.yaml-emit.php                             28-Sep-2020 11:09               12811
function.yaml-parse-file.php                       28-Sep-2020 11:09                5594
function.yaml-parse-url.php                        28-Sep-2020 11:09                5923
function.yaml-parse.php                            28-Sep-2020 11:09                9938
function.yaz-addinfo.php                           28-Sep-2020 11:09                3213
function.yaz-ccl-conf.php                          28-Sep-2020 11:09                5586
function.yaz-ccl-parse.php                         28-Sep-2020 11:09                6525
function.yaz-close.php                             28-Sep-2020 11:09                3216
function.yaz-connect.php                           28-Sep-2020 11:09                8783
function.yaz-database.php                          28-Sep-2020 11:09                3081
function.yaz-element.php                           28-Sep-2020 11:09                3517
function.yaz-errno.php                             28-Sep-2020 11:09                3451
function.yaz-error.php                             28-Sep-2020 11:09                3204
function.yaz-es-result.php                         28-Sep-2020 11:09                3105
function.yaz-es.php                                28-Sep-2020 11:09                7056
function.yaz-get-option.php                        28-Sep-2020 11:09                3127
function.yaz-hits.php                              28-Sep-2020 11:09                4579
function.yaz-itemorder.php                         28-Sep-2020 11:09                6834
function.yaz-present.php                           28-Sep-2020 11:09                2710
function.yaz-range.php                             28-Sep-2020 11:09                3349
function.yaz-record.php                            28-Sep-2020 11:09               14291
function.yaz-scan-result.php                       28-Sep-2020 11:09                3717
function.yaz-scan.php                              28-Sep-2020 11:09                9505
function.yaz-schema.php                            28-Sep-2020 11:09                3232
function.yaz-search.php                            28-Sep-2020 11:09                8281
function.yaz-set-option.php                        28-Sep-2020 11:09                6611
function.yaz-sort.php                              28-Sep-2020 11:09                5406
function.yaz-syntax.php                            28-Sep-2020 11:09                3190
function.yaz-wait.php                              28-Sep-2020 11:09                3870
function.zend-thread-id.php                        28-Sep-2020 11:08                3492
function.zend-version.php                          28-Sep-2020 11:08                3765
function.zip-close.php                             28-Sep-2020 11:08                3547
function.zip-entry-close.php                       28-Sep-2020 11:08                3680
function.zip-entry-compressedsize.php              28-Sep-2020 11:08                3796
function.zip-entry-compressionmethod.php           28-Sep-2020 11:08                3882
function.zip-entry-filesize.php                    28-Sep-2020 11:08                3732
function.zip-entry-name.php                        28-Sep-2020 11:08                3651
function.zip-entry-open.php                        28-Sep-2020 11:08                5268
function.zip-entry-read.php                        28-Sep-2020 11:08                4556
function.zip-open.php                              28-Sep-2020 11:08                3780
function.zip-read.php                              28-Sep-2020 11:08                4232
function.zlib-decode.php                           28-Sep-2020 11:08                3047
function.zlib-encode.php                           28-Sep-2020 11:08                4839
function.zlib-get-coding-type.php                  28-Sep-2020 11:08                2419
function.zookeeper-dispatch.php                    28-Sep-2020 11:09                8146
functional.parallel.php                            28-Sep-2020 11:09                2437
functions.anonymous.php                            28-Sep-2020 11:08               26610
functions.arguments.php                            28-Sep-2020 11:08               51754
functions.arrow.php                                28-Sep-2020 11:08               11202
functions.internal.php                             28-Sep-2020 11:08                4905
functions.returning-values.php                     28-Sep-2020 11:08               13959
functions.user-defined.php                         28-Sep-2020 11:08               10498
functions.variable-functions.php                   28-Sep-2020 11:08               13545
gearman.configuration.php                          28-Sep-2020 11:09                1160
gearman.constants.php                              28-Sep-2020 11:09               20811
gearman.examples-reverse-bg.php                    28-Sep-2020 11:09               11613
gearman.examples-reverse-task.php                  28-Sep-2020 11:09               18792
gearman.examples-reverse.php                       28-Sep-2020 11:09               14234
gearman.examples.php                               28-Sep-2020 11:09                1481
gearman.installation.php                           28-Sep-2020 11:09                1453
gearman.requirements.php                           28-Sep-2020 11:09                1403
gearman.resources.php                              28-Sep-2020 11:09                1133
gearman.setup.php                                  28-Sep-2020 11:09                1500
gearmanclient.addoptions.php                       28-Sep-2020 11:09                2772
gearmanclient.addserver.php                        28-Sep-2020 11:09                4862
gearmanclient.addservers.php                       28-Sep-2020 11:09                4346
gearmanclient.addtask.php                          28-Sep-2020 11:09               14971
gearmanclient.addtaskbackground.php                28-Sep-2020 11:09               21225
gearmanclient.addtaskhigh.php                      28-Sep-2020 11:09               11061
gearmanclient.addtaskhighbackground.php            28-Sep-2020 11:09                5585
gearmanclient.addtasklow.php                       28-Sep-2020 11:09               11044
gearmanclient.addtasklowbackground.php             28-Sep-2020 11:09                5579
gearmanclient.addtaskstatus.php                    28-Sep-2020 11:09                9781
gearmanclient.clearcallbacks.php                   28-Sep-2020 11:09                4288
gearmanclient.clone.php                            28-Sep-2020 11:09                2441
gearmanclient.construct.php                        28-Sep-2020 11:09                2704
gearmanclient.context.php                          28-Sep-2020 11:09                2782
gearmanclient.data.php                             28-Sep-2020 11:09                3053
gearmanclient.do.php                               28-Sep-2020 11:09               23832
gearmanclient.dobackground.php                     28-Sep-2020 11:09                9651
gearmanclient.dohigh.php                           28-Sep-2020 11:09                4607
gearmanclient.dohighbackground.php                 28-Sep-2020 11:09                4486
gearmanclient.dojobhandle.php                      28-Sep-2020 11:09                2835
gearmanclient.dolow.php                            28-Sep-2020 11:09                4594
gearmanclient.dolowbackground.php                  28-Sep-2020 11:09                4469
gearmanclient.donormal.php                         28-Sep-2020 11:09               24152
gearmanclient.dostatus.php                         28-Sep-2020 11:09                8738
gearmanclient.echo.php                             28-Sep-2020 11:09                2680
gearmanclient.error.php                            28-Sep-2020 11:09                2529
gearmanclient.geterrno.php                         28-Sep-2020 11:09                2550
gearmanclient.jobstatus.php                        28-Sep-2020 11:09                8554
gearmanclient.ping.php                             28-Sep-2020 11:09                2653
gearmanclient.removeoptions.php                    28-Sep-2020 11:09                2415
gearmanclient.returncode.php                       28-Sep-2020 11:09                2179
gearmanclient.runtasks.php                         28-Sep-2020 11:09                3514
gearmanclient.setclientcallback.php                28-Sep-2020 11:09                5226
gearmanclient.setcompletecallback.php              28-Sep-2020 11:09                5027
gearmanclient.setcontext.php                       28-Sep-2020 11:09                2977
gearmanclient.setcreatedcallback.php               28-Sep-2020 11:09                4532
gearmanclient.setdata.php                          28-Sep-2020 11:09                3175
gearmanclient.setdatacallback.php                  28-Sep-2020 11:09                4586
gearmanclient.setexceptioncallback.php             28-Sep-2020 11:09                4532
gearmanclient.setfailcallback.php                  28-Sep-2020 11:09                4592
gearmanclient.setoptions.php                       28-Sep-2020 11:09                2404
gearmanclient.setstatuscallback.php                28-Sep-2020 11:09                4590
gearmanclient.settimeout.php                       28-Sep-2020 11:09                2446
gearmanclient.setwarningcallback.php               28-Sep-2020 11:09                4592
gearmanclient.setworkloadcallback.php              28-Sep-2020 11:09                4745
gearmanclient.timeout.php                          28-Sep-2020 11:09                2635
gearmanjob.complete.php                            28-Sep-2020 11:09                3308
gearmanjob.construct.php                           28-Sep-2020 11:09                2212
gearmanjob.data.php                                28-Sep-2020 11:09                3272
gearmanjob.exception.php                           28-Sep-2020 11:09                3489
gearmanjob.fail.php                                28-Sep-2020 11:09                3526
gearmanjob.functionname.php                        28-Sep-2020 11:09                2570
gearmanjob.handle.php                              28-Sep-2020 11:09                2463
gearmanjob.returncode.php                          28-Sep-2020 11:09                2506
gearmanjob.sendcomplete.php                        28-Sep-2020 11:09                3022
gearmanjob.senddata.php                            28-Sep-2020 11:09                2993
gearmanjob.sendexception.php                       28-Sep-2020 11:09                3216
gearmanjob.sendfail.php                            28-Sep-2020 11:09                3238
gearmanjob.sendstatus.php                          28-Sep-2020 11:09                3686
gearmanjob.sendwarning.php                         28-Sep-2020 11:09                3214
gearmanjob.setreturn.php                           28-Sep-2020 11:09                2343
gearmanjob.status.php                              28-Sep-2020 11:09                3974
gearmanjob.unique.php                              28-Sep-2020 11:09                2716
gearmanjob.warning.php                             28-Sep-2020 11:09                3502
gearmanjob.workload.php                            28-Sep-2020 11:09                2719
gearmanjob.workloadsize.php                        28-Sep-2020 11:09                2520
gearmantask.construct.php                          28-Sep-2020 11:09                2231
gearmantask.create.php                             28-Sep-2020 11:09                2519
gearmantask.data.php                               28-Sep-2020 11:09                2518
gearmantask.datasize.php                           28-Sep-2020 11:09                2539
gearmantask.function.php                           28-Sep-2020 11:09                2528
gearmantask.functionname.php                       28-Sep-2020 11:09                2213
gearmantask.isknown.php                            28-Sep-2020 11:09                2237
gearmantask.isrunning.php                          28-Sep-2020 11:09                2235
gearmantask.jobhandle.php                          28-Sep-2020 11:09                2609
gearmantask.recvdata.php                           28-Sep-2020 11:09                3186
gearmantask.returncode.php                         28-Sep-2020 11:09                2532
gearmantask.senddata.php                           28-Sep-2020 11:09                3113
gearmantask.sendworkload.php                       28-Sep-2020 11:09                3142
gearmantask.taskdenominator.php                    28-Sep-2020 11:09                2725
gearmantask.tasknumerator.php                      28-Sep-2020 11:09                2699
gearmantask.unique.php                             28-Sep-2020 11:09                2933
gearmantask.uuid.php                               28-Sep-2020 11:09                3227
gearmanworker.addfunction.php                      28-Sep-2020 11:09                7554
gearmanworker.addoptions.php                       28-Sep-2020 11:09                3163
gearmanworker.addserver.php                        28-Sep-2020 11:09                4519
gearmanworker.addservers.php                       28-Sep-2020 11:09                3996
gearmanworker.clone.php                            28-Sep-2020 11:09                2201
gearmanworker.construct.php                        28-Sep-2020 11:09                2677
gearmanworker.echo.php                             28-Sep-2020 11:09                2822
gearmanworker.error.php                            28-Sep-2020 11:09                2482
gearmanworker.geterrno.php                         28-Sep-2020 11:09                2517
gearmanworker.options.php                          28-Sep-2020 11:09                2525
gearmanworker.register.php                         28-Sep-2020 11:09                3505
gearmanworker.removeoptions.php                    28-Sep-2020 11:09                3182
gearmanworker.returncode.php                       28-Sep-2020 11:09                2725
gearmanworker.setid.php                            28-Sep-2020 11:09                3789
gearmanworker.setoptions.php                       28-Sep-2020 11:09                3333
gearmanworker.settimeout.php                       28-Sep-2020 11:09                8000
gearmanworker.timeout.php                          28-Sep-2020 11:09                2625
gearmanworker.unregister.php                       28-Sep-2020 11:09                3152
gearmanworker.unregisterall.php                    28-Sep-2020 11:09                2897
gearmanworker.wait.php                             28-Sep-2020 11:09                8403
gearmanworker.work.php                             28-Sep-2020 11:09                5335
gender-gender.connect.php                          28-Sep-2020 11:09                2346
gender-gender.construct.php                        28-Sep-2020 11:09                2381
gender-gender.country.php                          28-Sep-2020 11:09                3434
gender-gender.get.php                              28-Sep-2020 11:09                2582
gender-gender.isnick.php                           28-Sep-2020 11:09                3041
gender-gender.similarnames.php                     28-Sep-2020 11:09                2686
gender.example.admin.php                           28-Sep-2020 11:09                9235
gender.examples.php                                28-Sep-2020 11:09                1245
gender.installation.php                            28-Sep-2020 11:09                1864
gender.setup.php                                   28-Sep-2020 11:09                1281
generator.current.php                              28-Sep-2020 11:08                2057
generator.getreturn.php                            28-Sep-2020 11:08                3929
generator.key.php                                  28-Sep-2020 11:08                3912
generator.next.php                                 28-Sep-2020 11:08                2302
generator.rewind.php                               28-Sep-2020 11:08                2103
generator.send.php                                 28-Sep-2020 11:08                5674
generator.throw.php                                28-Sep-2020 11:08                5839
generator.valid.php                                28-Sep-2020 11:08                2081
generator.wakeup.php                               28-Sep-2020 11:08                2112
geoip.configuration.php                            28-Sep-2020 11:09                2350
geoip.constants.php                                28-Sep-2020 11:09                5400
geoip.installation.php                             28-Sep-2020 11:09                1587
geoip.requirements.php                             28-Sep-2020 11:09                1608
geoip.resources.php                                28-Sep-2020 11:09                1091
geoip.setup.php                                    28-Sep-2020 11:09                1463
gettext.configuration.php                          28-Sep-2020 11:09                1160
gettext.constants.php                              28-Sep-2020 11:09                1058
gettext.installation.php                           28-Sep-2020 11:09                1361
gettext.requirements.php                           28-Sep-2020 11:09                1305
gettext.resources.php                              28-Sep-2020 11:09                1103
gettext.setup.php                                  28-Sep-2020 11:09                1505
getting-started.php                                28-Sep-2020 11:08                1923
globiterator.construct.php                         28-Sep-2020 11:09                6399
globiterator.count.php                             28-Sep-2020 11:09                4418
gmagick.addimage.php                               28-Sep-2020 11:09                2734
gmagick.addnoiseimage.php                          28-Sep-2020 11:09                2726
gmagick.annotateimage.php                          28-Sep-2020 11:09                3811
gmagick.blurimage.php                              28-Sep-2020 11:09                2906
gmagick.borderimage.php                            28-Sep-2020 11:09                3277
gmagick.charcoalimage.php                          28-Sep-2020 11:09                2938
gmagick.chopimage.php                              28-Sep-2020 11:09                3379
gmagick.clear.php                                  28-Sep-2020 11:09                2354
gmagick.commentimage.php                           28-Sep-2020 11:09                2590
gmagick.compositeimage.php                         28-Sep-2020 11:09                3522
gmagick.configuration.php                          28-Sep-2020 11:09                1169
gmagick.constants.php                              28-Sep-2020 11:09               83846
gmagick.construct.php                              28-Sep-2020 11:09                2511
gmagick.cropimage.php                              28-Sep-2020 11:09                3517
gmagick.cropthumbnailimage.php                     28-Sep-2020 11:09                2971
gmagick.current.php                                28-Sep-2020 11:09                2416
gmagick.cyclecolormapimage.php                     28-Sep-2020 11:09                2794
gmagick.deconstructimages.php                      28-Sep-2020 11:09                2634
gmagick.despeckleimage.php                         28-Sep-2020 11:09                3572
gmagick.destroy.php                                28-Sep-2020 11:09                2228
gmagick.drawimage.php                              28-Sep-2020 11:09                2689
gmagick.edgeimage.php                              28-Sep-2020 11:09                2665
gmagick.embossimage.php                            28-Sep-2020 11:09                3119
gmagick.enhanceimage.php                           28-Sep-2020 11:09                2247
gmagick.equalizeimage.php                          28-Sep-2020 11:09                2204
gmagick.examples.php                               28-Sep-2020 11:09                3596
gmagick.flipimage.php                              28-Sep-2020 11:09                2559
gmagick.flopimage.php                              28-Sep-2020 11:09                2545
gmagick.frameimage.php                             28-Sep-2020 11:09                3945
gmagick.gammaimage.php                             28-Sep-2020 11:09                2875
gmagick.getcopyright.php                           28-Sep-2020 11:09                2249
gmagick.getfilename.php                            28-Sep-2020 11:09                2199
gmagick.getimagebackgroundcolor.php                28-Sep-2020 11:09                2578
gmagick.getimageblueprimary.php                    28-Sep-2020 11:09                2836
gmagick.getimagebordercolor.php                    28-Sep-2020 11:09                2539
gmagick.getimagechanneldepth.php                   28-Sep-2020 11:09                2533
gmagick.getimagecolors.php                         28-Sep-2020 11:09                2428
gmagick.getimagecolorspace.php                     28-Sep-2020 11:09                2382
gmagick.getimagecompose.php                        28-Sep-2020 11:09                2465
gmagick.getimagedelay.php                          28-Sep-2020 11:09                2364
gmagick.getimagedepth.php                          28-Sep-2020 11:09                2334
gmagick.getimagedispose.php                        28-Sep-2020 11:09                2386
gmagick.getimageextrema.php                        28-Sep-2020 11:09                2570
gmagick.getimagefilename.php                       28-Sep-2020 11:09                2467
gmagick.getimageformat.php                         28-Sep-2020 11:09                2452
gmagick.getimagegamma.php                          28-Sep-2020 11:09                2360
gmagick.getimagegreenprimary.php                   28-Sep-2020 11:09                2567
gmagick.getimageheight.php                         28-Sep-2020 11:09                2385
gmagick.getimagehistogram.php                      28-Sep-2020 11:09                2501
gmagick.getimageindex.php                          28-Sep-2020 11:09                2440
gmagick.getimageinterlacescheme.php                28-Sep-2020 11:09                2495
gmagick.getimageiterations.php                     28-Sep-2020 11:09                2427
gmagick.getimagematte.php                          28-Sep-2020 11:09                2566
gmagick.getimagemattecolor.php                     28-Sep-2020 11:09                2533
gmagick.getimageprofile.php                        28-Sep-2020 11:09                2486
gmagick.getimageredprimary.php                     28-Sep-2020 11:09                2590
gmagick.getimagerenderingintent.php                28-Sep-2020 11:09                2506
gmagick.getimageresolution.php                     28-Sep-2020 11:09                2443
gmagick.getimagescene.php                          28-Sep-2020 11:09                2351
gmagick.getimagesignature.php                      28-Sep-2020 11:09                2460
gmagick.getimagetype.php                           28-Sep-2020 11:09                2359
gmagick.getimageunits.php                          28-Sep-2020 11:09                2147
gmagick.getimagewhitepoint.php                     28-Sep-2020 11:09                2570
gmagick.getimagewidth.php                          28-Sep-2020 11:09                2365
gmagick.getpackagename.php                         28-Sep-2020 11:09                2416
gmagick.getquantumdepth.php                        28-Sep-2020 11:09                2432
gmagick.getreleasedate.php                         28-Sep-2020 11:09                2450
gmagick.getsamplingfactors.php                     28-Sep-2020 11:09                2501
gmagick.getsize.php                                28-Sep-2020 11:09                2505
gmagick.getversion.php                             28-Sep-2020 11:09                2399
gmagick.hasnextimage.php                           28-Sep-2020 11:09                2596
gmagick.haspreviousimage.php                       28-Sep-2020 11:09                2636
gmagick.implodeimage.php                           28-Sep-2020 11:09                2730
gmagick.installation.php                           28-Sep-2020 11:09                1832
gmagick.labelimage.php                             28-Sep-2020 11:09                2574
gmagick.levelimage.php                             28-Sep-2020 11:09                4192
gmagick.magnifyimage.php                           28-Sep-2020 11:09                2453
gmagick.mapimage.php                               28-Sep-2020 11:09                3017
gmagick.medianfilterimage.php                      28-Sep-2020 11:09                2767
gmagick.minifyimage.php                            28-Sep-2020 11:09                2475
gmagick.modulateimage.php                          28-Sep-2020 11:09                3529
gmagick.motionblurimage.php                        28-Sep-2020 11:09                3499
gmagick.newimage.php                               28-Sep-2020 11:09                3386
gmagick.nextimage.php                              28-Sep-2020 11:09                2442
gmagick.normalizeimage.php                         28-Sep-2020 11:09                2724
gmagick.oilpaintimage.php                          28-Sep-2020 11:09                2844
gmagick.previousimage.php                          28-Sep-2020 11:09                2508
gmagick.profileimage.php                           28-Sep-2020 11:09                3100
gmagick.quantizeimage.php                          28-Sep-2020 11:09                4828
gmagick.quantizeimages.php                         28-Sep-2020 11:09                4830
gmagick.queryfontmetrics.php                       28-Sep-2020 11:09                2678
gmagick.queryfonts.php                             28-Sep-2020 11:09                2458
gmagick.queryformats.php                           28-Sep-2020 11:09                2718
gmagick.radialblurimage.php                        28-Sep-2020 11:09                2931
gmagick.raiseimage.php                             28-Sep-2020 11:09                3833
gmagick.read.php                                   28-Sep-2020 11:09                2507
gmagick.readimage.php                              28-Sep-2020 11:09                2553
gmagick.readimageblob.php                          28-Sep-2020 11:09                2888
gmagick.readimagefile.php                          28-Sep-2020 11:09                2754
gmagick.reducenoiseimage.php                       28-Sep-2020 11:09                2899
gmagick.removeimage.php                            28-Sep-2020 11:09                2425
gmagick.removeimageprofile.php                     28-Sep-2020 11:09                2661
gmagick.requirements.php                           28-Sep-2020 11:09                1581
gmagick.resampleimage.php                          28-Sep-2020 11:09                3487
gmagick.resizeimage.php                            28-Sep-2020 11:09                3623
gmagick.rollimage.php                              28-Sep-2020 11:09                2780
gmagick.rotateimage.php                            28-Sep-2020 11:09                3033
gmagick.scaleimage.php                             28-Sep-2020 11:09                3153
gmagick.separateimagechannel.php                   28-Sep-2020 11:09                2928
gmagick.setcompressionquality.php                  28-Sep-2020 11:09                3973
gmagick.setfilename.php                            28-Sep-2020 11:09                2680
gmagick.setimagebackgroundcolor.php                28-Sep-2020 11:09                2797
gmagick.setimageblueprimary.php                    28-Sep-2020 11:09                2987
gmagick.setimagebordercolor.php                    28-Sep-2020 11:09                2763
gmagick.setimagechanneldepth.php                   28-Sep-2020 11:09                3120
gmagick.setimagecolorspace.php                     28-Sep-2020 11:09                2946
gmagick.setimagecompose.php                        28-Sep-2020 11:09                2662
gmagick.setimagedelay.php                          28-Sep-2020 11:09                2613
gmagick.setimagedepth.php                          28-Sep-2020 11:09                2611
gmagick.setimagedispose.php                        28-Sep-2020 11:09                2652
gmagick.setimagefilename.php                       28-Sep-2020 11:09                2700
gmagick.setimageformat.php                         28-Sep-2020 11:09                2666
gmagick.setimagegamma.php                          28-Sep-2020 11:09                2604
gmagick.setimagegreenprimary.php                   28-Sep-2020 11:09                2995
gmagick.setimageindex.php                          28-Sep-2020 11:09                2752
gmagick.setimageinterlacescheme.php                28-Sep-2020 11:09                2812
gmagick.setimageiterations.php                     28-Sep-2020 11:09                2704
gmagick.setimageprofile.php                        28-Sep-2020 11:09                3150
gmagick.setimageredprimary.php                     28-Sep-2020 11:09                2965
gmagick.setimagerenderingintent.php                28-Sep-2020 11:09                2850
gmagick.setimageresolution.php                     28-Sep-2020 11:09                2959
gmagick.setimagescene.php                          28-Sep-2020 11:09                2602
gmagick.setimagetype.php                           28-Sep-2020 11:09                2773
gmagick.setimageunits.php                          28-Sep-2020 11:09                2728
gmagick.setimagewhitepoint.php                     28-Sep-2020 11:09                2927
gmagick.setsamplingfactors.php                     28-Sep-2020 11:09                2743
gmagick.setsize.php                                28-Sep-2020 11:09                2893
gmagick.setup.php                                  28-Sep-2020 11:09                1427
gmagick.shearimage.php                             28-Sep-2020 11:09                3661
gmagick.solarizeimage.php                          28-Sep-2020 11:09                2859
gmagick.spreadimage.php                            28-Sep-2020 11:09                2704
gmagick.stripimage.php                             28-Sep-2020 11:09                2405
gmagick.swirlimage.php                             28-Sep-2020 11:09                2786
gmagick.thumbnailimage.php                         28-Sep-2020 11:09                3379
gmagick.trimimage.php                              28-Sep-2020 11:09                2840
gmagick.write.php                                  28-Sep-2020 11:09                1612
gmagick.writeimage.php                             28-Sep-2020 11:09                2887
gmagickdraw.annotate.php                           28-Sep-2020 11:09                2858
gmagickdraw.arc.php                                28-Sep-2020 11:09                3704
gmagickdraw.bezier.php                             28-Sep-2020 11:09                2396
gmagickdraw.ellipse.php                            28-Sep-2020 11:09                3620
gmagickdraw.getfillcolor.php                       28-Sep-2020 11:09                2341
gmagickdraw.getfillopacity.php                     28-Sep-2020 11:09                2263
gmagickdraw.getfont.php                            28-Sep-2020 11:09                2293
gmagickdraw.getfontsize.php                        28-Sep-2020 11:09                2220
gmagickdraw.getfontstyle.php                       28-Sep-2020 11:09                2264
gmagickdraw.getfontweight.php                      28-Sep-2020 11:09                2227
gmagickdraw.getstrokecolor.php                     28-Sep-2020 11:09                2398
gmagickdraw.getstrokeopacity.php                   28-Sep-2020 11:09                2262
gmagickdraw.getstrokewidth.php                     28-Sep-2020 11:09                2288
gmagickdraw.gettextdecoration.php                  28-Sep-2020 11:09                2294
gmagickdraw.gettextencoding.php                    28-Sep-2020 11:09                2413
gmagickdraw.line.php                               28-Sep-2020 11:09                3144
gmagickdraw.point.php                              28-Sep-2020 11:09                2639
gmagickdraw.polygon.php                            28-Sep-2020 11:09                2462
gmagickdraw.polyline.php                           28-Sep-2020 11:09                2496
gmagickdraw.rectangle.php                          28-Sep-2020 11:09                3239
gmagickdraw.rotate.php                             28-Sep-2020 11:09                2454
gmagickdraw.roundrectangle.php                     28-Sep-2020 11:09                3857
gmagickdraw.scale.php                              28-Sep-2020 11:09                2703
gmagickdraw.setfillcolor.php                       28-Sep-2020 11:09                2801
gmagickdraw.setfillopacity.php                     28-Sep-2020 11:09                2544
gmagickdraw.setfont.php                            28-Sep-2020 11:09                2449
gmagickdraw.setfontsize.php                        28-Sep-2020 11:09                2477
gmagickdraw.setfontstyle.php                       28-Sep-2020 11:09                2607
gmagickdraw.setfontweight.php                      28-Sep-2020 11:09                2477
gmagickdraw.setstrokecolor.php                     28-Sep-2020 11:09                2823
gmagickdraw.setstrokeopacity.php                   28-Sep-2020 11:09                2560
gmagickdraw.setstrokewidth.php                     28-Sep-2020 11:09                2522
gmagickdraw.settextdecoration.php                  28-Sep-2020 11:09                2605
gmagickdraw.settextencoding.php                    28-Sep-2020 11:09                2813
gmagickpixel.construct.php                         28-Sep-2020 11:09                2485
gmagickpixel.getcolor.php                          28-Sep-2020 11:09                3787
gmagickpixel.getcolorcount.php                     28-Sep-2020 11:09                2293
gmagickpixel.getcolorvalue.php                     28-Sep-2020 11:09                2608
gmagickpixel.setcolor.php                          28-Sep-2020 11:09                2619
gmagickpixel.setcolorvalue.php                     28-Sep-2020 11:09                2929
gmp.configuration.php                              28-Sep-2020 11:09                1136
gmp.constants.php                                  28-Sep-2020 11:09                3604
gmp.examples.php                                   28-Sep-2020 11:09                3175
gmp.installation.php                               28-Sep-2020 11:09                1239
gmp.requirements.php                               28-Sep-2020 11:09                1637
gmp.resources.php                                  28-Sep-2020 11:09                1262
gmp.setup.php                                      28-Sep-2020 11:09                1458
gnupg.configuration.php                            28-Sep-2020 11:09                1148
gnupg.constants.php                                28-Sep-2020 11:09                7927
gnupg.examples-clearsign.php                       28-Sep-2020 11:09                6633
gnupg.examples.php                                 28-Sep-2020 11:09                1265
gnupg.installation.php                             28-Sep-2020 11:09                1436
gnupg.requirements.php                             28-Sep-2020 11:09                1177
gnupg.resources.php                                28-Sep-2020 11:09                1091
gnupg.setup.php                                    28-Sep-2020 11:09                1483
hash.configuration.php                             28-Sep-2020 11:08                1142
hash.constants.php                                 28-Sep-2020 11:08                1701
hash.installation.php                              28-Sep-2020 11:08                1575
hash.requirements.php                              28-Sep-2020 11:08                1123
hash.resources.php                                 28-Sep-2020 11:08                1235
hash.setup.php                                     28-Sep-2020 11:08                1463
hashcontext.construct.php                          28-Sep-2020 11:08                1818
history.php                                        28-Sep-2020 11:09                2002
history.php.books.php                              28-Sep-2020 11:09                2627
history.php.php                                    28-Sep-2020 11:09               11001
history.php.publications.php                       28-Sep-2020 11:09                1803
history.php.related.php                            28-Sep-2020 11:09                6330
hrtime-performancecounter.getfrequency.php         28-Sep-2020 11:09                2607
hrtime-performancecounter.getticks.php             28-Sep-2020 11:09                2488
hrtime-performancecounter.gettickssince.php        28-Sep-2020 11:09                2698
hrtime-stopwatch.getelapsedticks.php               28-Sep-2020 11:09                2388
hrtime-stopwatch.getelapsedtime.php                28-Sep-2020 11:09                2658
hrtime-stopwatch.getlastelapsedticks.php           28-Sep-2020 11:09                2456
hrtime-stopwatch.getlastelapsedtime.php            28-Sep-2020 11:09                2678
hrtime-stopwatch.isrunning.php                     28-Sep-2020 11:09                2356
hrtime-stopwatch.start.php                         28-Sep-2020 11:09                2289
hrtime-stopwatch.stop.php                          28-Sep-2020 11:09                2169
hrtime.example.basic.php                           28-Sep-2020 11:09                5880
hrtime.examples.php                                28-Sep-2020 11:09                1249
hrtime.installation.php                            28-Sep-2020 11:09                1841
hrtime.setup.php                                   28-Sep-2020 11:09                1278
ibase.configuration.php                            28-Sep-2020 11:08                7677
ibase.constants.php                                28-Sep-2020 11:08               18076
ibase.installation.php                             28-Sep-2020 11:08                3185
ibase.requirements.php                             28-Sep-2020 11:08                1108
ibase.resources.php                                28-Sep-2020 11:08                1091
ibase.setup.php                                    28-Sep-2020 11:08                1499
ibm-db2.configuration.php                          28-Sep-2020 11:08                9594
ibm-db2.constants.php                              28-Sep-2020 11:08                8003
ibm-db2.installation.php                           28-Sep-2020 11:08                3440
ibm-db2.requirements.php                           28-Sep-2020 11:08                3109
ibm-db2.resources.php                              28-Sep-2020 11:08                1161
ibm-db2.setup.php                                  28-Sep-2020 11:08                1509
iconv.configuration.php                            28-Sep-2020 11:09                4734
iconv.constants.php                                28-Sep-2020 11:09                3316
iconv.installation.php                             28-Sep-2020 11:09                1455
iconv.requirements.php                             28-Sep-2020 11:09                1388
iconv.resources.php                                28-Sep-2020 11:09                1091
iconv.setup.php                                    28-Sep-2020 11:09                1487
ifx.configuration.php                              28-Sep-2020 11:08               15639
ifx.constants.php                                  28-Sep-2020 11:08                3271
ifx.installation.php                               28-Sep-2020 11:08                1937
ifx.requirements.php                               28-Sep-2020 11:08                1605
ifx.resources.php                                  28-Sep-2020 11:08                1079
ifx.setup.php                                      28-Sep-2020 11:08                1468
iisfunc.configuration.php                          28-Sep-2020 11:09                1160
iisfunc.constants.php                              28-Sep-2020 11:09                4033
iisfunc.installation.php                           28-Sep-2020 11:09                1473
iisfunc.requirements.php                           28-Sep-2020 11:09                1120
iisfunc.resources.php                              28-Sep-2020 11:09                1103
iisfunc.setup.php                                  28-Sep-2020 11:09                1495
image.configuration.php                            28-Sep-2020 11:09                3320
image.constants.php                                28-Sep-2020 11:09               46184
image.examples-png.php                             28-Sep-2020 11:09                4946
image.examples-watermark.php                       28-Sep-2020 11:09                6035
image.examples.merged-watermark.php                28-Sep-2020 11:09                8862
image.examples.php                                 28-Sep-2020 11:09                1499
image.installation.php                             28-Sep-2020 11:09                6009
image.requirements.php                             28-Sep-2020 11:09                5436
image.resources.php                                28-Sep-2020 11:09                2537
image.setup.php                                    28-Sep-2020 11:09                1486
imagick.adaptiveblurimage.php                      28-Sep-2020 11:09                6608
imagick.adaptiveresizeimage.php                    28-Sep-2020 11:09                8614
imagick.adaptivesharpenimage.php                   28-Sep-2020 11:09                6204
imagick.adaptivethresholdimage.php                 28-Sep-2020 11:09                5997
imagick.addimage.php                               28-Sep-2020 11:09                2650
imagick.addnoiseimage.php                          28-Sep-2020 11:09                5347
imagick.affinetransformimage.php                   28-Sep-2020 11:09                6753
imagick.animateimages.php                          28-Sep-2020 11:09                2893
imagick.annotateimage.php                          28-Sep-2020 11:09                8387
imagick.appendimages.php                           28-Sep-2020 11:09                6577
imagick.autolevelimage.php                         28-Sep-2020 11:09                4309
imagick.averageimages.php                          28-Sep-2020 11:09                2418
imagick.blackthresholdimage.php                    28-Sep-2020 11:09                5169
imagick.blueshiftimage.php                         28-Sep-2020 11:09                4378
imagick.blurimage.php                              28-Sep-2020 11:09                5381
imagick.borderimage.php                            28-Sep-2020 11:09                5843
imagick.brightnesscontrastimage.php                28-Sep-2020 11:09                5429
imagick.charcoalimage.php                          28-Sep-2020 11:09                4771
imagick.chopimage.php                              28-Sep-2020 11:09                6633
imagick.clampimage.php                             28-Sep-2020 11:09                2405
imagick.clear.php                                  28-Sep-2020 11:09                1860
imagick.clipimage.php                              28-Sep-2020 11:09                2089
imagick.clipimagepath.php                          28-Sep-2020 11:09                2883
imagick.clippathimage.php                          28-Sep-2020 11:09                3085
imagick.clone.php                                  28-Sep-2020 11:09                3959
imagick.clutimage.php                              28-Sep-2020 11:09                5837
imagick.coalesceimages.php                         28-Sep-2020 11:09                2489
imagick.colorfloodfillimage.php                    28-Sep-2020 11:09                4925
imagick.colorizeimage.php                          28-Sep-2020 11:09                6766
imagick.colormatriximage.php                       28-Sep-2020 11:09                8333
imagick.combineimages.php                          28-Sep-2020 11:09                3090
imagick.commentimage.php                           28-Sep-2020 11:09                4799
imagick.compareimagechannels.php                   28-Sep-2020 11:09                3629
imagick.compareimagelayers.php                     28-Sep-2020 11:09                5368
imagick.compareimages.php                          28-Sep-2020 11:09                5453
imagick.compositeimage.php                         28-Sep-2020 11:09                7553
imagick.configuration.php                          28-Sep-2020 11:09                4142
imagick.constants.php                              28-Sep-2020 11:09              133373
imagick.construct.php                              28-Sep-2020 11:09                2617
imagick.contrastimage.php                          28-Sep-2020 11:09                4920
imagick.contraststretchimage.php                   28-Sep-2020 11:09                3475
imagick.convolveimage.php                          28-Sep-2020 11:09                5834
imagick.count.php                                  28-Sep-2020 11:09                2533
imagick.cropimage.php                              28-Sep-2020 11:09                5729
imagick.cropthumbnailimage.php                     28-Sep-2020 11:09                3041
imagick.current.php                                28-Sep-2020 11:09                2164
imagick.cyclecolormapimage.php                     28-Sep-2020 11:09                2669
imagick.decipherimage.php                          28-Sep-2020 11:09                2985
imagick.deconstructimages.php                      28-Sep-2020 11:09                2299
imagick.deleteimageartifact.php                    28-Sep-2020 11:09                3424
imagick.deleteimageproperty.php                    28-Sep-2020 11:09                2383
imagick.deskewimage.php                            28-Sep-2020 11:09               11583
imagick.despeckleimage.php                         28-Sep-2020 11:09                3954
imagick.destroy.php                                28-Sep-2020 11:09                1994
imagick.displayimage.php                           28-Sep-2020 11:09                2470
imagick.displayimages.php                          28-Sep-2020 11:09                2513
imagick.distortimage.php                           28-Sep-2020 11:09               12781
imagick.drawimage.php                              28-Sep-2020 11:09                2378
imagick.edgeimage.php                              28-Sep-2020 11:09                4483
imagick.embossimage.php                            28-Sep-2020 11:09                5138
imagick.encipherimage.php                          28-Sep-2020 11:09                2981
imagick.enhanceimage.php                           28-Sep-2020 11:09                3925
imagick.equalizeimage.php                          28-Sep-2020 11:09                3890
imagick.evaluateimage.php                          28-Sep-2020 11:09                5621
imagick.examples-1.php                             28-Sep-2020 11:09               32516
imagick.examples.php                               28-Sep-2020 11:09                1265
imagick.exportimagepixels.php                      28-Sep-2020 11:09                7459
imagick.extentimage.php                            28-Sep-2020 11:09                4764
imagick.filter.php                                 28-Sep-2020 11:09                7857
imagick.flattenimages.php                          28-Sep-2020 11:09                2472
imagick.flipimage.php                              28-Sep-2020 11:09                3907
imagick.floodfillpaintimage.php                    28-Sep-2020 11:09               11358
imagick.flopimage.php                              28-Sep-2020 11:09                3937
imagick.forwardfouriertransformimage.php           28-Sep-2020 11:09               12915
imagick.frameimage.php                             28-Sep-2020 11:09                8196
imagick.functionimage.php                          28-Sep-2020 11:09               13681
imagick.fximage.php                                28-Sep-2020 11:09                5972
imagick.gammaimage.php                             28-Sep-2020 11:09                5483
imagick.gaussianblurimage.php                      28-Sep-2020 11:09                5972
imagick.getcolorspace.php                          28-Sep-2020 11:09                2115
imagick.getcompression.php                         28-Sep-2020 11:09                1907
imagick.getcompressionquality.php                  28-Sep-2020 11:09                1971
imagick.getcopyright.php                           28-Sep-2020 11:09                1979
imagick.getfilename.php                            28-Sep-2020 11:09                2077
imagick.getfont.php                                28-Sep-2020 11:09                2717
imagick.getformat.php                              28-Sep-2020 11:09                2039
imagick.getgravity.php                             28-Sep-2020 11:09                2117
imagick.gethomeurl.php                             28-Sep-2020 11:09                1856
imagick.getimage.php                               28-Sep-2020 11:09                2147
imagick.getimagealphachannel.php                   28-Sep-2020 11:09                2581
imagick.getimageartifact.php                       28-Sep-2020 11:09                3372
imagick.getimageattribute.php                      28-Sep-2020 11:09                2614
imagick.getimagebackgroundcolor.php                28-Sep-2020 11:09                2279
imagick.getimageblob.php                           28-Sep-2020 11:09                2331
imagick.getimageblueprimary.php                    28-Sep-2020 11:09                2721
imagick.getimagebordercolor.php                    28-Sep-2020 11:09                2244
imagick.getimagechanneldepth.php                   28-Sep-2020 11:09                2879
imagick.getimagechanneldistortion.php              28-Sep-2020 11:09                3708
imagick.getimagechanneldistortions.php             28-Sep-2020 11:09                4107
imagick.getimagechannelextrema.php                 28-Sep-2020 11:09                3320
imagick.getimagechannelkurtosis.php                28-Sep-2020 11:09                3402
imagick.getimagechannelmean.php                    28-Sep-2020 11:09                3005
imagick.getimagechannelrange.php                   28-Sep-2020 11:09                3183
imagick.getimagechannelstatistics.php              28-Sep-2020 11:09                2226
imagick.getimageclipmask.php                       28-Sep-2020 11:09                2697
imagick.getimagecolormapcolor.php                  28-Sep-2020 11:09                2693
imagick.getimagecolors.php                         28-Sep-2020 11:09                2059
imagick.getimagecolorspace.php                     28-Sep-2020 11:09                2030
imagick.getimagecompose.php                        28-Sep-2020 11:09                1990
imagick.getimagecompression.php                    28-Sep-2020 11:09                1989
imagick.getimagecompressionquality.php             28-Sep-2020 11:09                2057
imagick.getimagedelay.php                          28-Sep-2020 11:09                2068
imagick.getimagedepth.php                          28-Sep-2020 11:09                1852
imagick.getimagedispose.php                        28-Sep-2020 11:09                2104
imagick.getimagedistortion.php                     28-Sep-2020 11:09                3039
imagick.getimageextrema.php                        28-Sep-2020 11:09                2519
imagick.getimagefilename.php                       28-Sep-2020 11:09                2174
imagick.getimageformat.php                         28-Sep-2020 11:09                2160
imagick.getimagegamma.php                          28-Sep-2020 11:09                2063
imagick.getimagegeometry.php                       28-Sep-2020 11:09                3771
imagick.getimagegravity.php                        28-Sep-2020 11:09                2384
imagick.getimagegreenprimary.php                   28-Sep-2020 11:09                2315
imagick.getimageheight.php                         28-Sep-2020 11:09                2092
imagick.getimagehistogram.php                      28-Sep-2020 11:09               19419
imagick.getimageindex.php                          28-Sep-2020 11:09                2630
imagick.getimageinterlacescheme.php                28-Sep-2020 11:09                2092
imagick.getimageinterpolatemethod.php              28-Sep-2020 11:09                2339
imagick.getimageiterations.php                     28-Sep-2020 11:09                2142
imagick.getimagelength.php                         28-Sep-2020 11:09                3083
imagick.getimagemagicklicense.php                  28-Sep-2020 11:09                2008
imagick.getimagematte.php                          28-Sep-2020 11:09                2394
imagick.getimagemattecolor.php                     28-Sep-2020 11:09                2486
imagick.getimagemimetype.php                       28-Sep-2020 11:09                2146
imagick.getimageorientation.php                    28-Sep-2020 11:09                2248
imagick.getimagepage.php                           28-Sep-2020 11:09                2323
imagick.getimagepixelcolor.php                     28-Sep-2020 11:09                2897
imagick.getimageprofile.php                        28-Sep-2020 11:09                2528
imagick.getimageprofiles.php                       28-Sep-2020 11:09                3091
imagick.getimageproperties.php                     28-Sep-2020 11:09                5520
imagick.getimageproperty.php                       28-Sep-2020 11:09                4749
imagick.getimageredprimary.php                     28-Sep-2020 11:09                2365
imagick.getimageregion.php                         28-Sep-2020 11:09                3484
imagick.getimagerenderingintent.php                28-Sep-2020 11:09                2260
imagick.getimageresolution.php                     28-Sep-2020 11:09                2146
imagick.getimagesblob.php                          28-Sep-2020 11:09                2169
imagick.getimagescene.php                          28-Sep-2020 11:09                2050
imagick.getimagesignature.php                      28-Sep-2020 11:09                2169
imagick.getimagesize.php                           28-Sep-2020 11:09                2308
imagick.getimagetickspersecond.php                 28-Sep-2020 11:09                2174
imagick.getimagetotalinkdensity.php                28-Sep-2020 11:09                2082
imagick.getimagetype.php                           28-Sep-2020 11:09                3690
imagick.getimageunits.php                          28-Sep-2020 11:09                2108
imagick.getimagevirtualpixelmethod.php             28-Sep-2020 11:09                2237
imagick.getimagewhitepoint.php                     28-Sep-2020 11:09                2303
imagick.getimagewidth.php                          28-Sep-2020 11:09                2068
imagick.getinterlacescheme.php                     28-Sep-2020 11:09                2204
imagick.getiteratorindex.php                       28-Sep-2020 11:09                5842
imagick.getnumberimages.php                        28-Sep-2020 11:09                2155
imagick.getoption.php                              28-Sep-2020 11:09                2512
imagick.getpackagename.php                         28-Sep-2020 11:09                2091
imagick.getpage.php                                28-Sep-2020 11:09                2159
imagick.getpixeliterator.php                       28-Sep-2020 11:09                6515
imagick.getpixelregioniterator.php                 28-Sep-2020 11:09                6518
imagick.getpointsize.php                           28-Sep-2020 11:09                2479
imagick.getquantum.php                             28-Sep-2020 11:09                2131
imagick.getquantumdepth.php                        28-Sep-2020 11:09                2109
imagick.getquantumrange.php                        28-Sep-2020 11:09                2472
imagick.getregistry.php                            28-Sep-2020 11:09                2315
imagick.getreleasedate.php                         28-Sep-2020 11:09                2115
imagick.getresource.php                            28-Sep-2020 11:09                2634
imagick.getresourcelimit.php                       28-Sep-2020 11:09                3055
imagick.getsamplingfactors.php                     28-Sep-2020 11:09                2210
imagick.getsize.php                                28-Sep-2020 11:09                5579
imagick.getsizeoffset.php                          28-Sep-2020 11:09                2214
imagick.getversion.php                             28-Sep-2020 11:09                2115
imagick.haldclutimage.php                          28-Sep-2020 11:09                6055
imagick.hasnextimage.php                           28-Sep-2020 11:09                2132
imagick.haspreviousimage.php                       28-Sep-2020 11:09                2162
imagick.identifyformat.php                         28-Sep-2020 11:09                4358
imagick.identifyimage.php                          28-Sep-2020 11:09                3707
imagick.implodeimage.php                           28-Sep-2020 11:09                4465
imagick.importimagepixels.php                      28-Sep-2020 11:09               11459
imagick.installation.php                           28-Sep-2020 11:09                1997
imagick.inversefouriertransformimage.php           28-Sep-2020 11:09                3216
imagick.labelimage.php                             28-Sep-2020 11:09                2273
imagick.levelimage.php                             28-Sep-2020 11:09                7456
imagick.linearstretchimage.php                     28-Sep-2020 11:09                5509
imagick.liquidrescaleimage.php                     28-Sep-2020 11:09                3978
imagick.listregistry.php                           28-Sep-2020 11:09                2248
imagick.magnifyimage.php                           28-Sep-2020 11:09                3928
imagick.mapimage.php                               28-Sep-2020 11:09                2949
imagick.mattefloodfillimage.php                    28-Sep-2020 11:09                5120
imagick.medianfilterimage.php                      28-Sep-2020 11:09                4958
imagick.mergeimagelayers.php                       28-Sep-2020 11:09                6472
imagick.minifyimage.php                            28-Sep-2020 11:09                1966
imagick.modulateimage.php                          28-Sep-2020 11:09                5362
imagick.montageimage.php                           28-Sep-2020 11:09                3984
imagick.morphimages.php                            28-Sep-2020 11:09                2571
imagick.morphology.php                             28-Sep-2020 11:09               76339
imagick.mosaicimages.php                           28-Sep-2020 11:09                2377
imagick.motionblurimage.php                        28-Sep-2020 11:09                6383
imagick.negateimage.php                            28-Sep-2020 11:09                5331
imagick.newimage.php                               28-Sep-2020 11:09                5786
imagick.newpseudoimage.php                         28-Sep-2020 11:09                5563
imagick.nextimage.php                              28-Sep-2020 11:09                1902
imagick.normalizeimage.php                         28-Sep-2020 11:09                6331
imagick.oilpaintimage.php                          28-Sep-2020 11:09                4420
imagick.opaquepaintimage.php                       28-Sep-2020 11:09                4503
imagick.optimizeimagelayers.php                    28-Sep-2020 11:09                5038
imagick.orderedposterizeimage.php                  28-Sep-2020 11:09                6659
imagick.paintfloodfillimage.php                    28-Sep-2020 11:09                5178
imagick.paintopaqueimage.php                       28-Sep-2020 11:09                4955
imagick.painttransparentimage.php                  28-Sep-2020 11:09                4305
imagick.pingimageblob.php                          28-Sep-2020 11:09                5931
imagick.pingimagefile.php                          28-Sep-2020 11:09                5603
imagick.polaroidimage.php                          28-Sep-2020 11:09                4559
imagick.posterizeimage.php                         28-Sep-2020 11:09                5441
imagick.previewimages.php                          28-Sep-2020 11:09                2793
imagick.previousimage.php                          28-Sep-2020 11:09                1948
imagick.profileimage.php                           28-Sep-2020 11:09                2887
imagick.quantizeimage.php                          28-Sep-2020 11:09                6226
imagick.quantizeimages.php                         28-Sep-2020 11:09                3372
imagick.queryfontmetrics.php                       28-Sep-2020 11:09                5395
imagick.queryfonts.php                             28-Sep-2020 11:09                4835
imagick.queryformats.php                           28-Sep-2020 11:09                8058
imagick.radialblurimage.php                        28-Sep-2020 11:09                5397
imagick.raiseimage.php                             28-Sep-2020 11:09                6079
imagick.randomthresholdimage.php                   28-Sep-2020 11:09                6323
imagick.readimage.php                              28-Sep-2020 11:09                2244
imagick.readimageblob.php                          28-Sep-2020 11:09                5254
imagick.readimagefile.php                          28-Sep-2020 11:09                2772
imagick.readimages.php                             28-Sep-2020 11:09                2332
imagick.recolorimage.php                           28-Sep-2020 11:09                6532
imagick.reducenoiseimage.php                       28-Sep-2020 11:09                5009
imagick.remapimage.php                             28-Sep-2020 11:09                3206
imagick.removeimage.php                            28-Sep-2020 11:09                2091
imagick.removeimageprofile.php                     28-Sep-2020 11:09                2520
imagick.render.php                                 28-Sep-2020 11:09                1871
imagick.requirements.php                           28-Sep-2020 11:09                1855
imagick.resampleimage.php                          28-Sep-2020 11:09                5193
imagick.resetimagepage.php                         28-Sep-2020 11:09                2521
imagick.resizeimage.php                            28-Sep-2020 11:09               11586
imagick.resources.php                              28-Sep-2020 11:09                1103
imagick.rollimage.php                              28-Sep-2020 11:09                4582
imagick.rotateimage.php                            28-Sep-2020 11:09                5523
imagick.rotationalblurimage.php                    28-Sep-2020 11:09                5599
imagick.roundcorners.php                           28-Sep-2020 11:09                6030
imagick.sampleimage.php                            28-Sep-2020 11:09                2611
imagick.scaleimage.php                             28-Sep-2020 11:09                6480
imagick.segmentimage.php                           28-Sep-2020 11:09                6431
imagick.selectiveblurimage.php                     28-Sep-2020 11:09                6217
imagick.separateimagechannel.php                   28-Sep-2020 11:09                5202
imagick.sepiatoneimage.php                         28-Sep-2020 11:09                4699
imagick.setbackgroundcolor.php                     28-Sep-2020 11:09                3001
imagick.setcolorspace.php                          28-Sep-2020 11:09                2743
imagick.setcompression.php                         28-Sep-2020 11:09                2452
imagick.setcompressionquality.php                  28-Sep-2020 11:09                7201
imagick.setfilename.php                            28-Sep-2020 11:09                2323
imagick.setfirstiterator.php                       28-Sep-2020 11:09                1937
imagick.setfont.php                                28-Sep-2020 11:09                5401
imagick.setformat.php                              28-Sep-2020 11:09                2227
imagick.setgravity.php                             28-Sep-2020 11:09                2513
imagick.setimage.php                               28-Sep-2020 11:09                4564
imagick.setimagealphachannel.php                   28-Sep-2020 11:09                3400
imagick.setimageartifact.php                       28-Sep-2020 11:09                7298
imagick.setimageattribute.php                      28-Sep-2020 11:09                3028
imagick.setimagebackgroundcolor.php                28-Sep-2020 11:09                3227
imagick.setimagebias.php                           28-Sep-2020 11:09                6891
imagick.setimagebiasquantum.php                    28-Sep-2020 11:09                2782
imagick.setimageblueprimary.php                    28-Sep-2020 11:09                2784
imagick.setimagebordercolor.php                    28-Sep-2020 11:09                3209
imagick.setimagechanneldepth.php                   28-Sep-2020 11:09                2800
imagick.setimageclipmask.php                       28-Sep-2020 11:09                9287
imagick.setimagecolormapcolor.php                  28-Sep-2020 11:09                2880
imagick.setimagecolorspace.php                     28-Sep-2020 11:09                2896
imagick.setimagecompose.php                        28-Sep-2020 11:09                2618
imagick.setimagecompression.php                    28-Sep-2020 11:09                2586
imagick.setimagecompressionquality.php             28-Sep-2020 11:09                4715
imagick.setimagedelay.php                          28-Sep-2020 11:09                6153
imagick.setimagedepth.php                          28-Sep-2020 11:09                2438
imagick.setimagedispose.php                        28-Sep-2020 11:09                2480
imagick.setimageextent.php                         28-Sep-2020 11:09                2706
imagick.setimagefilename.php                       28-Sep-2020 11:09                2529
imagick.setimageformat.php                         28-Sep-2020 11:09                2421
imagick.setimagegamma.php                          28-Sep-2020 11:09                2442
imagick.setimagegravity.php                        28-Sep-2020 11:09                2673
imagick.setimagegreenprimary.php                   28-Sep-2020 11:09                2776
imagick.setimageindex.php                          28-Sep-2020 11:09                3055
imagick.setimageinterlacescheme.php                28-Sep-2020 11:09                2592
imagick.setimageinterpolatemethod.php              28-Sep-2020 11:09                2515
imagick.setimageiterations.php                     28-Sep-2020 11:09                4734
imagick.setimagematte.php                          28-Sep-2020 11:09                2457
imagick.setimagemattecolor.php                     28-Sep-2020 11:09                3438
imagick.setimageopacity.php                        28-Sep-2020 11:09                4832
imagick.setimageorientation.php                    28-Sep-2020 11:09                4543
imagick.setimagepage.php                           28-Sep-2020 11:09                3134
imagick.setimageprofile.php                        28-Sep-2020 11:09                2920
imagick.setimageproperty.php                       28-Sep-2020 11:09                4864
imagick.setimageredprimary.php                     28-Sep-2020 11:09                2774
imagick.setimagerenderingintent.php                28-Sep-2020 11:09                2598
imagick.setimageresolution.php                     28-Sep-2020 11:09                4778
imagick.setimagescene.php                          28-Sep-2020 11:09                2462
imagick.setimagetickspersecond.php                 28-Sep-2020 11:09                8136
imagick.setimagetype.php                           28-Sep-2020 11:09                2259
imagick.setimageunits.php                          28-Sep-2020 11:09                2294
imagick.setimagevirtualpixelmethod.php             28-Sep-2020 11:09                2401
imagick.setimagewhitepoint.php                     28-Sep-2020 11:09                2772
imagick.setinterlacescheme.php                     28-Sep-2020 11:09                2337
imagick.setiteratorindex.php                       28-Sep-2020 11:09                6055
imagick.setlastiterator.php                        28-Sep-2020 11:09                1941
imagick.setoption.php                              28-Sep-2020 11:09               12760
imagick.setpage.php                                28-Sep-2020 11:09                2890
imagick.setpointsize.php                           28-Sep-2020 11:09                5091
imagick.setprogressmonitor.php                     28-Sep-2020 11:09               12663
imagick.setregistry.php                            28-Sep-2020 11:09                2722
imagick.setresolution.php                          28-Sep-2020 11:09                3423
imagick.setresourcelimit.php                       28-Sep-2020 11:09                3282
imagick.setsamplingfactors.php                     28-Sep-2020 11:09                6978
imagick.setsize.php                                28-Sep-2020 11:09                2529
imagick.setsizeoffset.php                          28-Sep-2020 11:09                2994
imagick.settype.php                                28-Sep-2020 11:09                2210
imagick.setup.php                                  28-Sep-2020 11:09                1504
imagick.shadeimage.php                             28-Sep-2020 11:09                5378
imagick.shadowimage.php                            28-Sep-2020 11:09                5006
imagick.sharpenimage.php                           28-Sep-2020 11:09                5350
imagick.shaveimage.php                             28-Sep-2020 11:09                4513
imagick.shearimage.php                             28-Sep-2020 11:09                6264
imagick.sigmoidalcontrastimage.php                 28-Sep-2020 11:09                7546
imagick.sketchimage.php                            28-Sep-2020 11:09                5595
imagick.smushimages.php                            28-Sep-2020 11:09                5757
imagick.solarizeimage.php                          28-Sep-2020 11:09                4673
imagick.sparsecolorimage.php                       28-Sep-2020 11:09               31287
imagick.spliceimage.php                            28-Sep-2020 11:09                5394
imagick.spreadimage.php                            28-Sep-2020 11:09                4477
imagick.statisticimage.php                         28-Sep-2020 11:09                6546
imagick.steganoimage.php                           28-Sep-2020 11:09                2793
imagick.stereoimage.php                            28-Sep-2020 11:09                2573
imagick.stripimage.php                             28-Sep-2020 11:09                2090
imagick.subimagematch.php                          28-Sep-2020 11:09                7535
imagick.swirlimage.php                             28-Sep-2020 11:09                4566
imagick.textureimage.php                           28-Sep-2020 11:09                6286
imagick.thresholdimage.php                         28-Sep-2020 11:09                5050
imagick.thumbnailimage.php                         28-Sep-2020 11:09                6914
imagick.tintimage.php                              28-Sep-2020 11:09                7809
imagick.tostring.php                               28-Sep-2020 11:09                2829
imagick.transformimage.php                         28-Sep-2020 11:09                5881
imagick.transformimagecolorspace.php               28-Sep-2020 11:09                8083
imagick.transparentpaintimage.php                  28-Sep-2020 11:09                7119
imagick.transposeimage.php                         28-Sep-2020 11:09                4319
imagick.transverseimage.php                        28-Sep-2020 11:09                4307
imagick.trimimage.php                              28-Sep-2020 11:09                5586
imagick.uniqueimagecolors.php                      28-Sep-2020 11:09                5358
imagick.unsharpmaskimage.php                       28-Sep-2020 11:09                6206
imagick.valid.php                                  28-Sep-2020 11:09                1853
imagick.vignetteimage.php                          28-Sep-2020 11:09                6220
imagick.waveimage.php                              28-Sep-2020 11:09                6186
imagick.whitethresholdimage.php                    28-Sep-2020 11:09                5077
imagick.writeimage.php                             28-Sep-2020 11:09                2700
imagick.writeimagefile.php                         28-Sep-2020 11:09                2649
imagick.writeimages.php                            28-Sep-2020 11:09                2500
imagick.writeimagesfile.php                        28-Sep-2020 11:09                2697
imagickdraw.affine.php                             28-Sep-2020 11:09               18585
imagickdraw.annotation.php                         28-Sep-2020 11:09                2977
imagickdraw.arc.php                                28-Sep-2020 11:09                9625
imagickdraw.bezier.php                             28-Sep-2020 11:09               19507
imagickdraw.circle.php                             28-Sep-2020 11:09                9031
imagickdraw.clear.php                              28-Sep-2020 11:09                2101
imagickdraw.clone.php                              28-Sep-2020 11:09                2215
imagickdraw.color.php                              28-Sep-2020 11:09                3017
imagickdraw.comment.php                            28-Sep-2020 11:09                2466
imagickdraw.composite.php                          28-Sep-2020 11:09               11771
imagickdraw.construct.php                          28-Sep-2020 11:09                2037
imagickdraw.destroy.php                            28-Sep-2020 11:09                2083
imagickdraw.ellipse.php                            28-Sep-2020 11:09               12217
imagickdraw.getclippath.php                        28-Sep-2020 11:09                2147
imagickdraw.getcliprule.php                        28-Sep-2020 11:09                2150
imagickdraw.getclipunits.php                       28-Sep-2020 11:09                2129
imagickdraw.getfillcolor.php                       28-Sep-2020 11:09                2198
imagickdraw.getfillopacity.php                     28-Sep-2020 11:09                2180
imagickdraw.getfillrule.php                        28-Sep-2020 11:09                2102
imagickdraw.getfont.php                            28-Sep-2020 11:09                2118
imagickdraw.getfontfamily.php                      28-Sep-2020 11:09                2172
imagickdraw.getfontsize.php                        28-Sep-2020 11:09                2167
imagickdraw.getfontstretch.php                     28-Sep-2020 11:09                2211
imagickdraw.getfontstyle.php                       28-Sep-2020 11:09                2204
imagickdraw.getfontweight.php                      28-Sep-2020 11:09                2148
imagickdraw.getgravity.php                         28-Sep-2020 11:09                2178
imagickdraw.getstrokeantialias.php                 28-Sep-2020 11:09                2432
imagickdraw.getstrokecolor.php                     28-Sep-2020 11:09                2596
imagickdraw.getstrokedasharray.php                 28-Sep-2020 11:09                2303
imagickdraw.getstrokedashoffset.php                28-Sep-2020 11:09                2276
imagickdraw.getstrokelinecap.php                   28-Sep-2020 11:09                2302
imagickdraw.getstrokelinejoin.php                  28-Sep-2020 11:09                2328
imagickdraw.getstrokemiterlimit.php                28-Sep-2020 11:09                2538
imagickdraw.getstrokeopacity.php                   28-Sep-2020 11:09                2199
imagickdraw.getstrokewidth.php                     28-Sep-2020 11:09                2214
imagickdraw.gettextalignment.php                   28-Sep-2020 11:09                2201
imagickdraw.gettextantialias.php                   28-Sep-2020 11:09                2315
imagickdraw.gettextdecoration.php                  28-Sep-2020 11:09                2226
imagickdraw.gettextencoding.php                    28-Sep-2020 11:09                2272
imagickdraw.gettextinterlinespacing.php            28-Sep-2020 11:09                2277
imagickdraw.gettextinterwordspacing.php            28-Sep-2020 11:09                2277
imagickdraw.gettextkerning.php                     28-Sep-2020 11:09                2191
imagickdraw.gettextundercolor.php                  28-Sep-2020 11:09                2296
imagickdraw.getvectorgraphics.php                  28-Sep-2020 11:09                2283
imagickdraw.line.php                               28-Sep-2020 11:09                8207
imagickdraw.matte.php                              28-Sep-2020 11:09                8173
imagickdraw.pathclose.php                          28-Sep-2020 11:09                2289
imagickdraw.pathcurvetoabsolute.php                28-Sep-2020 11:09                4237
imagickdraw.pathcurvetoquadraticbezierabsolute.php 28-Sep-2020 11:09               11992
imagickdraw.pathcurvetoquadraticbezierrelative.php 28-Sep-2020 11:09                3757
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 28-Sep-2020 11:09               10654
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 28-Sep-2020 11:09               10807
imagickdraw.pathcurvetorelative.php                28-Sep-2020 11:09                4253
imagickdraw.pathcurvetosmoothabsolute.php          28-Sep-2020 11:09                4138
imagickdraw.pathcurvetosmoothrelative.php          28-Sep-2020 11:09                4145
imagickdraw.pathellipticarcabsolute.php            28-Sep-2020 11:09                4811
imagickdraw.pathellipticarcrelative.php            28-Sep-2020 11:09                4781
imagickdraw.pathfinish.php                         28-Sep-2020 11:09                2121
imagickdraw.pathlinetoabsolute.php                 28-Sep-2020 11:09                2927
imagickdraw.pathlinetohorizontalabsolute.php       28-Sep-2020 11:09                2801
imagickdraw.pathlinetohorizontalrelative.php       28-Sep-2020 11:09                2796
imagickdraw.pathlinetorelative.php                 28-Sep-2020 11:09                2961
imagickdraw.pathlinetoverticalabsolute.php         28-Sep-2020 11:09                2767
imagickdraw.pathlinetoverticalrelative.php         28-Sep-2020 11:09                2772
imagickdraw.pathmovetoabsolute.php                 28-Sep-2020 11:09                2958
imagickdraw.pathmovetorelative.php                 28-Sep-2020 11:09                2894
imagickdraw.pathstart.php                          28-Sep-2020 11:09               12384
imagickdraw.point.php                              28-Sep-2020 11:09                6953
imagickdraw.polygon.php                            28-Sep-2020 11:09                9369
imagickdraw.polyline.php                           28-Sep-2020 11:09                9362
imagickdraw.pop.php                                28-Sep-2020 11:09                2385
imagickdraw.popclippath.php                        28-Sep-2020 11:09                2079
imagickdraw.popdefs.php                            28-Sep-2020 11:09                8016
imagickdraw.poppattern.php                         28-Sep-2020 11:09                2166
imagickdraw.push.php                               28-Sep-2020 11:09                8552
imagickdraw.pushclippath.php                       28-Sep-2020 11:09                2595
imagickdraw.pushdefs.php                           28-Sep-2020 11:09                2292
imagickdraw.pushpattern.php                        28-Sep-2020 11:09               14976
imagickdraw.rectangle.php                          28-Sep-2020 11:09                8443
imagickdraw.render.php                             28-Sep-2020 11:09                2212
imagickdraw.resetvectorgraphics.php                28-Sep-2020 11:09                2238
imagickdraw.rotate.php                             28-Sep-2020 11:09                7893
imagickdraw.roundrectangle.php                     28-Sep-2020 11:09                9104
imagickdraw.scale.php                              28-Sep-2020 11:09                8196
imagickdraw.setclippath.php                        28-Sep-2020 11:09                8629
imagickdraw.setcliprule.php                        28-Sep-2020 11:09                9592
imagickdraw.setclipunits.php                       28-Sep-2020 11:09                9078
imagickdraw.setfillalpha.php                       28-Sep-2020 11:09                7904
imagickdraw.setfillcolor.php                       28-Sep-2020 11:09                7979
imagickdraw.setfillopacity.php                     28-Sep-2020 11:09                7965
imagickdraw.setfillpatternurl.php                  28-Sep-2020 11:09                2906
imagickdraw.setfillrule.php                        28-Sep-2020 11:09               14539
imagickdraw.setfont.php                            28-Sep-2020 11:09                9482
imagickdraw.setfontfamily.php                      28-Sep-2020 11:09               10178
imagickdraw.setfontsize.php                        28-Sep-2020 11:09                8566
imagickdraw.setfontstretch.php                     28-Sep-2020 11:09               10252
imagickdraw.setfontstyle.php                       28-Sep-2020 11:09                9066
imagickdraw.setfontweight.php                      28-Sep-2020 11:09                9392
imagickdraw.setgravity.php                         28-Sep-2020 11:09               11163
imagickdraw.setresolution.php                      28-Sep-2020 11:09                2597
imagickdraw.setstrokealpha.php                     28-Sep-2020 11:09                8612
imagickdraw.setstrokeantialias.php                 28-Sep-2020 11:09                9166
imagickdraw.setstrokecolor.php                     28-Sep-2020 11:09                8729
imagickdraw.setstrokedasharray.php                 28-Sep-2020 11:09               13818
imagickdraw.setstrokedashoffset.php                28-Sep-2020 11:09               10238
imagickdraw.setstrokelinecap.php                   28-Sep-2020 11:09                8749
imagickdraw.setstrokelinejoin.php                  28-Sep-2020 11:09               12327
imagickdraw.setstrokemiterlimit.php                28-Sep-2020 11:09               12062
imagickdraw.setstrokeopacity.php                   28-Sep-2020 11:09               10536
imagickdraw.setstrokepatternurl.php                28-Sep-2020 11:09                2621
imagickdraw.setstrokewidth.php                     28-Sep-2020 11:09                8643
imagickdraw.settextalignment.php                   28-Sep-2020 11:09                9543
imagickdraw.settextantialias.php                   28-Sep-2020 11:09                9145
imagickdraw.settextdecoration.php                  28-Sep-2020 11:09                7428
imagickdraw.settextencoding.php                    28-Sep-2020 11:09                2892
imagickdraw.settextinterlinespacing.php            28-Sep-2020 11:09                2670
imagickdraw.settextinterwordspacing.php            28-Sep-2020 11:09                2473
imagickdraw.settextkerning.php                     28-Sep-2020 11:09                2582
imagickdraw.settextundercolor.php                  28-Sep-2020 11:09                7986
imagickdraw.setvectorgraphics.php                  28-Sep-2020 11:09                9276
imagickdraw.setviewbox.php                         28-Sep-2020 11:09               10682
imagickdraw.skewx.php                              28-Sep-2020 11:09                8406
imagickdraw.skewy.php                              28-Sep-2020 11:09                8395
imagickdraw.translate.php                          28-Sep-2020 11:09                8689
imagickkernel.addkernel.php                        28-Sep-2020 11:09                7538
imagickkernel.addunitykernel.php                   28-Sep-2020 11:09               15887
imagickkernel.frombuiltin.php                      28-Sep-2020 11:09               29594
imagickkernel.frommatrix.php                       28-Sep-2020 11:09               25932
imagickkernel.getmatrix.php                        28-Sep-2020 11:09                8172
imagickkernel.scale.php                            28-Sep-2020 11:09               15065
imagickkernel.separate.php                         28-Sep-2020 11:09               11705
imagickpixel.clear.php                             28-Sep-2020 11:09                2165
imagickpixel.construct.php                         28-Sep-2020 11:09               13675
imagickpixel.destroy.php                           28-Sep-2020 11:09                2252
imagickpixel.getcolor.php                          28-Sep-2020 11:09                5981
imagickpixel.getcolorasstring.php                  28-Sep-2020 11:09                4742
imagickpixel.getcolorcount.php                     28-Sep-2020 11:09                4693
imagickpixel.getcolorquantum.php                   28-Sep-2020 11:09                2721
imagickpixel.getcolorvalue.php                     28-Sep-2020 11:09                8596
imagickpixel.getcolorvaluequantum.php              28-Sep-2020 11:09                6503
imagickpixel.gethsl.php                            28-Sep-2020 11:09                4036
imagickpixel.getindex.php                          28-Sep-2020 11:09                2131
imagickpixel.ispixelsimilar.php                    28-Sep-2020 11:09                3349
imagickpixel.ispixelsimilarquantum.php             28-Sep-2020 11:09                2876
imagickpixel.issimilar.php                         28-Sep-2020 11:09               22701
imagickpixel.setcolor.php                          28-Sep-2020 11:09                7548
imagickpixel.setcolorcount.php                     28-Sep-2020 11:09                2387
imagickpixel.setcolorvalue.php                     28-Sep-2020 11:09                4818
imagickpixel.setcolorvaluequantum.php              28-Sep-2020 11:09                8486
imagickpixel.sethsl.php                            28-Sep-2020 11:09                7382
imagickpixel.setindex.php                          28-Sep-2020 11:09                2315
imagickpixeliterator.clear.php                     28-Sep-2020 11:09                7103
imagickpixeliterator.construct.php                 28-Sep-2020 11:09                6778
imagickpixeliterator.destroy.php                   28-Sep-2020 11:09                2285
imagickpixeliterator.getcurrentiteratorrow.php     28-Sep-2020 11:09                2430
imagickpixeliterator.getiteratorrow.php            28-Sep-2020 11:09                2362
imagickpixeliterator.getnextiteratorrow.php        28-Sep-2020 11:09                7898
imagickpixeliterator.getpreviousiteratorrow.php    28-Sep-2020 11:09                2498
imagickpixeliterator.newpixeliterator.php          28-Sep-2020 11:09                2492
imagickpixeliterator.newpixelregioniterator.php    28-Sep-2020 11:09                3724
imagickpixeliterator.resetiterator.php             28-Sep-2020 11:09               10388
imagickpixeliterator.setiteratorfirstrow.php       28-Sep-2020 11:09                2367
imagickpixeliterator.setiteratorlastrow.php        28-Sep-2020 11:09                2361
imagickpixeliterator.setiteratorrow.php            28-Sep-2020 11:09                7740
imagickpixeliterator.synciterator.php              28-Sep-2020 11:09                2222
imap.configuration.php                             28-Sep-2020 11:09                3163
imap.constants.php                                 28-Sep-2020 11:09               22051
imap.installation.php                              28-Sep-2020 11:09                2652
imap.requirements.php                              28-Sep-2020 11:09                3000
imap.resources.php                                 28-Sep-2020 11:09                1261
imap.setup.php                                     28-Sep-2020 11:09                1477
index.php                                          28-Sep-2020 11:09               15803
indexes.examples.php                               28-Sep-2020 11:09              794218
indexes.functions.php                              28-Sep-2020 11:09             1275717
indexes.php                                        28-Sep-2020 11:09                1405
infiniteiterator.construct.php                     28-Sep-2020 11:09                5553
infiniteiterator.next.php                          28-Sep-2020 11:09                3094
info.configuration.php                             28-Sep-2020 11:08               20946
info.constants.php                                 28-Sep-2020 11:08               15549
info.installation.php                              28-Sep-2020 11:08                1126
info.requirements.php                              28-Sep-2020 11:08                1102
info.resources.php                                 28-Sep-2020 11:08                1085
info.setup.php                                     28-Sep-2020 11:08                1475
ingres.configuration.php                           28-Sep-2020 11:08               15408
ingres.constants.php                               28-Sep-2020 11:08               24758
ingres.examples-basic.php                          28-Sep-2020 11:08                6210
ingres.examples.php                                28-Sep-2020 11:08                1278
ingres.installation.php                            28-Sep-2020 11:08                4506
ingres.requirements.php                            28-Sep-2020 11:08                1318
ingres.resources.php                               28-Sep-2020 11:08                1625
ingres.setup.php                                   28-Sep-2020 11:08                1501
ini.core.php                                       28-Sep-2020 11:09               90820
ini.list.php                                       28-Sep-2020 11:09              131490
ini.php                                            28-Sep-2020 11:09                1478
ini.sect.safe-mode.php                             28-Sep-2020 11:08               12843
ini.sections.php                                   28-Sep-2020 11:09                3999
inotify.configuration.php                          28-Sep-2020 11:09                1169
inotify.constants.php                              28-Sep-2020 11:09                9215
inotify.install.php                                28-Sep-2020 11:09                1621
inotify.requirements.php                           28-Sep-2020 11:09                1123
inotify.resources.php                              28-Sep-2020 11:09                1218
inotify.setup.php                                  28-Sep-2020 11:09                1508
install.cloud.azure.php                            28-Sep-2020 11:08                4187
install.cloud.ec2.php                              28-Sep-2020 11:08                1330
install.cloud.php                                  28-Sep-2020 11:08                1520
install.fpm.configuration.php                      28-Sep-2020 11:08               30528
install.fpm.install.php                            28-Sep-2020 11:08                2209
install.fpm.php                                    28-Sep-2020 11:08                3679
install.general.php                                28-Sep-2020 11:08                4693
install.macosx.bundled.php                         28-Sep-2020 11:08               10584
install.macosx.compile.php                         28-Sep-2020 11:08                1240
install.macosx.packages.php                        28-Sep-2020 11:08                2633
install.macosx.php                                 28-Sep-2020 11:08                1757
install.pecl.downloads.php                         28-Sep-2020 11:08                3291
install.pecl.intro.php                             28-Sep-2020 11:08                2949
install.pecl.pear.php                              28-Sep-2020 11:08                2827
install.pecl.php                                   28-Sep-2020 11:08                1875
install.pecl.php-config.php                        28-Sep-2020 11:08                3694
install.pecl.phpize.php                            28-Sep-2020 11:08                2904
install.pecl.static.php                            28-Sep-2020 11:08                2989
install.pecl.windows.php                           28-Sep-2020 11:08                8977
install.php                                        28-Sep-2020 11:08                5506
install.problems.bugs.php                          28-Sep-2020 11:08                1733
install.problems.faq.php                           28-Sep-2020 11:08                1206
install.problems.php                               28-Sep-2020 11:08                1490
install.problems.support.php                       28-Sep-2020 11:08                2298
install.unix.apache.php                            28-Sep-2020 11:08               13295
install.unix.apache2.php                           28-Sep-2020 11:08               13401
install.unix.commandline.php                       28-Sep-2020 11:08                3815
install.unix.debian.php                            28-Sep-2020 11:08                7103
install.unix.hpux.php                              28-Sep-2020 11:08                2060
install.unix.lighttpd-14.php                       28-Sep-2020 11:08                6297
install.unix.litespeed.php                         28-Sep-2020 11:08                8901
install.unix.nginx.php                             28-Sep-2020 11:08                8910
install.unix.openbsd.php                           28-Sep-2020 11:08                5948
install.unix.php                                   28-Sep-2020 11:08                8566
install.unix.solaris.php                           28-Sep-2020 11:08                3765
install.unix.sun.php                               28-Sep-2020 11:08               17159
install.windows.legacy.index.php                   28-Sep-2020 11:08               99013
install.windows.manual.php                         28-Sep-2020 11:08                5922
install.windows.pecl.php                           28-Sep-2020 11:08                1455
install.windows.php                                28-Sep-2020 11:08                3239
install.windows.recommended.php                    28-Sep-2020 11:08                4534
install.windows.requirements.php                   28-Sep-2020 11:08                3126
install.windows.tools.php                          28-Sep-2020 11:08                1888
install.windows.troubleshooting.php                28-Sep-2020 11:08                1578
internals2.apiref.php                              28-Sep-2020 11:09                1073
internals2.buildsys.configunix.php                 28-Sep-2020 11:09               20186
internals2.buildsys.configwin.php                  28-Sep-2020 11:09                4486
internals2.buildsys.environment.php                28-Sep-2020 11:09                2451
internals2.buildsys.php                            28-Sep-2020 11:09                2245
internals2.buildsys.skeleton.php                   28-Sep-2020 11:09                4238
internals2.classes.php                             28-Sep-2020 11:09                1065
internals2.counter.basic-interface.php             28-Sep-2020 11:09                1804
internals2.counter.constants.php                   28-Sep-2020 11:09                4173
internals2.counter.counter-class.bumpvalue.php     28-Sep-2020 11:09                2957
internals2.counter.counter-class.construct.php     28-Sep-2020 11:09                3445
internals2.counter.counter-class.getmeta.php       28-Sep-2020 11:09                2763
internals2.counter.counter-class.getnamed.php      28-Sep-2020 11:09                2878
internals2.counter.counter-class.getvalue.php      28-Sep-2020 11:09                2801
internals2.counter.counter-class.php               28-Sep-2020 11:09                5643
internals2.counter.counter-class.resetvalue.php    28-Sep-2020 11:09                2578
internals2.counter.counter-class.setcounterclas..> 28-Sep-2020 11:09                2904
internals2.counter.examples.basic.php              28-Sep-2020 11:09                3203
internals2.counter.examples.extended.php           28-Sep-2020 11:09                8802
internals2.counter.examples.objective.php          28-Sep-2020 11:09                8026
internals2.counter.examples.php                    28-Sep-2020 11:09                1597
internals2.counter.extended-interface.php          28-Sep-2020 11:09                2304
internals2.counter.function.counter-bump-value.php 28-Sep-2020 11:09                3411
internals2.counter.function.counter-bump.php       28-Sep-2020 11:09                3000
internals2.counter.function.counter-create.php     28-Sep-2020 11:09                3117
internals2.counter.function.counter-get-meta.php   28-Sep-2020 11:09                3127
internals2.counter.function.counter-get-named.php  28-Sep-2020 11:09                2854
internals2.counter.function.counter-get-value.php  28-Sep-2020 11:09                3323
internals2.counter.function.counter-get.php        28-Sep-2020 11:09                2759
internals2.counter.function.counter-reset-value..> 28-Sep-2020 11:09                3108
internals2.counter.function.counter-reset.php      28-Sep-2020 11:09                2556
internals2.counter.ini.php                         28-Sep-2020 11:09                3848
internals2.counter.intro.php                       28-Sep-2020 11:09                1781
internals2.counter.php                             28-Sep-2020 11:09                2614
internals2.counter.resources.php                   28-Sep-2020 11:09                1204
internals2.counter.setup.php                       28-Sep-2020 11:09                1596
internals2.faq.php                                 28-Sep-2020 11:09                1067
internals2.funcs.php                               28-Sep-2020 11:09               13756
internals2.ini.php                                 28-Sep-2020 11:09                1082
internals2.memory.management.php                   28-Sep-2020 11:09                8350
internals2.memory.persistence.php                  28-Sep-2020 11:09                5068
internals2.memory.php                              28-Sep-2020 11:09                1734
internals2.memory.tsrm.php                         28-Sep-2020 11:09                8730
internals2.opcodes.add-array-element.php           28-Sep-2020 11:09                3889
internals2.opcodes.add-char.php                    28-Sep-2020 11:09                3046
internals2.opcodes.add-interface.php               28-Sep-2020 11:09                3510
internals2.opcodes.add-string.php                  28-Sep-2020 11:09                3255
internals2.opcodes.add-var.php                     28-Sep-2020 11:09                3261
internals2.opcodes.add.php                         28-Sep-2020 11:09                2828
internals2.opcodes.assign-add.php                  28-Sep-2020 11:09                2615
internals2.opcodes.assign-bw-and.php               28-Sep-2020 11:09                2697
internals2.opcodes.assign-bw-or.php                28-Sep-2020 11:09                2693
internals2.opcodes.assign-bw-xor.php               28-Sep-2020 11:09                2693
internals2.opcodes.assign-concat.php               28-Sep-2020 11:09                2699
internals2.opcodes.assign-dim.php                  28-Sep-2020 11:09                3441
internals2.opcodes.assign-div.php                  28-Sep-2020 11:09                2615
internals2.opcodes.assign-mod.php                  28-Sep-2020 11:09                2634
internals2.opcodes.assign-mul.php                  28-Sep-2020 11:09                2622
internals2.opcodes.assign-obj.php                  28-Sep-2020 11:09                2847
internals2.opcodes.assign-ref.php                  28-Sep-2020 11:09                2883
internals2.opcodes.assign-sl.php                   28-Sep-2020 11:09                2657
internals2.opcodes.assign-sr.php                   28-Sep-2020 11:09                2658
internals2.opcodes.assign-sub.php                  28-Sep-2020 11:09                2628
internals2.opcodes.assign.php                      28-Sep-2020 11:09                3812
internals2.opcodes.begin-silence.php               28-Sep-2020 11:09                5199
internals2.opcodes.bool-not.php                    28-Sep-2020 11:09                2676
internals2.opcodes.bool-xor.php                    28-Sep-2020 11:09                2762
internals2.opcodes.bool.php                        28-Sep-2020 11:09                4059
internals2.opcodes.brk.php                         28-Sep-2020 11:09                4064
internals2.opcodes.bw-and.php                      28-Sep-2020 11:09                2741
internals2.opcodes.bw-not.php                      28-Sep-2020 11:09                2648
internals2.opcodes.bw-or.php                       28-Sep-2020 11:09                2734
internals2.opcodes.bw-xor.php                      28-Sep-2020 11:09                2737
internals2.opcodes.case.php                        28-Sep-2020 11:09                6525
internals2.opcodes.cast.php                        28-Sep-2020 11:09                2662
internals2.opcodes.catch.php                       28-Sep-2020 11:09                6981
internals2.opcodes.clone.php                       28-Sep-2020 11:09                3647
internals2.opcodes.concat.php                      28-Sep-2020 11:09                2800
internals2.opcodes.cont.php                        28-Sep-2020 11:09                3835
internals2.opcodes.declare-class.php               28-Sep-2020 11:09                3717
internals2.opcodes.declare-const.php               28-Sep-2020 11:09                1592
internals2.opcodes.declare-function.php            28-Sep-2020 11:09                3223
internals2.opcodes.declare-inherited-class-dela..> 28-Sep-2020 11:09                1676
internals2.opcodes.declare-inherited-class.php     28-Sep-2020 11:09                7224
internals2.opcodes.div.php                         28-Sep-2020 11:09                2827
internals2.opcodes.do-fcall-by-name.php            28-Sep-2020 11:09                3511
internals2.opcodes.do-fcall.php                    28-Sep-2020 11:09                2822
internals2.opcodes.echo.php                        28-Sep-2020 11:09                2496
internals2.opcodes.end-silence.php                 28-Sep-2020 11:09                5068
internals2.opcodes.exit.php                        28-Sep-2020 11:09                2517
internals2.opcodes.ext-fcall-begin.php             28-Sep-2020 11:09                1578
internals2.opcodes.ext-fcall-end.php               28-Sep-2020 11:09                1578
internals2.opcodes.ext-nop.php                     28-Sep-2020 11:09                1546
internals2.opcodes.ext-stmt.php                    28-Sep-2020 11:09                2348
internals2.opcodes.fe-fetch.php                    28-Sep-2020 11:09                5281
internals2.opcodes.fe-reset.php                    28-Sep-2020 11:09                5290
internals2.opcodes.fetch-class.php                 28-Sep-2020 11:09                3136
internals2.opcodes.fetch-constant.php              28-Sep-2020 11:09                3734
internals2.opcodes.fetch-dim-func-arg.php          28-Sep-2020 11:09                7198
internals2.opcodes.fetch-dim-is.php                28-Sep-2020 11:09                1586
internals2.opcodes.fetch-dim-r.php                 28-Sep-2020 11:09                4515
internals2.opcodes.fetch-dim-rw.php                28-Sep-2020 11:09                4686
internals2.opcodes.fetch-dim-tmp-var.php           28-Sep-2020 11:09                3313
internals2.opcodes.fetch-dim-unset.php             28-Sep-2020 11:09                1732
internals2.opcodes.fetch-dim-w.php                 28-Sep-2020 11:09                4214
internals2.opcodes.fetch-func-arg.php              28-Sep-2020 11:09                5395
internals2.opcodes.fetch-is.php                    28-Sep-2020 11:09                5309
internals2.opcodes.fetch-obj-func-arg.php          28-Sep-2020 11:09                8419
internals2.opcodes.fetch-obj-is.php                28-Sep-2020 11:09                1586
internals2.opcodes.fetch-obj-r.php                 28-Sep-2020 11:09                4346
internals2.opcodes.fetch-obj-rw.php                28-Sep-2020 11:09                4333
internals2.opcodes.fetch-obj-unset.php             28-Sep-2020 11:09                1725
internals2.opcodes.fetch-obj-w.php                 28-Sep-2020 11:09                5625
internals2.opcodes.fetch-r.php                     28-Sep-2020 11:09                3464
internals2.opcodes.fetch-rw.php                    28-Sep-2020 11:09                3625
internals2.opcodes.fetch-unset.php                 28-Sep-2020 11:09                1647
internals2.opcodes.fetch-w.php                     28-Sep-2020 11:09                3537
internals2.opcodes.free.php                        28-Sep-2020 11:09                2711
internals2.opcodes.goto.php                        28-Sep-2020 11:09                1529
internals2.opcodes.handle-exception.php            28-Sep-2020 11:09                2194
internals2.opcodes.include-or-eval.php             28-Sep-2020 11:09                3678
internals2.opcodes.init-array.php                  28-Sep-2020 11:09                4001
internals2.opcodes.init-fcall-by-name.php          28-Sep-2020 11:09                3468
internals2.opcodes.init-method-call.php            28-Sep-2020 11:09                5534
internals2.opcodes.init-ns-fcall-by-name.php       28-Sep-2020 11:09                1651
internals2.opcodes.init-static-method-call.php     28-Sep-2020 11:09                4606
internals2.opcodes.init-string.php                 28-Sep-2020 11:09                3268
internals2.opcodes.instanceof.php                  28-Sep-2020 11:09                4408
internals2.opcodes.is-equal.php                    28-Sep-2020 11:09                3364
internals2.opcodes.is-identical.php                28-Sep-2020 11:09                3445
internals2.opcodes.is-not-equal.php                28-Sep-2020 11:09                2852
internals2.opcodes.is-not-identical.php            28-Sep-2020 11:09                2931
internals2.opcodes.is-smaller-or-equal.php         28-Sep-2020 11:09                2927
internals2.opcodes.is-smaller.php                  28-Sep-2020 11:09                2844
internals2.opcodes.isset-isempty-dim-obj.php       28-Sep-2020 11:09                3437
internals2.opcodes.isset-isempty-prop-obj.php      28-Sep-2020 11:09                4312
internals2.opcodes.isset-isempty-var.php           28-Sep-2020 11:09                3304
internals2.opcodes.jmp.php                         28-Sep-2020 11:09                3594
internals2.opcodes.jmpnz-ex.php                    28-Sep-2020 11:09                3247
internals2.opcodes.jmpnz.php                       28-Sep-2020 11:09                4299
internals2.opcodes.jmpz-ex.php                     28-Sep-2020 11:09                2269
internals2.opcodes.jmpz.php                        28-Sep-2020 11:09                3291
internals2.opcodes.jmpznz.php                      28-Sep-2020 11:09                4455
internals2.opcodes.list.php                        28-Sep-2020 11:09               11294
internals2.opcodes.mod.php                         28-Sep-2020 11:09                2780
internals2.opcodes.mul.php                         28-Sep-2020 11:09                2763
internals2.opcodes.new.php                         28-Sep-2020 11:09                3204
internals2.opcodes.nop.php                         28-Sep-2020 11:09                2992
internals2.opcodes.php                             28-Sep-2020 11:09               23291
internals2.opcodes.post-dec-obj.php                28-Sep-2020 11:09                3687
internals2.opcodes.post-dec.php                    28-Sep-2020 11:09                2759
internals2.opcodes.post-inc-obj.php                28-Sep-2020 11:09                3843
internals2.opcodes.post-inc.php                    28-Sep-2020 11:09                2777
internals2.opcodes.pre-dec-obj.php                 28-Sep-2020 11:09                3494
internals2.opcodes.pre-dec.php                     28-Sep-2020 11:09                2624
internals2.opcodes.pre-inc-obj.php                 28-Sep-2020 11:09                3490
internals2.opcodes.pre-inc.php                     28-Sep-2020 11:09                2621
internals2.opcodes.print.php                       28-Sep-2020 11:09                2658
internals2.opcodes.qm-assign.php                   28-Sep-2020 11:09                7322
internals2.opcodes.raise-abstract-error.php        28-Sep-2020 11:09                8749
internals2.opcodes.recv-init.php                   28-Sep-2020 11:09                3538
internals2.opcodes.recv.php                        28-Sep-2020 11:09                3525
internals2.opcodes.return-by-ref.php               28-Sep-2020 11:09                1562
internals2.opcodes.return.php                      28-Sep-2020 11:09                2498
internals2.opcodes.send-ref.php                    28-Sep-2020 11:09                3480
internals2.opcodes.send-val.php                    28-Sep-2020 11:09                5064
internals2.opcodes.send-var-no-ref.php             28-Sep-2020 11:09                1564
internals2.opcodes.send-var.php                    28-Sep-2020 11:09                4647
internals2.opcodes.sl.php                          28-Sep-2020 11:09                2836
internals2.opcodes.sr.php                          28-Sep-2020 11:09                2811
internals2.opcodes.sub.php                         28-Sep-2020 11:09                2779
internals2.opcodes.switch-free.php                 28-Sep-2020 11:09                5163
internals2.opcodes.throw.php                       28-Sep-2020 11:09                6995
internals2.opcodes.ticks.php                       28-Sep-2020 11:09                7775
internals2.opcodes.unset-dim.php                   28-Sep-2020 11:09                3755
internals2.opcodes.unset-obj.php                   28-Sep-2020 11:09                3630
internals2.opcodes.unset-var.php                   28-Sep-2020 11:09                3232
internals2.opcodes.user-opcode.php                 28-Sep-2020 11:09                1584
internals2.opcodes.verify-abstract-class.php       28-Sep-2020 11:09                1652
internals2.opcodes.zend-declare-lambda-function..> 28-Sep-2020 11:09                1675
internals2.opcodes.zend-jmp-set.php                28-Sep-2020 11:09                1593
internals2.pdo.building.php                        28-Sep-2020 11:09                2245
internals2.pdo.constants.php                       28-Sep-2020 11:09                4786
internals2.pdo.error-handling.php                  28-Sep-2020 11:09                3285
internals2.pdo.implementing.php                    28-Sep-2020 11:09               47280
internals2.pdo.packaging.php                       28-Sep-2020 11:09                2925
internals2.pdo.pdo-dbh-t.php                       28-Sep-2020 11:09                9564
internals2.pdo.pdo-stmt-t.php                      28-Sep-2020 11:09                6606
internals2.pdo.php                                 28-Sep-2020 11:09                2524
internals2.pdo.preparation.php                     28-Sep-2020 11:09                7514
internals2.pdo.prerequisites.php                   28-Sep-2020 11:09                2969
internals2.pdo.testing.php                         28-Sep-2020 11:09                3964
internals2.php                                     28-Sep-2020 11:09                5926
internals2.preface.php                             28-Sep-2020 11:09                2736
internals2.resources.php                           28-Sep-2020 11:09                1229
internals2.streams.php                             28-Sep-2020 11:09                1424
internals2.structure.basics.php                    28-Sep-2020 11:09                6778
internals2.structure.files.php                     28-Sep-2020 11:09                5978
internals2.structure.globals.php                   28-Sep-2020 11:09                8977
internals2.structure.lifecycle.php                 28-Sep-2020 11:09                8282
internals2.structure.modstruct.php                 28-Sep-2020 11:09               24752
internals2.structure.php                           28-Sep-2020 11:09                2386
internals2.structure.tests.php                     28-Sep-2020 11:09                1654
internals2.variables.arrays.php                    28-Sep-2020 11:09                8332
internals2.variables.intro.php                     28-Sep-2020 11:09               16729
internals2.variables.objects.php                   28-Sep-2020 11:09                1100
internals2.variables.php                           28-Sep-2020 11:09                1642
internals2.variables.tables.php                    28-Sep-2020 11:09               15733
internals2.ze1.intro.php                           28-Sep-2020 11:09                1647
internals2.ze1.php                                 28-Sep-2020 11:09                1827
internals2.ze1.streams.php                         28-Sep-2020 11:09               16139
internals2.ze1.tsrm.php                            28-Sep-2020 11:09                1006
internals2.ze1.zendapi.php                         28-Sep-2020 11:09              216010
intl.configuration.php                             28-Sep-2020 11:09                5104
intl.constants.php                                 28-Sep-2020 11:09                8796
intl.examples.basic.php                            28-Sep-2020 11:09                4359
intl.examples.php                                  28-Sep-2020 11:09                1280
intl.installation.php                              28-Sep-2020 11:09                2258
intl.requirements.php                              28-Sep-2020 11:09                1479
intl.resources.php                                 28-Sep-2020 11:09                1085
intl.setup.php                                     28-Sep-2020 11:09                1475
intlbreakiterator.construct.php                    28-Sep-2020 11:09                2364
intlbreakiterator.createcharacterinstance.php      28-Sep-2020 11:09                2826
intlbreakiterator.createcodepointinstance.php      28-Sep-2020 11:09                2672
intlbreakiterator.createlineinstance.php           28-Sep-2020 11:09                2792
intlbreakiterator.createsentenceinstance.php       28-Sep-2020 11:09                2790
intlbreakiterator.createtitleinstance.php          28-Sep-2020 11:09                2773
intlbreakiterator.createwordinstance.php           28-Sep-2020 11:09                2728
intlbreakiterator.current.php                      28-Sep-2020 11:09                2346
intlbreakiterator.first.php                        28-Sep-2020 11:09                2332
intlbreakiterator.following.php                    28-Sep-2020 11:09                2539
intlbreakiterator.geterrorcode.php                 28-Sep-2020 11:09                2866
intlbreakiterator.geterrormessage.php              28-Sep-2020 11:09                2908
intlbreakiterator.getlocale.php                    28-Sep-2020 11:09                2548
intlbreakiterator.getpartsiterator.php             28-Sep-2020 11:09                3333
intlbreakiterator.gettext.php                      28-Sep-2020 11:09                2352
intlbreakiterator.isboundary.php                   28-Sep-2020 11:09                2507
intlbreakiterator.last.php                         28-Sep-2020 11:09                2332
intlbreakiterator.next.php                         28-Sep-2020 11:09                2450
intlbreakiterator.preceding.php                    28-Sep-2020 11:09                2517
intlbreakiterator.previous.php                     28-Sep-2020 11:09                2384
intlbreakiterator.settext.php                      28-Sep-2020 11:09                2474
intlcalendar.add.php                               28-Sep-2020 11:09                8224
intlcalendar.after.php                             28-Sep-2020 11:09                6498
intlcalendar.before.php                            28-Sep-2020 11:09                3735
intlcalendar.clear.php                             28-Sep-2020 11:09               20469
intlcalendar.construct.php                         28-Sep-2020 11:09                2451
intlcalendar.createinstance.php                    28-Sep-2020 11:09               11976
intlcalendar.equals.php                            28-Sep-2020 11:09               10710
intlcalendar.fielddifference.php                   28-Sep-2020 11:09               10954
intlcalendar.fromdatetime.php                      28-Sep-2020 11:09                6600
intlcalendar.get.php                               28-Sep-2020 11:09                8516
intlcalendar.getactualmaximum.php                  28-Sep-2020 11:09                8119
intlcalendar.getactualminimum.php                  28-Sep-2020 11:09                5264
intlcalendar.getavailablelocales.php               28-Sep-2020 11:09                4305
intlcalendar.getdayofweektype.php                  28-Sep-2020 11:09                9530
intlcalendar.geterrorcode.php                      28-Sep-2020 11:09                8742
intlcalendar.geterrormessage.php                   28-Sep-2020 11:09                5685
intlcalendar.getfirstdayofweek.php                 28-Sep-2020 11:09                8193
intlcalendar.getgreatestminimum.php                28-Sep-2020 11:09                4108
intlcalendar.getkeywordvaluesforlocale.php         28-Sep-2020 11:09                7283
intlcalendar.getleastmaximum.php                   28-Sep-2020 11:09                7923
intlcalendar.getlocale.php                         28-Sep-2020 11:09                5634
intlcalendar.getmaximum.php                        28-Sep-2020 11:09                4809
intlcalendar.getminimaldaysinfirstweek.php         28-Sep-2020 11:09                8785
intlcalendar.getminimum.php                        28-Sep-2020 11:09                4060
intlcalendar.getnow.php                            28-Sep-2020 11:09                5395
intlcalendar.getrepeatedwalltimeoption.php         28-Sep-2020 11:09               10185
intlcalendar.getskippedwalltimeoption.php          28-Sep-2020 11:09               12595
intlcalendar.gettime.php                           28-Sep-2020 11:09                6157
intlcalendar.gettimezone.php                       28-Sep-2020 11:09                7128
intlcalendar.gettype.php                           28-Sep-2020 11:09                5550
intlcalendar.getweekendtransition.php              28-Sep-2020 11:09                4370
intlcalendar.indaylighttime.php                    28-Sep-2020 11:09                8662
intlcalendar.isequivalentto.php                    28-Sep-2020 11:09                8348
intlcalendar.islenient.php                         28-Sep-2020 11:09                8281
intlcalendar.isset.php                             28-Sep-2020 11:09                4416
intlcalendar.isweekend.php                         28-Sep-2020 11:09                8421
intlcalendar.roll.php                              28-Sep-2020 11:09                8953
intlcalendar.set.php                               28-Sep-2020 11:09               13707
intlcalendar.setfirstdayofweek.php                 28-Sep-2020 11:09                7786
intlcalendar.setlenient.php                        28-Sep-2020 11:09                3974
intlcalendar.setminimaldaysinfirstweek.php         28-Sep-2020 11:09                3920
intlcalendar.setrepeatedwalltimeoption.php         28-Sep-2020 11:09                5279
intlcalendar.setskippedwalltimeoption.php          28-Sep-2020 11:09                5989
intlcalendar.settime.php                           28-Sep-2020 11:09                8487
intlcalendar.settimezone.php                       28-Sep-2020 11:09               10356
intlcalendar.todatetime.php                        28-Sep-2020 11:09                6657
intlchar.charage.php                               28-Sep-2020 11:09                5520
intlchar.chardigitvalue.php                        28-Sep-2020 11:09                5130
intlchar.chardirection.php                         28-Sep-2020 11:09                8597
intlchar.charfromname.php                          28-Sep-2020 11:09                6708
intlchar.charmirror.php                            28-Sep-2020 11:09                6161
intlchar.charname.php                              28-Sep-2020 11:09                7038
intlchar.chartype.php                              28-Sep-2020 11:09                8727
intlchar.chr.php                                   28-Sep-2020 11:09                5151
intlchar.digit.php                                 28-Sep-2020 11:09                7757
intlchar.enumcharnames.php                         28-Sep-2020 11:09                7682
intlchar.enumchartypes.php                         28-Sep-2020 11:09                5870
intlchar.foldcase.php                              28-Sep-2020 11:09                3469
intlchar.fordigit.php                              28-Sep-2020 11:09                6847
intlchar.getbidipairedbracket.php                  28-Sep-2020 11:09                5691
intlchar.getblockcode.php                          28-Sep-2020 11:09                5208
intlchar.getcombiningclass.php                     28-Sep-2020 11:09                4517
intlchar.getfc-nfkc-closure.php                    28-Sep-2020 11:09                4347
intlchar.getintpropertymaxvalue.php                28-Sep-2020 11:09                6265
intlchar.getintpropertyminvalue.php                28-Sep-2020 11:09                6258
intlchar.getintpropertyvalue.php                   28-Sep-2020 11:09                7620
intlchar.getnumericvalue.php                       28-Sep-2020 11:09                5087
intlchar.getpropertyenum.php                       28-Sep-2020 11:09                6424
intlchar.getpropertyname.php                       28-Sep-2020 11:09                8089
intlchar.getpropertyvalueenum.php                  28-Sep-2020 11:09                7777
intlchar.getpropertyvaluename.php                  28-Sep-2020 11:09                9776
intlchar.getunicodeversion.php                     28-Sep-2020 11:09                3863
intlchar.hasbinaryproperty.php                     28-Sep-2020 11:09                8485
intlchar.isalnum.php                               28-Sep-2020 11:09                5259
intlchar.isalpha.php                               28-Sep-2020 11:09                5147
intlchar.isbase.php                                28-Sep-2020 11:09                5628
intlchar.isblank.php                               28-Sep-2020 11:09                6336
intlchar.iscntrl.php                               28-Sep-2020 11:09                5936
intlchar.isdefined.php                             28-Sep-2020 11:09                6367
intlchar.isdigit.php                               28-Sep-2020 11:09                5485
intlchar.isgraph.php                               28-Sep-2020 11:09                5177
intlchar.isidignorable.php                         28-Sep-2020 11:09                5760
intlchar.isidpart.php                              28-Sep-2020 11:09                6345
intlchar.isidstart.php                             28-Sep-2020 11:09                5848
intlchar.isisocontrol.php                          28-Sep-2020 11:09                5097
intlchar.isjavaidpart.php                          28-Sep-2020 11:09                6437
intlchar.isjavaidstart.php                         28-Sep-2020 11:09                6136
intlchar.isjavaspacechar.php                       28-Sep-2020 11:09                6372
intlchar.islower.php                               28-Sep-2020 11:09                6649
intlchar.ismirrored.php                            28-Sep-2020 11:09                5209
intlchar.isprint.php                               28-Sep-2020 11:09                5456
intlchar.ispunct.php                               28-Sep-2020 11:09                4924
intlchar.isspace.php                               28-Sep-2020 11:09                6023
intlchar.istitle.php                               28-Sep-2020 11:09                6084
intlchar.isualphabetic.php                         28-Sep-2020 11:09                5437
intlchar.isulowercase.php                          28-Sep-2020 11:09                6421
intlchar.isupper.php                               28-Sep-2020 11:09                6647
intlchar.isuuppercase.php                          28-Sep-2020 11:09                6459
intlchar.isuwhitespace.php                         28-Sep-2020 11:09                6964
intlchar.iswhitespace.php                          28-Sep-2020 11:09                7090
intlchar.isxdigit.php                              28-Sep-2020 11:09                6534
intlchar.ord.php                                   28-Sep-2020 11:09                5088
intlchar.tolower.php                               28-Sep-2020 11:09                7285
intlchar.totitle.php                               28-Sep-2020 11:09                7306
intlchar.toupper.php                               28-Sep-2020 11:09                7283
intlcodepointbreakiterator.getlastcodepoint.php    28-Sep-2020 11:09                2556
intldateformatter.create.php                       28-Sep-2020 11:09               24634
intldateformatter.format.php                       28-Sep-2020 11:09               26651
intldateformatter.formatobject.php                 28-Sep-2020 11:09               13012
intldateformatter.getcalendar.php                  28-Sep-2020 11:09                9171
intldateformatter.getcalendarobject.php            28-Sep-2020 11:09                7022
intldateformatter.getdatetype.php                  28-Sep-2020 11:09               11930
intldateformatter.geterrorcode.php                 28-Sep-2020 11:09                9207
intldateformatter.geterrormessage.php              28-Sep-2020 11:09                9110
intldateformatter.getlocale.php                    28-Sep-2020 11:09               10668
intldateformatter.getpattern.php                   28-Sep-2020 11:09               10490
intldateformatter.gettimetype.php                  28-Sep-2020 11:09               11922
intldateformatter.gettimezone.php                  28-Sep-2020 11:09                8209
intldateformatter.gettimezoneid.php                28-Sep-2020 11:09                8642
intldateformatter.islenient.php                    28-Sep-2020 11:09               15845
intldateformatter.localtime.php                    28-Sep-2020 11:09               11285
intldateformatter.parse.php                        28-Sep-2020 11:09               11811
intldateformatter.setcalendar.php                  28-Sep-2020 11:09               14175
intldateformatter.setlenient.php                   28-Sep-2020 11:09               16515
intldateformatter.setpattern.php                   28-Sep-2020 11:09               11182
intldateformatter.settimezone.php                  28-Sep-2020 11:09               11007
intldateformatter.settimezoneid.php                28-Sep-2020 11:09               10345
intlgregoriancalendar.construct.php                28-Sep-2020 11:09                4790
intlgregoriancalendar.getgregorianchange.php       28-Sep-2020 11:09                2607
intlgregoriancalendar.isleapyear.php               28-Sep-2020 11:09                2732
intlgregoriancalendar.setgregorianchange.php       28-Sep-2020 11:09                2749
intliterator.current.php                           28-Sep-2020 11:09                2305
intliterator.key.php                               28-Sep-2020 11:09                2199
intliterator.next.php                              28-Sep-2020 11:09                2246
intliterator.rewind.php                            28-Sep-2020 11:09                2272
intliterator.valid.php                             28-Sep-2020 11:09                2216
intlpartsiterator.getbreakiterator.php             28-Sep-2020 11:09                2480
intlrulebasedbreakiterator.construct.php           28-Sep-2020 11:09                2852
intlrulebasedbreakiterator.getbinaryrules.php      28-Sep-2020 11:09                2554
intlrulebasedbreakiterator.getrules.php            28-Sep-2020 11:09                2524
intlrulebasedbreakiterator.getrulestatus.php       28-Sep-2020 11:09                2609
intlrulebasedbreakiterator.getrulestatusvec.php    28-Sep-2020 11:09                2612
intltimezone.countequivalentids.php                28-Sep-2020 11:09                2592
intltimezone.createdefault.php                     28-Sep-2020 11:09                2499
intltimezone.createenumeration.php                 28-Sep-2020 11:09                2795
intltimezone.createtimezone.php                    28-Sep-2020 11:09                2655
intltimezone.createtimezoneidenumeration.php       28-Sep-2020 11:09                3375
intltimezone.fromdatetimezone.php                  28-Sep-2020 11:09                2826
intltimezone.getcanonicalid.php                    28-Sep-2020 11:09                2868
intltimezone.getdisplayname.php                    28-Sep-2020 11:09                3009
intltimezone.getdstsavings.php                     28-Sep-2020 11:09                2409
intltimezone.getequivalentid.php                   28-Sep-2020 11:09                2803
intltimezone.geterrorcode.php                      28-Sep-2020 11:09                2775
intltimezone.geterrormessage.php                   28-Sep-2020 11:09                2796
intltimezone.getgmt.php                            28-Sep-2020 11:09                2376
intltimezone.getid.php                             28-Sep-2020 11:09                2257
intltimezone.getidforwindowsid.php                 28-Sep-2020 11:09                3598
intltimezone.getoffset.php                         28-Sep-2020 11:09                3207
intltimezone.getrawoffset.php                      28-Sep-2020 11:09                2364
intltimezone.getregion.php                         28-Sep-2020 11:09                2596
intltimezone.gettzdataversion.php                  28-Sep-2020 11:09                2421
intltimezone.getunknown.php                        28-Sep-2020 11:09                2544
intltimezone.getwindowsid.php                      28-Sep-2020 11:09                3342
intltimezone.hassamerules.php                      28-Sep-2020 11:09                2599
intltimezone.todatetimezone.php                    28-Sep-2020 11:09                2519
intltimezone.usedaylighttime.php                   28-Sep-2020 11:09                2375
intro-whatcando.php                                28-Sep-2020 11:08                8923
intro-whatis.php                                   28-Sep-2020 11:08                4462
intro.apache.php                                   28-Sep-2020 11:09                1069
intro.apcu.php                                     28-Sep-2020 11:08                1378
intro.array.php                                    28-Sep-2020 11:09                1912
intro.bc.php                                       28-Sep-2020 11:09                4519
intro.blenc.php                                    28-Sep-2020 11:08                3363
intro.bzip2.php                                    28-Sep-2020 11:08                1105
intro.calendar.php                                 28-Sep-2020 11:09                2194
intro.classkit.php                                 28-Sep-2020 11:09                1384
intro.classobj.php                                 28-Sep-2020 11:09                1688
intro.cmark.php                                    28-Sep-2020 11:09                6097
intro.com.php                                      28-Sep-2020 11:09                2975
intro.componere.php                                28-Sep-2020 11:08                5972
intro.csprng.php                                   28-Sep-2020 11:08                1552
intro.ctype.php                                    28-Sep-2020 11:09                3146
intro.cubrid.php                                   28-Sep-2020 11:08                1360
intro.curl.php                                     28-Sep-2020 11:09                1530
intro.datetime.php                                 28-Sep-2020 11:09                2368
intro.dba.php                                      28-Sep-2020 11:08                1486
intro.dbase.php                                    28-Sep-2020 11:08                6723
intro.dbplus.php                                   28-Sep-2020 11:08                2374
intro.dbx.php                                      28-Sep-2020 11:08                1733
intro.dio.php                                      28-Sep-2020 11:09                1944
intro.dom.php                                      28-Sep-2020 11:09                1585
intro.ds.php                                       28-Sep-2020 11:09                1344
intro.eio.php                                      28-Sep-2020 11:09               15510
intro.enchant.php                                  28-Sep-2020 11:09                2492
intro.errorfunc.php                                28-Sep-2020 11:08                1941
intro.ev.php                                       28-Sep-2020 11:09                2197
intro.event.php                                    28-Sep-2020 11:09                1867
intro.exec.php                                     28-Sep-2020 11:09                1717
intro.exif.php                                     28-Sep-2020 11:09                1392
intro.expect.php                                   28-Sep-2020 11:09                1314
intro.fann.php                                     28-Sep-2020 11:09                1295
intro.fbsql.php                                    28-Sep-2020 11:08                1781
intro.fdf.php                                      28-Sep-2020 11:09                3855
intro.ffi.php                                      28-Sep-2020 11:08                3116
intro.fileinfo.php                                 28-Sep-2020 11:09                1323
intro.filepro.php                                  28-Sep-2020 11:08                1659
intro.filesystem.php                               28-Sep-2020 11:09                1317
intro.filter.php                                   28-Sep-2020 11:09                2782
intro.fpm.php                                      28-Sep-2020 11:09                1232
intro.ftp.php                                      28-Sep-2020 11:09                1773
intro.funchand.php                                 28-Sep-2020 11:09                1118
intro.gearman.php                                  28-Sep-2020 11:09                1543
intro.gender.php                                   28-Sep-2020 11:09                1231
intro.geoip.php                                    28-Sep-2020 11:09                1453
intro.gettext.php                                  28-Sep-2020 11:09                1515
intro.gmagick.php                                  28-Sep-2020 11:09                1573
intro.gmp.php                                      28-Sep-2020 11:09                3212
intro.gnupg.php                                    28-Sep-2020 11:09                1114
intro.hash.php                                     28-Sep-2020 11:08                1198
intro.hrtime.php                                   28-Sep-2020 11:09                1548
intro.ibase.php                                    28-Sep-2020 11:08                3034
intro.ibm-db2.php                                  28-Sep-2020 11:08                1160
intro.iconv.php                                    28-Sep-2020 11:09                1838
intro.ifx.php                                      28-Sep-2020 11:08                1800
intro.iisfunc.php                                  28-Sep-2020 11:09                1256
intro.image.php                                    28-Sep-2020 11:09                6393
intro.imagick.php                                  28-Sep-2020 11:09                1592
intro.imap.php                                     28-Sep-2020 11:09                1411
intro.info.php                                     28-Sep-2020 11:08                1496
intro.ingres.php                                   28-Sep-2020 11:08                1441
intro.inotify.php                                  28-Sep-2020 11:09                2222
intro.intl.php                                     28-Sep-2020 11:09                4894
intro.json.php                                     28-Sep-2020 11:09                2358
intro.judy.php                                     28-Sep-2020 11:09                1918
intro.ldap.php                                     28-Sep-2020 11:09                4437
intro.libxml.php                                   28-Sep-2020 11:09                1652
intro.lua.php                                      28-Sep-2020 11:09                1152
intro.luasandbox.php                               28-Sep-2020 11:09                2249
intro.lzf.php                                      28-Sep-2020 11:08                1305
intro.mail.php                                     28-Sep-2020 11:09                1111
intro.mailparse.php                                28-Sep-2020 11:09                1818
intro.math.php                                     28-Sep-2020 11:09                1715
intro.maxdb.php                                    28-Sep-2020 11:08                4341
intro.mbstring.php                                 28-Sep-2020 11:09                2652
intro.mcrypt.php                                   28-Sep-2020 11:08                2278
intro.memcache.php                                 28-Sep-2020 11:09                1579
intro.memcached.php                                28-Sep-2020 11:09                1755
intro.memtrack.php                                 28-Sep-2020 11:08                2351
intro.mhash.php                                    28-Sep-2020 11:08                2671
intro.mime-magic.php                               28-Sep-2020 11:09                1857
intro.misc.php                                     28-Sep-2020 11:09                1051
intro.mqseries.php                                 28-Sep-2020 11:09                1623
intro.msql.php                                     28-Sep-2020 11:09                1386
intro.mysql-xdevapi.php                            28-Sep-2020 11:09                1754
intro.mysql.php                                    28-Sep-2020 11:09                1856
intro.mysqli.php                                   28-Sep-2020 11:09                2078
intro.mysqlnd-memcache.php                         28-Sep-2020 11:09                5769
intro.mysqlnd-ms.php                               28-Sep-2020 11:09               12388
intro.mysqlnd-mux.php                              28-Sep-2020 11:09                6134
intro.mysqlnd-qc.php                               28-Sep-2020 11:09                5283
intro.mysqlnd-uh.php                               28-Sep-2020 11:09                5817
intro.mysqlnd.php                                  28-Sep-2020 11:09                1822
intro.ncurses.php                                  28-Sep-2020 11:08                3375
intro.network.php                                  28-Sep-2020 11:09                1074
intro.nsapi.php                                    28-Sep-2020 11:09                1090
intro.oauth.php                                    28-Sep-2020 11:09                1216
intro.oci8.php                                     28-Sep-2020 11:09                1597
intro.opcache.php                                  28-Sep-2020 11:08                1424
intro.openal.php                                   28-Sep-2020 11:08                1162
intro.openssl.php                                  28-Sep-2020 11:08                1589
intro.outcontrol.php                               28-Sep-2020 11:08                1772
intro.paradox.php                                  28-Sep-2020 11:09                1996
intro.parallel.php                                 28-Sep-2020 11:09                6299
intro.parle.php                                    28-Sep-2020 11:09                3321
intro.password.php                                 28-Sep-2020 11:08                1572
intro.pcntl.php                                    28-Sep-2020 11:09                2763
intro.pcre.php                                     28-Sep-2020 11:09                3056
intro.pdf.php                                      28-Sep-2020 11:09                2280
intro.pdo.php                                      28-Sep-2020 11:08                2346
intro.pgsql.php                                    28-Sep-2020 11:09                1527
intro.phar.php                                     28-Sep-2020 11:08                9939
intro.phpdbg.php                                   28-Sep-2020 11:08                5922
intro.pht.php                                      28-Sep-2020 11:09                3560
intro.posix.php                                    28-Sep-2020 11:09                2070
intro.proctitle.php                                28-Sep-2020 11:09                1294
intro.ps.php                                       28-Sep-2020 11:09                1647
intro.pspell.php                                   28-Sep-2020 11:09                1113
intro.pthreads.php                                 28-Sep-2020 11:09                8451
intro.quickhash.php                                28-Sep-2020 11:09                1145
intro.radius.php                                   28-Sep-2020 11:08                2049
intro.rar.php                                      28-Sep-2020 11:08                1434
intro.readline.php                                 28-Sep-2020 11:08                2032
intro.recode.php                                   28-Sep-2020 11:09                2331
intro.reflection.php                               28-Sep-2020 11:09                1771
intro.regex.php                                    28-Sep-2020 11:09                3041
intro.rpminfo.php                                  28-Sep-2020 11:09                1106
intro.rrd.php                                      28-Sep-2020 11:09                1320
intro.runkit7.php                                  28-Sep-2020 11:08                1359
intro.scoutapm.php                                 28-Sep-2020 11:09                1368
intro.sdo-das-xml.php                              28-Sep-2020 11:09                2261
intro.sdo.php                                      28-Sep-2020 11:09                3950
intro.sdodasrel.php                                28-Sep-2020 11:09                6651
intro.seaslog.php                                  28-Sep-2020 11:09                4164
intro.sem.php                                      28-Sep-2020 11:09                3221
intro.session.php                                  28-Sep-2020 11:09                5659
intro.shmop.php                                    28-Sep-2020 11:09                1154
intro.simplexml.php                                28-Sep-2020 11:09                1240
intro.snmp.php                                     28-Sep-2020 11:09                1704
intro.soap.php                                     28-Sep-2020 11:09                1383
intro.sockets.php                                  28-Sep-2020 11:09                2646
intro.sodium.php                                   28-Sep-2020 11:08                 990
intro.solr.php                                     28-Sep-2020 11:09                1668
intro.sphinx.php                                   28-Sep-2020 11:09                1456
intro.spl-types.php                                28-Sep-